| Basic Information | |
|---|---|
| Family ID | F074642 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 40 residues |
| Representative Sequence | KVGPLSRLADAARTFVVLNSAALVAFVNFVTGRKAVWVR |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.69 % |
| % of genes near scaffold ends (potentially truncated) | 95.80 % |
| % of genes from short scaffolds (< 2000 bps) | 87.39 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.118 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.244 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.210 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.176 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF13692 | Glyco_trans_1_4 | 13.45 |
| PF04932 | Wzy_C | 9.24 |
| PF13439 | Glyco_transf_4 | 8.40 |
| PF13231 | PMT_2 | 6.72 |
| PF08241 | Methyltransf_11 | 4.20 |
| PF02397 | Bac_transf | 1.68 |
| PF13579 | Glyco_trans_4_4 | 1.68 |
| PF01451 | LMWPc | 0.84 |
| PF13433 | Peripla_BP_5 | 0.84 |
| PF13489 | Methyltransf_23 | 0.84 |
| PF13537 | GATase_7 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 9.24 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.12 % |
| Unclassified | root | N/A | 5.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002074|JGI24748J21848_1013718 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300002917|JGI25616J43925_10398643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300004092|Ga0062389_102080380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300004152|Ga0062386_101488771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300005166|Ga0066674_10448598 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005435|Ga0070714_101205113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300005467|Ga0070706_101719185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300005591|Ga0070761_10426127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 812 | Open in IMG/M |
| 3300005938|Ga0066795_10205716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
| 3300006052|Ga0075029_100498832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300006059|Ga0075017_100367174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1074 | Open in IMG/M |
| 3300006102|Ga0075015_100466567 | Not Available | 722 | Open in IMG/M |
| 3300006796|Ga0066665_10241887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1423 | Open in IMG/M |
| 3300007258|Ga0099793_10223411 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300009012|Ga0066710_103361035 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300009519|Ga0116108_1121924 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300009519|Ga0116108_1259915 | Not Available | 507 | Open in IMG/M |
| 3300009523|Ga0116221_1110707 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300009547|Ga0116136_1123972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300009547|Ga0116136_1194559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300009616|Ga0116111_1122717 | Not Available | 636 | Open in IMG/M |
| 3300009683|Ga0116224_10025229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2925 | Open in IMG/M |
| 3300009698|Ga0116216_10235991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
| 3300010304|Ga0134088_10040921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2112 | Open in IMG/M |
