| Basic Information | |
|---|---|
| Family ID | F074664 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRLHVRELALVALLAGAPGLAVAADDWQAQVGAALGKTGAA |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.16 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.639 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.336 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.462 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.580 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 7.56 |
| PF00486 | Trans_reg_C | 5.04 |
| PF08521 | 2CSK_N | 2.52 |
| PF09828 | Chrome_Resist | 0.84 |
| PF00873 | ACR_tran | 0.84 |
| PF08281 | Sigma70_r4_2 | 0.84 |
| PF06439 | 3keto-disac_hyd | 0.84 |
| PF02798 | GST_N | 0.84 |
| PF02777 | Sod_Fe_C | 0.84 |
| PF00892 | EamA | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 2.52 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.64 % |
| Unclassified | root | N/A | 3.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003368|JGI26340J50214_10111062 | Not Available | 699 | Open in IMG/M |
| 3300005178|Ga0066688_10625077 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005332|Ga0066388_106560351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 586 | Open in IMG/M |
| 3300005332|Ga0066388_108738546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 503 | Open in IMG/M |
| 3300005435|Ga0070714_100558863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1096 | Open in IMG/M |
| 3300005518|Ga0070699_100342972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1345 | Open in IMG/M |
| 3300005610|Ga0070763_10232345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 993 | Open in IMG/M |
| 3300006028|Ga0070717_11729629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300006794|Ga0066658_10726139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300006954|Ga0079219_12458572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300007788|Ga0099795_10492016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300010048|Ga0126373_10397421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1402 | Open in IMG/M |
| 3300010048|Ga0126373_13249752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300010360|Ga0126372_12892360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300010361|Ga0126378_10921006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 980 | Open in IMG/M |
| 3300010366|Ga0126379_13530891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300010376|Ga0126381_102441598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300010376|Ga0126381_104573374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300010399|Ga0134127_13688118 | Not Available | 503 | Open in IMG/M |
| 3300011120|Ga0150983_12332125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300012361|Ga0137360_10861890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300012582|Ga0137358_10232620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1255 | Open in IMG/M |
| 3300012922|Ga0137394_10269742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1455 | Open in IMG/M |
| 3300012929|Ga0137404_11900590 | Not Available | 554 | Open in IMG/M |
| 3300012960|Ga0164301_10382957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 978 | Open in IMG/M |
