| Basic Information | |
|---|---|
| Family ID | F074611 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VIQQGQVFKLKAKGADGEPLWAYRYRLEGRGSARPQVGGFASR |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.28 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.034 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.941 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.76% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 5.04 |
| PF01872 | RibD_C | 3.36 |
| PF13474 | SnoaL_3 | 2.52 |
| PF13602 | ADH_zinc_N_2 | 2.52 |
| PF12840 | HTH_20 | 1.68 |
| PF13669 | Glyoxalase_4 | 1.68 |
| PF07690 | MFS_1 | 1.68 |
| PF02518 | HATPase_c | 1.68 |
| PF00462 | Glutaredoxin | 1.68 |
| PF01061 | ABC2_membrane | 1.68 |
| PF00211 | Guanylate_cyc | 1.68 |
| PF00155 | Aminotran_1_2 | 1.68 |
| PF00571 | CBS | 1.68 |
| PF13338 | AbiEi_4 | 1.68 |
| PF02371 | Transposase_20 | 0.84 |
| PF13473 | Cupredoxin_1 | 0.84 |
| PF07501 | G5 | 0.84 |
| PF03640 | Lipoprotein_15 | 0.84 |
| PF03404 | Mo-co_dimer | 0.84 |
| PF03372 | Exo_endo_phos | 0.84 |
| PF06500 | FrsA-like | 0.84 |
| PF13560 | HTH_31 | 0.84 |
| PF05145 | AbrB | 0.84 |
| PF00532 | Peripla_BP_1 | 0.84 |
| PF07676 | PD40 | 0.84 |
| PF12681 | Glyoxalase_2 | 0.84 |
| PF01610 | DDE_Tnp_ISL3 | 0.84 |
| PF01139 | RtcB | 0.84 |
| PF08240 | ADH_N | 0.84 |
| PF01527 | HTH_Tnp_1 | 0.84 |
| PF00440 | TetR_N | 0.84 |
| PF13191 | AAA_16 | 0.84 |
| PF07617 | DUF1579 | 0.84 |
| PF13458 | Peripla_BP_6 | 0.84 |
| PF00196 | GerE | 0.84 |
| PF03795 | YCII | 0.84 |
| PF12680 | SnoaL_2 | 0.84 |
| PF04075 | F420H2_quin_red | 0.84 |
| PF00107 | ADH_zinc_N | 0.84 |
| PF13302 | Acetyltransf_3 | 0.84 |
| PF00903 | Glyoxalase | 0.84 |
| PF01243 | Putative_PNPOx | 0.84 |
| PF10647 | Gmad1 | 0.84 |
| PF13586 | DDE_Tnp_1_2 | 0.84 |
| PF12730 | ABC2_membrane_4 | 0.84 |
| PF00486 | Trans_reg_C | 0.84 |
| PF02504 | FA_synthesis | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 3.36 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 3.36 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.68 |
| COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 0.84 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.84 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
| COG3180 | Uncharacterized membrane protein AbrB, regulator of aidB expression | General function prediction only [R] | 0.84 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.87 % |
| Unclassified | root | N/A | 15.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_100978877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1347 | Open in IMG/M |
| 3300000956|JGI10216J12902_103079325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3334 | Open in IMG/M |
| 3300001334|A2165W6_1101666 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300001535|A3PFW1_10308515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
| 3300001535|A3PFW1_10670724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1166 | Open in IMG/M |
| 3300001536|A1565W1_10878204 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300002568|C688J35102_120770154 | Not Available | 1531 | Open in IMG/M |
| 3300003987|Ga0055471_10255403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
| 3300004081|Ga0063454_101767523 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300004114|Ga0062593_103131877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. B1-1-3 | 530 | Open in IMG/M |
| 3300005166|Ga0066674_10276400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 792 | Open in IMG/M |
| 3300005167|Ga0066672_10821833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 583 | Open in IMG/M |