| 3300010343|Ga0074044_10011186 | All Organisms → cellular organisms → Bacteria | 6797 | Open in IMG/M |
| 3300010343|Ga0074044_10130588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1685 | Open in IMG/M |
| 3300010358|Ga0126370_11317057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300010358|Ga0126370_12414227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300010366|Ga0126379_13104537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300010379|Ga0136449_104517415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010866|Ga0126344_1107447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300011271|Ga0137393_10000610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 21570 | Open in IMG/M |
| 3300012208|Ga0137376_11098227 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012208|Ga0137376_11540397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300012210|Ga0137378_10100433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2655 | Open in IMG/M |
| 3300012469|Ga0150984_105782776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2907 | Open in IMG/M |
| 3300012927|Ga0137416_10522962 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300012957|Ga0164303_11361454 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012987|Ga0164307_11814410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300014160|Ga0181517_10441284 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300014200|Ga0181526_10362414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
| 3300014501|Ga0182024_12756437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300016319|Ga0182033_10506424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300017927|Ga0187824_10262149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300017930|Ga0187825_10152453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300017933|Ga0187801_10091238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1148 | Open in IMG/M |
| 3300017933|Ga0187801_10175705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300017936|Ga0187821_10032270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1851 | Open in IMG/M |
| 3300017946|Ga0187879_10104044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1626 | Open in IMG/M |
| 3300017998|Ga0187870_1201728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300018002|Ga0187868_1169484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300018006|Ga0187804_10089894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1250 | Open in IMG/M |
| 3300018007|Ga0187805_10417247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300018008|Ga0187888_1094350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
| 3300018024|Ga0187881_10187077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300018028|Ga0184608_10492821 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300018040|Ga0187862_10041704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3387 | Open in IMG/M |
| 3300018057|Ga0187858_10184304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1371 | Open in IMG/M |
| 3300018086|Ga0187769_10561132 | Not Available | 863 | Open in IMG/M |
| 3300018088|Ga0187771_10075883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2666 | Open in IMG/M |