| 3300012971|Ga0126369_11622529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300016319|Ga0182033_10956668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
| 3300016319|Ga0182033_11255214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
| 3300016319|Ga0182033_11740381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300016341|Ga0182035_11336627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
| 3300016357|Ga0182032_10143896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1754 | Open in IMG/M |
| 3300016357|Ga0182032_10635936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 891 | Open in IMG/M |
| 3300016371|Ga0182034_11413722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300016387|Ga0182040_11619646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300016404|Ga0182037_11355810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300016404|Ga0182037_11789678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
| 3300016422|Ga0182039_12065995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300016445|Ga0182038_11903403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300021401|Ga0210393_10567248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 927 | Open in IMG/M |
| 3300021407|Ga0210383_10439405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1126 | Open in IMG/M |
| 3300021420|Ga0210394_10070631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3026 | Open in IMG/M |
| 3300021432|Ga0210384_11029514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300021474|Ga0210390_10482571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1045 | Open in IMG/M |
| 3300021478|Ga0210402_10013899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6903 | Open in IMG/M |
| 3300021479|Ga0210410_10456391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1143 | Open in IMG/M |
| 3300021560|Ga0126371_12486623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300021560|Ga0126371_13007513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300025898|Ga0207692_10217826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1130 | Open in IMG/M |
| 3300025906|Ga0207699_11140874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300025915|Ga0207693_10455934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 999 | Open in IMG/M |
| 3300025916|Ga0207663_10488344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 955 | Open in IMG/M |
| 3300027173|Ga0208097_1016165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 830 | Open in IMG/M |
| 3300027174|Ga0207948_1022055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300027174|Ga0207948_1047184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300027548|Ga0209523_1127144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300028047|Ga0209526_10249719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1214 | Open in IMG/M |
| 3300028906|Ga0308309_11470361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300031122|Ga0170822_14065837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300031128|Ga0170823_17532445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300031474|Ga0170818_114490460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300031543|Ga0318516_10552209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300031545|Ga0318541_10209476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1079 | Open in IMG/M |