| 3300005179|Ga0066684_10149758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1479 | Open in IMG/M |
| 3300005332|Ga0066388_104835737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300005332|Ga0066388_108101356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300005445|Ga0070708_100605453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1033 | Open in IMG/M |
| 3300005468|Ga0070707_100219893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1850 | Open in IMG/M |
| 3300005532|Ga0070739_10484088 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005538|Ga0070731_10141082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1598 | Open in IMG/M |
| 3300005542|Ga0070732_10185661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis | 1241 | Open in IMG/M |
| 3300005554|Ga0066661_10855771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300005576|Ga0066708_10397406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 885 | Open in IMG/M |
| 3300005993|Ga0080027_10311114 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006046|Ga0066652_100626404 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300006046|Ga0066652_101378767 | Not Available | 661 | Open in IMG/M |
| 3300006046|Ga0066652_101537956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
| 3300006046|Ga0066652_101839104 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006797|Ga0066659_10988461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300006844|Ga0075428_101583525 | Not Available | 685 | Open in IMG/M |
| 3300009088|Ga0099830_10129447 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300009094|Ga0111539_11571306 | Not Available | 763 | Open in IMG/M |
| 3300009137|Ga0066709_100015617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7315 | Open in IMG/M |
| 3300009801|Ga0105056_1021760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 792 | Open in IMG/M |
| 3300009812|Ga0105067_1079082 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009815|Ga0105070_1091125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| 3300009836|Ga0105068_1077377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300009836|Ga0105068_1083624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300009840|Ga0126313_10693759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium vinaceum | 824 | Open in IMG/M |
| 3300010036|Ga0126305_11167361 | Not Available | 531 | Open in IMG/M |
| 3300010038|Ga0126315_10673668 | Not Available | 673 | Open in IMG/M |
| 3300010041|Ga0126312_10389958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
| 3300010041|Ga0126312_10628803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300010042|Ga0126314_10763330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 711 | Open in IMG/M |
| 3300010045|Ga0126311_11401834 | Not Available | 583 | Open in IMG/M |
| 3300010166|Ga0126306_11811256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300010325|Ga0134064_10487719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
| 3300010335|Ga0134063_10205907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 927 | Open in IMG/M |
| 3300010373|Ga0134128_10750673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300011269|Ga0137392_10843765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300011271|Ga0137393_11782256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300011991|Ga0120153_1041669 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300012014|Ga0120159_1059436 | Not Available | 1177 | Open in IMG/M |