| 3300018090|Ga0187770_11455032 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300020199|Ga0179592_10077214 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300020582|Ga0210395_10683633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300021180|Ga0210396_10362640 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300021181|Ga0210388_10550774 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300021402|Ga0210385_10270053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1254 | Open in IMG/M |
| 3300021433|Ga0210391_10156433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1794 | Open in IMG/M |
| 3300021433|Ga0210391_10619946 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300021433|Ga0210391_10702545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300021433|Ga0210391_10836014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300021478|Ga0210402_10332564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1408 | Open in IMG/M |
| 3300021559|Ga0210409_11231138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300022716|Ga0242673_1068775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300022873|Ga0224550_1037999 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300025434|Ga0208690_1016687 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300025480|Ga0208688_1072122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300025910|Ga0207684_10788392 | Not Available | 804 | Open in IMG/M |
| 3300025913|Ga0207695_10132296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2451 | Open in IMG/M |
| 3300025913|Ga0207695_10858679 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300025916|Ga0207663_11691897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300026067|Ga0207678_10028133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4909 | Open in IMG/M |
| 3300026075|Ga0207708_11669432 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300026142|Ga0207698_10528787 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300026271|Ga0209880_1081906 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300026322|Ga0209687_1215571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300027497|Ga0208199_1053575 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300027767|Ga0209655_10243000 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300027846|Ga0209180_10646266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300027875|Ga0209283_10172204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1437 | Open in IMG/M |
| 3300028748|Ga0302156_10434517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300028873|Ga0302197_10318269 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300028906|Ga0308309_11620921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300029817|Ga0247275_1009989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3608 | Open in IMG/M |
| 3300029954|Ga0311331_11092670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300030007|Ga0311338_10165249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2608 | Open in IMG/M |
| 3300030020|Ga0311344_11111774 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300030041|Ga0302274_10042617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2748 | Open in IMG/M |
| 3300030042|Ga0302300_1124974 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300030043|Ga0302306_10263364 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300030494|Ga0310037_10137754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