| 3300031564|Ga0318573_10361003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300031564|Ga0318573_10496880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300031572|Ga0318515_10090142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1599 | Open in IMG/M |
| 3300031573|Ga0310915_10139220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1671 | Open in IMG/M |
| 3300031573|Ga0310915_10922035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300031719|Ga0306917_11322038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300031724|Ga0318500_10474985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300031744|Ga0306918_10454157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC280B00 | 1001 | Open in IMG/M |
| 3300031744|Ga0306918_10780444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300031753|Ga0307477_10527670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
| 3300031764|Ga0318535_10387557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300031768|Ga0318509_10630376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300031770|Ga0318521_10612850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300031770|Ga0318521_10735577 | Not Available | 600 | Open in IMG/M |
| 3300031782|Ga0318552_10150540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1168 | Open in IMG/M |
| 3300031796|Ga0318576_10469354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300031796|Ga0318576_10490497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300031798|Ga0318523_10622982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300031821|Ga0318567_10838121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300031833|Ga0310917_10328588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1036 | Open in IMG/M |
| 3300031845|Ga0318511_10009913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3191 | Open in IMG/M |
| 3300031845|Ga0318511_10153708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
| 3300031846|Ga0318512_10306428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
| 3300031860|Ga0318495_10203840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300031879|Ga0306919_10202488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1476 | Open in IMG/M |
| 3300031879|Ga0306919_11027744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300031894|Ga0318522_10103549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1055 | Open in IMG/M |
| 3300031910|Ga0306923_10535397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1321 | Open in IMG/M |
| 3300031912|Ga0306921_10326143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1797 | Open in IMG/M |
| 3300031912|Ga0306921_12589252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300031941|Ga0310912_10079656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2376 | Open in IMG/M |
| 3300031941|Ga0310912_10346476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1153 | Open in IMG/M |
| 3300031941|Ga0310912_10648251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
| 3300031946|Ga0310910_10909425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300031946|Ga0310910_11247212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300031947|Ga0310909_11660356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300031954|Ga0306926_11222705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300031954|Ga0306926_11742364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300031954|Ga0306926_12360936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300031962|Ga0307479_10112100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2654 | Open in IMG/M |