| 3300012022|Ga0120191_10105879 | Not Available | 588 | Open in IMG/M |
| 3300012201|Ga0137365_10213194 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300012204|Ga0137374_10100191 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
| 3300012204|Ga0137374_10371066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1147 | Open in IMG/M |
| 3300012204|Ga0137374_10768410 | Not Available | 717 | Open in IMG/M |
| 3300012204|Ga0137374_10982081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 612 | Open in IMG/M |
| 3300012205|Ga0137362_11520648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
| 3300012206|Ga0137380_10141861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2191 | Open in IMG/M |
| 3300012208|Ga0137376_11066731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300012208|Ga0137376_11535075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300012349|Ga0137387_10487924 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → Rhodothermia → Rhodothermales → unclassified Rhodothermales → Rhodothermales bacterium | 894 | Open in IMG/M |
| 3300012350|Ga0137372_10173230 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
| 3300012350|Ga0137372_10314874 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300012350|Ga0137372_10378111 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300012350|Ga0137372_11202016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300012351|Ga0137386_10529377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300012351|Ga0137386_10910102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300012353|Ga0137367_10272097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1216 | Open in IMG/M |
| 3300012358|Ga0137368_10255957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
| 3300012532|Ga0137373_10111862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2365 | Open in IMG/M |
| 3300012532|Ga0137373_10514087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 913 | Open in IMG/M |
| 3300012532|Ga0137373_10706743 | Not Available | 751 | Open in IMG/M |
| 3300012532|Ga0137373_10712636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
| 3300012895|Ga0157309_10215653 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 608 | Open in IMG/M |
| 3300012923|Ga0137359_10523756 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300012975|Ga0134110_10440177 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300013770|Ga0120123_1047578 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300014150|Ga0134081_10280947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300014157|Ga0134078_10192274 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300014166|Ga0134079_10471670 | Not Available | 599 | Open in IMG/M |
| 3300014827|Ga0120171_1080020 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300015373|Ga0132257_103956156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300016294|Ga0182041_11562440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300016404|Ga0182037_12068465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300017654|Ga0134069_1370685 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300017787|Ga0183260_10233951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1274 | Open in IMG/M |
| 3300018054|Ga0184621_10181354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Shewanellaceae → Shewanella → Shewanella surugensis | 756 | Open in IMG/M |
| 3300018061|Ga0184619_10504256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300018063|Ga0184637_10165629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1362 | Open in IMG/M |