| 3300030509|Ga0302183_10057299 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300030617|Ga0311356_10518009 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300031028|Ga0302180_10422749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300031122|Ga0170822_14059506 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300031231|Ga0170824_120404651 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300031232|Ga0302323_101270684 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031234|Ga0302325_11334888 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300031261|Ga0302140_10056204 | All Organisms → cellular organisms → Bacteria | 4252 | Open in IMG/M |
| 3300031474|Ga0170818_114425939 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031524|Ga0302320_10519223 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300031718|Ga0307474_10310743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1215 | Open in IMG/M |
| 3300031720|Ga0307469_11352206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300031962|Ga0307479_11655442 | Not Available | 594 | Open in IMG/M |
| 3300032401|Ga0315275_12744708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300032805|Ga0335078_11687059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300033888|Ga0334792_102550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300034124|Ga0370483_0048130 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300034163|Ga0370515_0481420 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.88% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.36% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.52% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.68% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.68% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.84% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24748J21848_10137181 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | FNRAADAALTFVVLNTAAVVAFAKFVTGRKVVWAR* |
| JGI25616J43925_103986431 | 3300002917 | Grasslands Soil | LKKGPLTRMTDAAFTFVMLNTAALLAFANXVTGRKAVWXR* |
| Ga0062389_1020803801 | 3300004092 | Bog Forest Soil | SPLKIGLLKRLGDTALTFVVLNTAAAVAFANFVLGRKVAWTR* |
| Ga0062386_1014887711 | 3300004152 | Bog Forest Soil | LTALAGARIGPLLRIADPARTFVVLNSAALVAFINFVTGRKAVWVR* |
| Ga0066674_104485982 | 3300005166 | Soil | KVLKGPLARVGDAARTFVVLNSAAAVAFVKFVTGRRVAWVRQAETF* |
| Ga0070714_1012051132 | 3300005435 | Agricultural Soil | VKMGPIARAGDAAFTFVVLNTAAMVAFANFVARRKVAWTR* |
| Ga0070706_1017191852 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KKGPLTRLTDAAFTFVMLNTAALLAFANFVTGRKAVWLR* |
| Ga0070761_104261271 | 3300005591 | Soil | ARMAGVASTFVMLNAAAVVAFANFVSGRKVAWNR* |
| Ga0066795_102057162 | 3300005938 | Soil | AALSGFKLGPLSRLADPARTFVILNCAALVAFINFATGRKAVWLR* |
| Ga0075029_1004988321 | 3300006052 | Watersheds | AGMRMGPLARIGDAALTFVVLNTAAVVAFANFVMGKKVAWTR* |
| Ga0075017_1003671741 | 3300006059 | Watersheds | VGMAGVKIGPLSRVADPARTFVVLNCAALVAFVNFLVGRKAVWVR* |
| Ga0075015_1004665672 | 3300006102 | Watersheds | SRLGDAAYTFVVLNLAALVAFANFVTKRRVAWSR* |
| Ga0066665_102418871 | 3300006796 | Soil | KGPVARAADAAFTFVVLNTAAIVAFANFITGRRAVWGR* |
| Ga0099793_102234111 | 3300007258 | Vadose Zone Soil | LAGVKIGPLSRIADPARTFVVLNSAAIVAFINFVTGRKAIWVR* |