| 3300032001|Ga0306922_10148917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2501 | Open in IMG/M |
| 3300032001|Ga0306922_11847878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300032010|Ga0318569_10120742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC280B00 | 1194 | Open in IMG/M |
| 3300032039|Ga0318559_10409327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300032041|Ga0318549_10545850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300032042|Ga0318545_10351472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300032051|Ga0318532_10096908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1038 | Open in IMG/M |
| 3300032059|Ga0318533_11039412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300032065|Ga0318513_10541701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300032091|Ga0318577_10255655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
| 3300032091|Ga0318577_10591109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300032160|Ga0311301_10741065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1368 | Open in IMG/M |
| 3300032180|Ga0307471_101111118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 956 | Open in IMG/M |
| 3300032205|Ga0307472_100937104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 805 | Open in IMG/M |
| 3300033289|Ga0310914_11106376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300033290|Ga0318519_10029086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2583 | Open in IMG/M |
| 3300033290|Ga0318519_10312332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 922 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26340J50214_101110623 | 3300003368 | Bog Forest Soil | MGFHLRELALAALLTGASGLALAADDDWQARVGEALGKTGAAAPGG |
| Ga0066688_106250771 | 3300005178 | Soil | MRFHLRQLALVALLAGAPGVAFAADDGWQAQVGAALGKTGSA |
| Ga0066388_1065603512 | 3300005332 | Tropical Forest Soil | MRLHVRELGLVAVLTAAPGLAVAADDWQAQVGEALGKSGATAP |
| Ga0066388_1087385462 | 3300005332 | Tropical Forest Soil | MTMRLHGRAFALSALLAGAPGLAVAADDWQAQVGKALGKTGAAAPGGIY* |
| Ga0070714_1005588631 | 3300005435 | Agricultural Soil | MRFHLRQLALVALLAGAPGVAFAADDGWQAQVGAALEKTGSAAPGGIYRVG |
| Ga0070699_1003429721 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MWLHVRELAIVALVAGSPSLAVAADNWQAQVGEALGKTGATATGGIYR |
| Ga0070763_102323451 | 3300005610 | Soil | MKHHLRQLTLAAALVAAAPGAVFADDWQTQVGEALGKTGSAAPG |
| Ga0070717_117296291 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFHLRQLALVALLAGAPGVAFAADDGWQAQVGAALEKTGSAAPGGIYRV |
| Ga0066658_107261391 | 3300006794 | Soil | MRFHLKQLALLVLAGAPGVAFAADNGWQAQVAAALGKTGSAAPGDIYRVG |
| Ga0079219_124585721 | 3300006954 | Agricultural Soil | MCLHLRQLALVALVAGAPGLAVAADDGWQAQVGETLGKTG |
| Ga0099795_104920161 | 3300007788 | Vadose Zone Soil | MKYHLRQLTLAALLAAAPSAAFAADDGWEAEVGQALGKTGSA |
| Ga0126373_103974213 | 3300010048 | Tropical Forest Soil | MRLQVKELALVALLVGAPGLAVAADDWQAQVGEALGKTGATTPS |
| Ga0126373_132497522 | 3300010048 | Tropical Forest Soil | MTMRLHLRQLALVAFVAGAPGLAVAADDWQAQVGEALGKT |
| Ga0126372_128923602 | 3300010360 | Tropical Forest Soil | MRLHVKELVLVALLAGAPGLAVAADDWQAQVGEALGKTGAT |