| 3300018078|Ga0184612_10158449 | Not Available | 1183 | Open in IMG/M |
| 3300018433|Ga0066667_10403630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1105 | Open in IMG/M |
| 3300018433|Ga0066667_10741383 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300019888|Ga0193751_1258019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300021073|Ga0210378_10072989 | Not Available | 1345 | Open in IMG/M |
| 3300021080|Ga0210382_10413937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300024186|Ga0247688_1077894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300025939|Ga0207665_11409420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300026316|Ga0209155_1187022 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300026316|Ga0209155_1236418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300026322|Ga0209687_1290871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300026325|Ga0209152_10251594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
| 3300026528|Ga0209378_1279252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300026550|Ga0209474_10083732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2186 | Open in IMG/M |
| 3300027773|Ga0209810_1331895 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027842|Ga0209580_10474562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300027875|Ga0209283_10634766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 673 | Open in IMG/M |
| 3300027875|Ga0209283_10801452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300027907|Ga0207428_10624287 | Not Available | 775 | Open in IMG/M |
| 3300028791|Ga0307290_10173672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300031226|Ga0307497_10659692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300031668|Ga0318542_10065220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1691 | Open in IMG/M |
| 3300032035|Ga0310911_10803352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300032043|Ga0318556_10298696 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 842 | Open in IMG/M |
| 3300032055|Ga0318575_10095338 | Not Available | 1436 | Open in IMG/M |
| 3300033158|Ga0335077_11835170 | Not Available | 568 | Open in IMG/M |
| 3300033290|Ga0318519_10254939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1016 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.45% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.72% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 6.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.04% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.20% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.68% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.84% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001334 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1009788773 | 3300000956 | Soil | VIQHGQVFKLKSKGADGQPLWAYRYRLEGRDSERPQV |
| JGI10216J12902_1030793254 | 3300000956 | Soil | VIQQGQVFKLKAKGADGEPLWAYRYRLEGRGSARPQVGGFASR |
| A2165W6_11016662 | 3300001334 | Permafrost | VIQQGQVFKLKARCADGEPLWAYRYRVAGRGSARLQVGGFSSRAEAQRAL |
| A3PFW1_103085153 | 3300001535 | Permafrost | MIQQGQVFKLKAKAADGQPLWAYRYRLEGRGSVRPQVG |
| A3PFW1_106707242 | 3300001535 | Permafrost | VIQQGQVFKLQATCADGEPLWAYRYRVAGRGSPRLQVGGFSSKAEAQRALQNR |
| A1565W1_108782041 | 3300001536 | Permafrost | VIQQGQVFKLKARCADGEPLWAYRYRVAGRGSARLQVGGFSTRAE |
| C688J35102_1207701541 | 3300002568 | Soil | MIQQGQVFKLKATSVDGEPLWAYRYRVAGRDSARRQAGGFTTKAEAQRA |
| Ga0055471_102554032 | 3300003987 | Natural And Restored Wetlands | MIQQGQVFKLKATGVDGEPLWSYRYRVAGRGSARWQVGGFTT |