| Ga0066710_1033610351 | 3300009012 | Grasslands Soil | DAARTFVVLNSAAAVAFVKFVTGRRVAWVRQAETF |
| Ga0116108_11219241 | 3300009519 | Peatland | LSRIADPARTFVVLNSAALVAFINFVTGRKAVWVR* |
| Ga0116108_12599151 | 3300009519 | Peatland | GPLSRITDPARTFVILNCAAMVAFINFATGRKAVWVR* |
| Ga0116221_11107071 | 3300009523 | Peatlands Soil | ARIGPLSRIADPARTFVVLNSAAMVAFINFVTGRKAVWVR* |
| Ga0116136_11239721 | 3300009547 | Peatland | RGFVSRMADAAFTFVVLNTAAVVAFGKFVTGRNIEWSR* |
| Ga0116136_11945592 | 3300009547 | Peatland | ALFKRQCGPLTRVANAALTLIVLNTAAVVAFANFVTGRKEVWVR* |
| Ga0116111_11227173 | 3300009616 | Peatland | LAALAGVKLGPLSRIADPARTFVILNCAAMVAFINFATGRKAVWVR* |
| Ga0116224_100252291 | 3300009683 | Peatlands Soil | LAGVKIGPLSRIADPARTFVVLNSAALVAFINFVTGRKAVWVR* |
| Ga0116216_102359912 | 3300009698 | Peatlands Soil | RRGPIARMADAALTFVVLNTAALVAFANFVTGRKAVWAR* |
| Ga0134088_100409213 | 3300010304 | Grasslands Soil | RLTRGPVTQLADAALTFVTLNTAAVVAFVNFVTGRKAVWLR* |
| Ga0074044_100111866 | 3300010343 | Bog Forest Soil | LARMSDAALTFVVLNGAAAVAFVNFLTGRKAVWVR* |
| Ga0074044_101305883 | 3300010343 | Bog Forest Soil | IGPLSRVADPARTFVVLNSAAMVAFFNFITGRKAIWVR* |
| Ga0126370_113170571 | 3300010358 | Tropical Forest Soil | APAKLRLGTLTRAADAAFTFVVLNTAALVAFLNFISGRKAVWTR* |
| Ga0126370_124142272 | 3300010358 | Tropical Forest Soil | GPLSRAADAARTVVLLNSAALVAFVNFVTGRRAVWVR* |
| Ga0126379_131045371 | 3300010366 | Tropical Forest Soil | LADAAFTFVLLNAAAFVAFANFVGGREIIWARGG* |
| Ga0136449_1045174151 | 3300010379 | Peatlands Soil | GPLSRVADAARTFVVLNSAALMAFLNFVTGRKTVWVR* |
| Ga0126344_11074471 | 3300010866 | Boreal Forest Soil | QIKPGIVSRVADAALTFVVLNTAAVFAFMNFVRGRTAAWNS* |
| Ga0137393_100006106 | 3300011271 | Vadose Zone Soil | MRMTGAAFTFIMLNTAALLAFANFVSERKAVWLRL* |
| Ga0137376_110982272 | 3300012208 | Vadose Zone Soil | VLARMADAAFTFVILNTAALVAFANFVTGRKAVWIR* |
| Ga0137376_115403971 | 3300012208 | Vadose Zone Soil | LKPSILGRTADAAFTFVVLNTAAVVAFGNFVTGRKAAWGR* |
| Ga0137378_101004333 | 3300012210 | Vadose Zone Soil | KGVLARMADAAFTFVILNTAAFVAFATFVTGRKVVWIR* |
| Ga0150984_1057827761 | 3300012469 | Avena Fatua Rhizosphere | ATLHIRGPLARLTDGAYTFVMLNAAALVAFANFVTGRKAAWSR* |
| Ga0137416_105229622 | 3300012927 | Vadose Zone Soil | KIGPLSRIADPARTFVVLNSAALVAFVNFVTGRKAVWVR* |
| Ga0164303_113614542 | 3300012957 | Soil | GVKLGPVARVGDAAFTFLVLNTAALVAFANFVTGRKAVWIR* |
| Ga0164307_118144102 | 3300012987 | Soil | LLARGADAAFTFVLLNAAALVAFGKFVSGRKPVWTR* |
| Ga0181517_104412841 | 3300014160 | Bog | ALGGIKVGPLSRLADAARTFVVLNSAALVAFVNFATGRKAVWVR* |
| Ga0181532_106514261 | 3300014164 | Bog | TGDWLRRAANAAFTFVMLNTAALVALGYFVGRKRGVWIK* |
| Ga0181526_103624141 | 3300014200 | Bog | LERMSDAALTFVVLNSAAAVAFVNFLTGRKAVWIR* |
| Ga0182024_127564372 | 3300014501 | Permafrost | LARMSDAALTFVVLNSAAAVAFVNFLTGRKAVWIR* |
| Ga0182033_105064242 | 3300016319 | Soil | GLLARMADAAFTFVVLNMAAVVAFANFVMGRKAAWDR |
| Ga0187824_102621492 | 3300017927 | Freshwater Sediment | LARIADAALTFVVLNTAAAVAFANFVTGRKAAWNR |
| Ga0187825_101524532 | 3300017930 | Freshwater Sediment | LRRGPLARISDAALTFVVLNSAAVMAFVNFLTGRKTVWATR |
| Ga0187801_100912381 | 3300017933 | Freshwater Sediment | LRTKIGPFDRAADAAFTFVLLNAAAVVAFANFVTGRKAAWVR |
| Ga0187801_101757052 | 3300017933 | Freshwater Sediment | PLTRIADAALTFVLLNTAALVAFANFVTGRKVAWTR |
| Ga0187821_100322701 | 3300017936 | Freshwater Sediment | SLAGLAGVKLGPVARAGDAAFTFVVLNTAAVVAFANFVTGRKVAWTR |