| Ga0126378_109210061 | 3300010361 | Tropical Forest Soil | MRFNLRRLALSALLTGAPGLAIAADDWQTQVGEALGKPGTTAPGGI |
| Ga0126379_135308911 | 3300010366 | Tropical Forest Soil | MTMRLHVREFALAALLAGAPGVAVAADDWQGQVSEALGKTGAAAPGGIYRV |
| Ga0126381_1024415981 | 3300010376 | Tropical Forest Soil | MRLHLREMALAALLAGAPGVAVAADDWQAQVGQALGKTGASTP |
| Ga0126381_1045733742 | 3300010376 | Tropical Forest Soil | MKSYAQKLAVALVLVGMPGLAFAADDGWQAEVGKALGKTGAA |
| Ga0134127_136881182 | 3300010399 | Terrestrial Soil | MMRINLRKMALAVLLAGAPGLAFAADNGWQAQVGEALGK |
| Ga0150983_123321251 | 3300011120 | Forest Soil | MWLYVREFVLVALLAGAPGLAVAADDWHAQVGEAL |
| Ga0137360_108618902 | 3300012361 | Vadose Zone Soil | MMMRFHLRKLALAALLIGGSGVAFADDWQTQVGEALGKTGSAA |
| Ga0137358_102326203 | 3300012582 | Vadose Zone Soil | MIMWFHLRQLAVAALFATAPCVAFADEWQAQVGEALGKTG |
| Ga0137394_102697424 | 3300012922 | Vadose Zone Soil | MKYHLRQLTLAALVAAAPGAAVAADDGWQAQVGQALGKTGSAAPGGVYRV |
| Ga0137404_119005902 | 3300012929 | Vadose Zone Soil | MTMKVYVRKLALAALLAGAPSLAFAADDGWETRVGEALGKTG |
| Ga0164301_103829571 | 3300012960 | Soil | MKFHLRHLTLAALLAAAPGAAFAADDGWQAQVGEALGKTGSVAPGGVYRVG |
| Ga0126369_116225291 | 3300012971 | Tropical Forest Soil | MKVHLRQLTLAALLAGVPSAAFAADDGWQAQVGEAL |
| Ga0182033_109566681 | 3300016319 | Soil | MRLHVRELALAALLAGTPGLGIAADDWQAQVGEALGKAGAT |
| Ga0182033_112552142 | 3300016319 | Soil | MRFYVRELALVAVLTAAPGIAVAADDWQAQVGEALGKS |
| Ga0182033_117403812 | 3300016319 | Soil | MRSHLQWLAVVALLAGAPGPAVAADDWQTQVGEALGKTGAAAAGGIYRVG |
| Ga0182035_113366272 | 3300016341 | Soil | MKFHLRELVLAASFAGMPGLAVAADDGWQAQVGKALGKTGANMPGGIY |
| Ga0182032_101438963 | 3300016357 | Soil | MRLHVRELALVALLAGAPGLAVAADDWQAQVGAALGKTGAAAPGG |
| Ga0182032_106359361 | 3300016357 | Soil | MRFYVRELALVAVLTAAPGIAVAADDWQAQVGEALGKSGATAPGGI |
| Ga0182034_114137221 | 3300016371 | Soil | MWLHLRQLALAALLAGAPGISAAADDWQAEVGEALGKTGATAPGG |
| Ga0182040_116196462 | 3300016387 | Soil | MRSHLQWLAVVALLAEAPGPAVAADDWQTQVGEALGKTGAAAAGGIY |
| Ga0182037_113558101 | 3300016404 | Soil | MRLHVRELALVAVLTAAPGLAVAGDDWHAQVGEALGKS |
| Ga0182037_117896781 | 3300016404 | Soil | MRFYVRELALVAVLTAAPGIAVAADDWQAQVGEALGKSGATAP |
| Ga0182039_120659952 | 3300016422 | Soil | MTMWSHLRQLALVAFAAGAPGLAVAADDWQAQVGEALGKTGATTPGG |
| Ga0182038_119034032 | 3300016445 | Soil | MRLHVRKLALVALLAGAPVLAVAADDWQTQVGQALGKTGA |
| Ga0210393_105672481 | 3300021401 | Soil | MWLYVREFVLVALLAGAPGLAVAADDWHAQVGEALGKTG |
| Ga0210383_104394051 | 3300021407 | Soil | MKHHLRQLTLAAALVAAAPGAVFADDWQTQVGEALGKTA |
| Ga0210394_100706311 | 3300021420 | Soil | MKYHLRQLTLAALVAAAPGAAVAADDGWQAQVGQALGKTGSAAP |
| Ga0210384_110295142 | 3300021432 | Soil | MWFNLRELAVAALFAAAPGAAFAADEWQAQVGEALGKTGTTTPSGIYR |
| Ga0210390_104825711 | 3300021474 | Soil | MKHHLRQLTLAAALVAAAPGAVFADDWQTQVGEALGKTGSAAPGGIYR |
| Ga0210402_100138998 | 3300021478 | Soil | MWLHVRQLAIVALVAGSPSLAVAADDWQAQVGEALGKTGATAAG |
| Ga0210410_104563911 | 3300021479 | Soil | MPLRVRRLALVALLAAAPGIAAAADDWQAQVGEALG |
| Ga0126371_124866232 | 3300021560 | Tropical Forest Soil | MKFQLLKLALLALLAGAPSLAFAADDWQAQVGQALGKTGSAAPG |
| Ga0126371_130075132 | 3300021560 | Tropical Forest Soil | MRLHVRELALVAVLTAAPGTAVAADDWQAQVGEALGKS |
| Ga0207692_102178263 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MWLYVREFVLVALLAGAPGLAVAADDWHAQVGEALGKTGAAAPGGIYRVGL |