| Ga0063454_1017675231 | 3300004081 | Soil | MWQQGQVFKLRVKGRNGQRLWAYRYRLEGRGSVRPQVGGFA |
| Ga0062593_1031318771 | 3300004114 | Soil | VIQQGQVFKLKANSAAGEPLWAFRYRVAGRGSARLQVGGFG |
| Ga0066674_102764001 | 3300005166 | Soil | MFQQGQVFKLKARCADGEPLWAYRYRVAGRGSARLQVGGLSSRAEAQRALQNKL |
| Ga0066672_108218332 | 3300005167 | Soil | VIQQGQVFKLTAKGADGEPLWAYRYRLEGRSSARPQVGGFA |
| Ga0066684_101497581 | 3300005179 | Soil | VIQQGQVFKLKAKGVDGQPLWAYRYRLDGRGSSRPQVGGFATRADALT |
| Ga0066388_1048357371 | 3300005332 | Tropical Forest Soil | VIQQGQVFELKARSSEGDPLWACRYRVAGRGSVRLQVGGFGSRAEA* |
| Ga0066388_1081013562 | 3300005332 | Tropical Forest Soil | MTQQGQVLKLKTTGADGKPLWAYRYRLDGRGSTRPQVGGFASQGEAMQA |
| Ga0070708_1006054532 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VFKLRAKGADGHPLWAYRYRVEGRGSARPQVGGFATRADALRALEKVL |
| Ga0070707_1002198933 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQQGQVFKLKAKGPDGQPLWAYRYRLEGRGSERPQVGGFATRACRPLVVVC |
| Ga0070739_104840882 | 3300005532 | Surface Soil | MIQQGQVFRLKTKGSDGQPLWAYRYRLEGRDSERPQVGGFAT |
| Ga0070731_101410823 | 3300005538 | Surface Soil | VIQQGQVFKLTAKGADGAPLWAYRYRLEGRSSARPQVGGFA |
| Ga0070732_101856613 | 3300005542 | Surface Soil | VIQQGQVLKLKANGSDGQPLWAYRYRLEGRASTRPQV |
| Ga0066661_108557711 | 3300005554 | Soil | MIQQGQVFKLRSKGADGQPLWAYRCRLEGRGSVRPQVGGFATRV |
| Ga0066708_103974063 | 3300005576 | Soil | VIQQGQVFKLTAKGADGEPLWAYRYRLEGRSSARPQVGGF |
| Ga0080027_103111142 | 3300005993 | Prmafrost Soil | MVQQGQVLKLKTKGADGKPLWAYRYRVAGRASGRRQIGGFATRAEAQRALRK |
| Ga0066652_1006264041 | 3300006046 | Soil | MIQQGQVFKLKTKGADGQPLWAYRYRLEGRGSERPQVGGFATRAEAE |
| Ga0066652_1013787671 | 3300006046 | Soil | MIQQGQVFKLKAKGPDGQPLWADRYRIEGRGSERPQ |
| Ga0066652_1015379561 | 3300006046 | Soil | MIQQGQVFKLKAKGSDGQPLWAYRYRLEGRGSERPQVGGFATRAEGRESAA* |
| Ga0066652_1018391041 | 3300006046 | Soil | VIQQGQVFKLTAKGADGEPLWAYRYRLEGRSSARPQVGGFASRAEAQKAL |
| Ga0066659_109884611 | 3300006797 | Soil | MIQQGQVFKLKANGHDGQLLWAYRCRIEGPGSERPQVGGFATRAD |
| Ga0075428_1015835252 | 3300006844 | Populus Rhizosphere | MIQQGQVFKLKATCADGEPLWAYRYRVAGRGSARLQVGGFSSK |
| Ga0099830_101294471 | 3300009088 | Vadose Zone Soil | MWQQGQVFKLKAKATDGQPLWAYRYRLEGRGSARPQ |
| Ga0111539_115713062 | 3300009094 | Populus Rhizosphere | VIQQGQVFKLQARPAEGEPLWAYRYRVAGCGSARLQVGGFSSMAEARRARQNKLARL |
| Ga0066709_1000156171 | 3300009137 | Grasslands Soil | MVQQGQVFKLKAKGANGQALWAYRYRLEGRGSARPQVGGFAS |
| Ga0105056_10217601 | 3300009801 | Groundwater Sand | MIQQGQVFKLKTKGADGQPLWAFRYRLEGRGSERPQVGGFATRAE |
| Ga0105067_10790822 | 3300009812 | Groundwater Sand | MWQQGQVFKLKAKGVDGQPLWAYQGRGSARPQVGGFATRADALK |
| Ga0105070_10911251 | 3300009815 | Groundwater Sand | VIQQGQVFKLRAKGVDGQPLWAYRYRLDGRGSLRPQVGGFATRADALK |
| Ga0105068_10773772 | 3300009836 | Groundwater Sand | MWQQGQVFKLKARSGDGQPLWAYRYRLEGRGSARPQVGGFATRADALKALEK |
| Ga0105068_10836241 | 3300009836 | Groundwater Sand | MIQQGQVFKLKAKSVDGQPLWAYRYRLEGRGSARPQ |
| Ga0126313_106937591 | 3300009840 | Serpentine Soil | MIQQGQVFKLKATSVDGEPLWAYRYRVAGRGSARRQA |
| Ga0126305_111673612 | 3300010036 | Serpentine Soil | VVIQQGQLFKLKARCADGEPLWAYRYRVAGRSSARL |
| Ga0126315_106736682 | 3300010038 | Serpentine Soil | MIQRGQVFKLQTKGADGEPLWAYRYRLEGRGSARPQVGGFAS |
| Ga0126312_103899582 | 3300010041 | Serpentine Soil | VIQQGQVFKLKAKCADGEPLWAYRYRVAGRGSARLQVGGFSTRAEA |
| Ga0126312_106288031 | 3300010041 | Serpentine Soil | VIQQGQVFKLKARCAGGEPLWAYRYRVAGRGSARLQVGGFS |
| Ga0126314_107633302 | 3300010042 | Serpentine Soil | MWQQGQVFKLKAKGRDGQPLWAYRYRLEGRGSTRPQVGGFATRAEA |
| Ga0126311_114018341 | 3300010045 | Serpentine Soil | MIQQGQVFKLKATSVDGEPLCAYRYGVAGRDSARRQAGG |