| Ga0187879_101040441 | 3300017946 | Peatland | KVGPLSRLADAARTFVVLNSAALVAFVNFATGRKAVWVR |
| Ga0187870_12017282 | 3300017998 | Peatland | KRGFVARMADAAFTFVALNTAAVVAFGKFVTGRNIEWSR |
| Ga0187868_11694841 | 3300018002 | Peatland | LSRIADPARTFVVLNSAAMVAFINFVTGRKAVWIRDPA |
| Ga0187804_100898941 | 3300018006 | Freshwater Sediment | TKIGPFDRAADAAFTFVLLNAAAVVAFANFVTGRKAAWVR |
| Ga0187805_104172472 | 3300018007 | Freshwater Sediment | LRLPKPGVIARAADAAATFVVLNTAALVAFANFVSGRKPAWSR |
| Ga0187888_10943502 | 3300018008 | Peatland | LALLRLNRGPLERMADASLTFVLLNTAAAVAFANFITGRRPAWDR |
| Ga0187881_101870771 | 3300018024 | Peatland | RLKRGFVSRMADAAFTFVVLNTAAVVAFGKFVTGRNIEWSR |
| Ga0184608_104928212 | 3300018028 | Groundwater Sediment | QMKRGVLARMADAAFTFVILNTAAVVAFANFVTGRKTVWIR |
| Ga0187862_100417045 | 3300018040 | Peatland | ALAGVKLGPLSRIDDPARTFVILNCAAMVAFINFATGRKAVWVR |
| Ga0187858_101843043 | 3300018057 | Peatland | SLAALAGVKLGPLSRIADPARTFVILNCAAMVAFINFATGRKAVWVR |
| Ga0187769_105611322 | 3300018086 | Tropical Peatland | RLARGLLARIADAAFTFVVLNTAAAVAFARFVVGRSVAWGG |
| Ga0187771_100758834 | 3300018088 | Tropical Peatland | VALGGFRTGPLSRVADAARTFVVLNSAAMVAFVNFITGKKAVWAR |
| Ga0187770_114550322 | 3300018090 | Tropical Peatland | PLSRIADAARTFVVLNSAAMVAFVNFVTGRKAVWVR |
| Ga0179592_100772141 | 3300020199 | Vadose Zone Soil | GIAGIKIGPLTRLADPARTFVILNSAAMVAFVNFVTGRKAVWVR |
| Ga0210395_106836331 | 3300020582 | Soil | MIGRAADAAATFMLLNTAALVAFANFVAGRKTAWSR |
| Ga0210396_103626401 | 3300021180 | Soil | AITQVKEGPLARMADAVLTFVVLNTAAVVAFVNFVSGRKAAWIR |
| Ga0210388_105507741 | 3300021181 | Soil | LAMTQLARGPLARLADPAFTFVVLNTAAVVAFANFVTRRRAVWIR |
| Ga0210385_102700531 | 3300021402 | Soil | RGPIRRVADAAFTFVLLNTAAVVAFANFVTGRKAAWRP |
| Ga0210391_101564333 | 3300021433 | Soil | VKTGPLAGTADAVFTFVMLNTAAVVAFANFVSGRKAAWIR |
| Ga0210391_106199461 | 3300021433 | Soil | KKGPLARMADAVLTFVVLNTAAVVAFANFVSGRKAAWIR |
| Ga0210391_107025452 | 3300021433 | Soil | KLKIGPLSRLADAGRTFMVLNSAAVVAFVNFVTGRKVTWVR |
| Ga0210391_108360142 | 3300021433 | Soil | IARLKRGPVARAADAAFTFVVLNSAAVVAFANFVSGRKAAWVR |
| Ga0210402_103325641 | 3300021478 | Soil | PITRLADAALTFVVLNMAAAVAFANFVSGRKAIWVR |
| Ga0210409_112311382 | 3300021559 | Soil | RGPIGRVSNTASTFVILNTAAVVAFANFVVGRKTGWGR |
| Ga0242673_10687751 | 3300022716 | Soil | AAHLARGPIRRVADAAFTFVLLNTAAVVAFANFVAGRKAAWRP |
| Ga0224550_10379992 | 3300022873 | Soil | LAGVRIGPLSRIADPARTFVVLNSAAIVAFVNFVTGRKAVWAR |
| Ga0208690_10166871 | 3300025434 | Peatland | QALSNRVGPLMRVANAALALIVLNTAAVVAFGNFVTGRKEVWVR |
| Ga0208688_10721223 | 3300025480 | Peatland | PLSRIADPARTFVVLNSAAMVAFINFVTGRKAVWVRDPA |
| Ga0207684_107883921 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PKLDPVARAADAAFTFVFLNTAAVVAFANFITRRKAVWAP |
| Ga0207695_101322961 | 3300025913 | Corn Rhizosphere | LGRGPLARISDAALTFVVLNSAAVLAFVNFLTGRKTVWATR |
| Ga0207695_108586791 | 3300025913 | Corn Rhizosphere | FNRAADAALTFVVLNTAAVVAFAKFVTGRKVVWAR |
| Ga0207663_116918972 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GPLARVADAAGTFVVLNSAALVAFVKFITGRRVAWVR |
| Ga0207678_100281332 | 3300026067 | Corn Rhizosphere | MALLELKRGPLARLVDAASTFVVLNTAALVAFANFVRGRKLEWV |
| Ga0207708_116694322 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPFNRAADAALTFVVLNTAAVVAFAKFVTGRKVVWAR |