| Ga0207699_111408741 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYHLRQLTLAALLAAAPGAAFAADDGWQAQVGQAL |
| Ga0207693_104559341 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFNLRQLLLAAVLAGGSSAAVAADDGWQAQVGEALGKTGSAMPGGVYWVG |
| Ga0207663_104883441 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFHLRQLAVAALFAAAPGVAFAADEWQAQVGEALGKTGTTTPSGIYRVG |
| Ga0208097_10161651 | 3300027173 | Forest Soil | MKHHLRQLTLAAALVAAAPGAVFADDWQTQVGEALGKTG |
| Ga0207948_10220552 | 3300027174 | Forest Soil | MKHHLRQLTLAAALVAAAPGAVFADDWQTQVGEALGKTGSAA |
| Ga0207948_10471841 | 3300027174 | Forest Soil | MWLHVRRLAIVAIVAGSPSLAVAADDWQAQVGEALGKTGATAAGGIYRV |
| Ga0209523_11271442 | 3300027548 | Forest Soil | MWLHVRQLAIVALVAASPSLAVAADDWQAQVGAALGKT |
| Ga0209526_102497191 | 3300028047 | Forest Soil | MTLRLRELALVAVLAAAPGLAVAADDWQAQVGEALG |
| Ga0308309_114703612 | 3300028906 | Soil | MWFQLRQLGLAALFAGSPGLAFAADDWQAQVAEAL |
| Ga0170822_140658371 | 3300031122 | Forest Soil | MRLHVRELAFTALLAAGPSLAVAADDWQAQVGAALGKTGATAPGGIYRVGLP |
| Ga0170823_175324452 | 3300031128 | Forest Soil | MRFDLRQLAFAALLAGAPGLVFAADDWQAQVGEALGKTGA |
| Ga0170818_1144904601 | 3300031474 | Forest Soil | MRLLVRVLALVAFIAVAPGLAVAADDWQAQVGEALGKTGS |
| Ga0318516_105522092 | 3300031543 | Soil | MWLHLRQLALLAIVAGAPGVAIAADDWQAQVGDALGK |
| Ga0318541_102094763 | 3300031545 | Soil | MWLHARGLALVAVLAGAPGVAVAADDWQTQVGEALGKTGAAAGGVYRVGL |
| Ga0318573_103610031 | 3300031564 | Soil | MRLYVRELALVAVLAAAPGLAVAADDWQAQVGAALGKTGTTAPGG |
| Ga0318573_104968801 | 3300031564 | Soil | MWSHLKQLTLAVLLAGAPGVAVAADDWQTQVGEALGKTGAAAPG |
| Ga0318515_100901421 | 3300031572 | Soil | MRFDLRQLALVALVAGAPGLAVAADEWQGQVGEALGKTGATTPAGIYRVGLP |
| Ga0310915_101392201 | 3300031573 | Soil | MWLHLRQLALLAIVAGAPGVAIAADDWQAQVGEALGKTGATTPGGIYRV |
| Ga0310915_109220351 | 3300031573 | Soil | MGLHVRELALIALLAAAPGLAAAADDWQAQVGEALGKTGATTPSGIYRVG |
| Ga0306917_113220382 | 3300031719 | Soil | MWLHVRQLALAALVVGAPGLAVAADDWQAQVGEALGKTGATT |
| Ga0318500_104749852 | 3300031724 | Soil | MWLPARGLALVAVLAGAPGVAVAADDWQTQVGEALGKTGAAAAGGIYRVG |
| Ga0306918_104541571 | 3300031744 | Soil | MWLHVRQLALVALLAGAPSLAVAADDWQAQVGEALGKTGATAAGGIYRV |
| Ga0306918_107804441 | 3300031744 | Soil | MRLHVRELALVAVLTAAPGIAVAADDWQAQVGEALGKSGATA |
| Ga0307477_105276701 | 3300031753 | Hardwood Forest Soil | MWFNLRELAVAALFAAAPGAAFAADEWQAQVGEALGKT |
| Ga0318535_103875571 | 3300031764 | Soil | MRLHVREFAVAALLAGAPGLAVAADDWQAQVGEALGKTGG |
| Ga0318509_106303762 | 3300031768 | Soil | MWLHARGLALVAVLAGAPGVAVAADDWQTQVGEALGKTGAAAAGG |
| Ga0318521_106128502 | 3300031770 | Soil | MSLHVRELALVALLAGAPGVAVAADDWQTQVGEALGKTGATVPGGIY |
| Ga0318521_107355771 | 3300031770 | Soil | MWLHVREVALIALLTGSPGLAVAADDWQAQVGAALGKT |
| Ga0318552_101505401 | 3300031782 | Soil | MRLNVRELALAALQAGAPGLAVAADDWQAQVGQALGKTGAAA |
| Ga0318576_104693542 | 3300031796 | Soil | MWLHLRQVALVALLAGAPGLAVAADDWQTQVGEALGKPGATAPGGIY |
| Ga0318576_104904972 | 3300031796 | Soil | MTLHVRKLALVALLAGAPGTAVAADDWQAQVGATLGKS |
| Ga0318523_106229822 | 3300031798 | Soil | MWLHVRESALVALLAAAPGLAVAADDWQAQVGEGLGKTGAPAPGGIYR |
| Ga0318567_108381211 | 3300031821 | Soil | MRLHVPELALVALLAGAPGLAVAADDWQAQVGTALGKTGAAAPGGIY |
| Ga0310917_103285883 | 3300031833 | Soil | MRLHVRELALVALLAGAPGLAVAADDWQAQVGEALGKTGAMAPGG |
| Ga0318511_100099131 | 3300031845 | Soil | MRLNVRELALAALLAGAPGLAVAADDWQAQVGQALGKTGAAAPGGIYR |