| Ga0207698_105287873 | 3300026142 | Corn Rhizosphere | LKSGPLAKAADAALTFVVLNTAAIVAFKNFVTGRRTVWVR |
| Ga0209880_10819061 | 3300026271 | Soil | AALSGFKLGPLSRLADPARTFVILNCAALVAFINFATGRKAVWLR |
| Ga0209687_12155711 | 3300026322 | Soil | VKIGPLSRIADPARTFVVLNSAAIVAFINFVTGRKAIWVR |
| Ga0208199_10535751 | 3300027497 | Peatlands Soil | LAGVKIGPLTRIADPARTFVVLNSAALVAFINFVTGRKALWVR |
| Ga0209655_102430001 | 3300027767 | Bog Forest Soil | VKIGPLSRIADPARTFVVLNSAAMVAFINFVTGRKAVWVR |
| Ga0209180_106462661 | 3300027846 | Vadose Zone Soil | ARLKGPVARAADAAFTFVVLNTAAIVAFANFITGRRAVWGR |
| Ga0209283_101722041 | 3300027875 | Vadose Zone Soil | RGPLARMADAAFTFVVLNTAAAVAFANFVTGRKAMWIR |
| Ga0302156_104345172 | 3300028748 | Bog | GVLSRMADAALTFVVLNVAAAVAFTNFVTGREAAWNW |
| Ga0302197_103182692 | 3300028873 | Bog | FKIGPLSRVADPARTFVVLNSAAVIAFLNFVTGRKAIWVR |
| Ga0308309_116209211 | 3300028906 | Soil | VVAQMKSGLLARMADAAFTFVVLNTAAVVAFINFVTRRKAAWNR |
| Ga0247275_10099894 | 3300029817 | Soil | LAGVKIGPLSRIADPARTFVVLNSAAMVAFINFVTGRKAVWIRDPA |
| Ga0311331_110926701 | 3300029954 | Bog | LARVADVAYTFVVLNSAAAVAFANFVTGRKVVWGG |
| Ga0311338_101652491 | 3300030007 | Palsa | FHRVSDAALTFVLLNGAAVVAFANFVTGKKVAWTR |
| Ga0311344_111117742 | 3300030020 | Bog | VALSNFKIGPLSRVADPARTFVVLNSAAVIAFLNFVTGRKAIWVR |
| Ga0302274_100426174 | 3300030041 | Bog | RGFLARAANAAQTFVVLNTAAVVAFVNFASGRKTGWGR |
| Ga0302300_11249741 | 3300030042 | Palsa | VGPLSRLADAARTFVVLNSAALVAFVNFVTGRKAVWVR |
| Ga0302306_102633641 | 3300030043 | Palsa | KVGPLSRLADAARTFVVLNSAALVAFVNFVTGRKAVWVR |
| Ga0310037_101377542 | 3300030494 | Peatlands Soil | RGPIARMADAALTFVVLNTAALVAFANFVTGRKAVWAR |
| Ga0302183_100572991 | 3300030509 | Palsa | ALVGVRVGPLSRVADPARTFVVLNSAALVAFVNFVVGRKAVWIR |
| Ga0311356_105180091 | 3300030617 | Palsa | PLSRIADPARTFVVLNSAAMVAFVNFVTGRKAVWVR |
| Ga0302180_104227491 | 3300031028 | Palsa | VVSRLADAALTFVVLNTAAMLALTNFVTGKKAAWKS |
| Ga0170822_140595061 | 3300031122 | Forest Soil | IGPLSPLADPARTFILLNSAAVIAFVNFATGRKAIWVR |
| Ga0170824_1204046512 | 3300031231 | Forest Soil | LLAMSHLARGPLARLAEPAFTFVVLNSAAVVAFANFVTRRRAVWIR |
| Ga0302323_1012706841 | 3300031232 | Fen | SVLAVLGWKIGPLSRIADAARTFVVLNSAAMVAFVNFMTGRKAVWVR |
| Ga0302325_113348882 | 3300031234 | Palsa | AGVRIGPLSRIADPARTFVVLNSAAIVAFVNFVTGRKAVWAR |
| Ga0302140_100562041 | 3300031261 | Bog | LVALSNFKTGPLSRVADPARTFVVLNSAAVIAFLNFVTGRKAIWVR |
| Ga0170818_1144259392 | 3300031474 | Forest Soil | LKGPMARVADAARTFVVLNSAAAVAFIKFVTGRRVAWVR |
| Ga0302320_105192232 | 3300031524 | Bog | VGPLSRLADAARTFVVLNSAALVAFVNFATGRKAVWVR |
| Ga0307474_103107431 | 3300031718 | Hardwood Forest Soil | ARGPIRRVADAAFTFVLLNTAAVVAFANFVTGRKAAWRP |
| Ga0307469_113522062 | 3300031720 | Hardwood Forest Soil | PLARVGDVALTFVVLNLAAAVACLNFVTGRKAVWVR |
| Ga0307479_116554421 | 3300031962 | Hardwood Forest Soil | AAVAKLKIGPLSRLADTARTFLVLNSAAVVAFVNFVTGRKVTWVR |
| Ga0315275_127447081 | 3300032401 | Sediment | LAALAGVKIGPLSRLADAARTFVVLNSAALVAFVNFVTGRKAVWVR |
| Ga0335078_116870591 | 3300032805 | Soil | PLKKGPLNRLTDAAFTFVVLNTAAVVAFANFVTGRKAVWLR |
| Ga0334792_102550_1_117 | 3300033888 | Soil | DGPMARIADAAFTFVLLNTAAVFAFVNFVSGRKAAWVR |
| Ga0370483_0048130_16_156 | 3300034124 | Untreated Peat Soil | LIALSNFKIGPLSRIADPARTFVVLNSAAVIAFVNFVTGRKAIWVR |
| Ga0370515_0481420_384_524 | 3300034163 | Untreated Peat Soil | SNQALSNRVGPLMRVANAALALIVLNTAAVVAFCNFVTGRKEVWAR |
| ⦗Top⦘ |