| Ga0318511_101537081 | 3300031845 | Soil | MRLHVPELALVALLAGAPGLAVAADDWQAQVGTALGK |
| Ga0318512_103064282 | 3300031846 | Soil | MRLHVRQLALVVVLAAAPGLAVAADDWQAQVGAALGKTGATA |
| Ga0318495_102038401 | 3300031860 | Soil | MRFYVRELALVAVLTAAPGIAVAADDWQAQVGEALG |
| Ga0306919_102024881 | 3300031879 | Soil | MRLHVRELALVAVLTATPGIAVAADDWQAQVGEALGKS |
| Ga0306919_110277441 | 3300031879 | Soil | MTRWLHVRQFALVDCVAGAPGLAVAADDWQAQVGEA |
| Ga0318522_101035493 | 3300031894 | Soil | MRLNVRELALAALLAGAPGLAVAADDWQAQVGQALGKTGAAAP |
| Ga0306923_105353971 | 3300031910 | Soil | MWLHARGLALVAVLAGAPGVAVAADDWQTQVGEALGKTGAAAGGV |
| Ga0306921_103261431 | 3300031912 | Soil | MRLHLRQLVLVALIGGAPGLAVAADDWQAQVGEALGKAGATA |
| Ga0306921_125892521 | 3300031912 | Soil | MRLHLRALALAALLTEASGLAVAADDWQAQVGEALG |
| Ga0310912_100796561 | 3300031941 | Soil | MRFYVRELALVAVLTAAPGIAVAADDWQAQVGEALGKSGATAPGG |
| Ga0310912_103464763 | 3300031941 | Soil | MWLHARGFALVAVLAGAPGVAVAADDWQTQVGEALGKTGAAAAGGIYRVG |
| Ga0310912_106482511 | 3300031941 | Soil | MRLHVRKLALVALLAGAPGLAVAADDWQTQVGQALGKTGATAPGGIYRVG |
| Ga0310910_109094251 | 3300031946 | Soil | MWLHLRQLALAALLAGAPGISAAGDDWQTQVGEALGKSGT |
| Ga0310910_112472122 | 3300031946 | Soil | MRLHVREVALVALLAGAPGVAVAADDWQEQVGAALGKT |
| Ga0310909_116603562 | 3300031947 | Soil | MRLHVRGLALAALLAGAPGLAVAADDWQTQVGQALGKT |
| Ga0306926_112227051 | 3300031954 | Soil | MRLHVRGLALAALLAGAPGLAVAADDWQTQVGQALGKTGATAP |
| Ga0306926_117423642 | 3300031954 | Soil | MRLHVRELALIALLAGAPGLAVAADDWQAQVGEALG |
| Ga0306926_123609361 | 3300031954 | Soil | MRLHVRKLALVALLAGAPGLAVAADDWQAQVGAALGKTGATAP |
| Ga0307479_101121004 | 3300031962 | Hardwood Forest Soil | MWLYVREFVLVALLAGAPGLAVAADDWHAQVGEALGKTGAA |
| Ga0306922_101489171 | 3300032001 | Soil | MWLHLRQLALLAIVAGAPGVAIAADDWQAQVGEALGKTGATTP |
| Ga0306922_118478782 | 3300032001 | Soil | MRLHLREVALVALLAGAPGVAVAADDWQEQVGAALGKTGVAAPGGIYRIGL |
| Ga0318569_101207421 | 3300032010 | Soil | MWLHVRHLALVALVAGAPSLAVAADDWQAQVGEALGKTGATTPSGIYRVGL |
| Ga0318559_104093272 | 3300032039 | Soil | MWLHVRQLALVALLAGAPSLAVAADDWQAQVGEALGKTGATAAGGIYRVG |
| Ga0318549_105458502 | 3300032041 | Soil | MRLHVRELALVALLAGAPGLAVAADDWQAQVGAALG |
| Ga0318545_103514722 | 3300032042 | Soil | MRLHVPELALVALLAGAPGLAVAADDWQAQVGTALG |
| Ga0318532_100969081 | 3300032051 | Soil | MRFYVRELALVAVLTAAPGIAVAADDWQAQVGEALGK |
| Ga0318533_110394122 | 3300032059 | Soil | MSLHVRELALVALLAGAPGVAVAADDWQTQVGEALGKTGATVPGGIYRVGL |
| Ga0318513_105417012 | 3300032065 | Soil | MRLHVRELALVALLAGAPGLAVAADDWQAQVGAALGKTGAA |
| Ga0318577_102556553 | 3300032091 | Soil | MWLHLRQVALVALLAGAPGLAVAADDWQTQVGEALGKTGATAPGGIYRV |
| Ga0318577_105911092 | 3300032091 | Soil | MWLHLRQLALVVLVAGAPGLAGAADDWQAQVGEALGKTG |
| Ga0311301_107410651 | 3300032160 | Peatlands Soil | MEFSMRILALAALLAGAPALALAADDDWQAQVGQALGKT |
| Ga0307471_1011111183 | 3300032180 | Hardwood Forest Soil | MKYHLRQLTLAAFVAAAPGAAFAADDGWQVRVGEALGKTGSAT |
| Ga0307472_1009371041 | 3300032205 | Hardwood Forest Soil | MGLQMRQLALVALVAGTPGLAVAADDWQAQVGEALGKAGA |
| Ga0310914_111063761 | 3300033289 | Soil | MQLHLRQLALVAFAAGAPGLAVAADDWQAQVGEALGKTGATTPGGIYR |
| Ga0318519_100290861 | 3300033290 | Soil | MSLHVRELALVALLAGAPGVAVAADDWQTQVGEALGKTGATVPGGIYRVG |
| Ga0318519_103123322 | 3300033290 | Soil | MWLHLRQLALLAIVAGAPGVAIAADDWQAQVGDALGKTGATTPGGIYRVG |
| ⦗Top⦘ |