| Ga0126306_118112561 | 3300010166 | Serpentine Soil | MIQQGQVFKLKATRADGEPLWAYRYRVAGRGSARLQVGGFSTRAEAQR |
| Ga0134064_104877192 | 3300010325 | Grasslands Soil | MIQQGQVFKLKTKGADGQPLWAYRYRLEGRGSERPQV |
| Ga0134063_102059072 | 3300010335 | Grasslands Soil | MWQQGQVFKLKAKGVDGQPLWAYRYRLEGRGSARPQVGGFSTRDDALKALEKVLA |
| Ga0134128_107506733 | 3300010373 | Terrestrial Soil | MIQQGQVFKLKTRGVDGRWLWAYRYRFEGRGSTRPQVGGFATRAE |
| Ga0137392_108437652 | 3300011269 | Vadose Zone Soil | VIQQGQVFKLTAKGADGQPLWAYRYRLEGRGSGRPQVG |
| Ga0137393_117822563 | 3300011271 | Vadose Zone Soil | MVQHGQVFKLKAKGANGQALWAYRYRLEGRGSSRPQVGGFATRAEA |
| Ga0120153_10416691 | 3300011991 | Permafrost | MVQQGQVFKLKTKGADSKPLWAYRYRLHGRGSCRRQ |
| Ga0120159_10594363 | 3300012014 | Permafrost | MWQQGQVFKLKAKGVDGQPLWAYRYRLEGRGSARPQVGGVRDSK* |
| Ga0120191_101058791 | 3300012022 | Terrestrial | MAQQGQVFKLRTSGADGKRLWAYRYRLDGRGSARPQVGGFASHGEAL |
| Ga0137365_102131944 | 3300012201 | Vadose Zone Soil | VIQQGQVFKLKAKGVDGQPLWAYRYRPEGRASMRLQVGGFASRAEAQKAL |
| Ga0137374_101001911 | 3300012204 | Vadose Zone Soil | VIQQGQVFKLQATCADGEALWAYRYRVAGRGSARLQVGGFSSKTEAQRA |
| Ga0137374_103710663 | 3300012204 | Vadose Zone Soil | VIQQGQVFKLKARCADGEPLWAYRYRVAGRGSERLQVGGFSSRAEAQRALQNKL |
| Ga0137374_107684101 | 3300012204 | Vadose Zone Soil | MIQQGQVFELKATSVDGEPLWAYRYRVAGRDSARRQA |
| Ga0137374_109820811 | 3300012204 | Vadose Zone Soil | VIQQGQVFKLKAREADDRPLWAYRYRLDGRGSSRPQVGGFAMRGG |
| Ga0137362_115206482 | 3300012205 | Vadose Zone Soil | VIQQGQVFKLTAKGVDGEPLWAYRYRLEGRSSARPQ |
| Ga0137380_101418614 | 3300012206 | Vadose Zone Soil | MVQQGQVFKLKAKGANGQALWAYRYRLEGRGSARPQVGGFASRAEAKN |
| Ga0137376_110667312 | 3300012208 | Vadose Zone Soil | MVQQGQVFKLKAKSVNGQALWAYRYRLEGRRSARPQVGGFASR* |
| Ga0137376_115350751 | 3300012208 | Vadose Zone Soil | MIQQGQVFKLKATGVDGEPLWSYRYRVAGRGSARRQVG |
| Ga0137387_104879241 | 3300012349 | Vadose Zone Soil | VIQQGQVFKLKARCADGEPLWAYRYRVAGRGSPRLQVGGFSS |
| Ga0137372_101732301 | 3300012350 | Vadose Zone Soil | MWQQGQVFKLKAKGVDGQPLWAYRYRLEGRGSTRPQVGGFANRADG |
| Ga0137372_103148742 | 3300012350 | Vadose Zone Soil | VIQQGQVFKLKAKCADGEPLWAYRYRVAGRGSARVQVGGFSSKAEAQ |
| Ga0137372_103781111 | 3300012350 | Vadose Zone Soil | VIQQGQVFKLKARCADGEPLWAYRYRVAGRGSARLQV |
| Ga0137372_112020161 | 3300012350 | Vadose Zone Soil | VIQQGQVFKLKAKSIDGQPLWAYRYRLDGRSSARPQVGGFATRADALKAL |
| Ga0137386_105293771 | 3300012351 | Vadose Zone Soil | MVQQGQVFKLKAKSVNGQALWAYRYRLEGRRSARPQVGGFAS |
| Ga0137386_109101022 | 3300012351 | Vadose Zone Soil | VFKLRAKGLDGQPLWAYRYRLEGRGSSRPQVGGFATCAEA |
| Ga0137367_102720971 | 3300012353 | Vadose Zone Soil | MIQQGQVFKLKTKGADGQPLWAYRYRLEGRGSERPQVGGFATRAEAETAL |
| Ga0137368_102559573 | 3300012358 | Vadose Zone Soil | MWQQGQVFKLRAKGRDGQPLWAYRYRLEGRGSVRPQVGGFA |
| Ga0137373_101118621 | 3300012532 | Vadose Zone Soil | VIQQGQVFKLKGRCADGEPLWAYRYRVAGRGSARLQVGGFSSKA |
| Ga0137373_105140871 | 3300012532 | Vadose Zone Soil | MIQQGQVFKLKATGVDGEPLWSYRYRVAGRGSARRQV |
| Ga0137373_107067431 | 3300012532 | Vadose Zone Soil | VIQQGQVLKLKATCADGEPLWAYRYRVAGRGSARLQVGGFSSRADAQRA |
| Ga0137373_107126363 | 3300012532 | Vadose Zone Soil | VIQQGQVFKLQARCVDGEPLWAYRYRVAGRGSARLQVGGFSSK |
| Ga0157309_102156532 | 3300012895 | Soil | VIQQGQVFKLQARCADGEPLWAYRYRVAGRGSARRQVGGFSSKAEAQ |
| Ga0137359_105237562 | 3300012923 | Vadose Zone Soil | MIQQGQVFKLKATSVDGEPLWAYRYRVAGRDSARR* |
| Ga0134110_104401772 | 3300012975 | Grasslands Soil | MIQHGQVFKLKTRGPDGQPLWAYRYRLEGRGSSERPQ |
| Ga0120123_10475782 | 3300013770 | Permafrost | VIQQGQVFKLKARCADGEPLWAYRYRVAGRGSARLQVGGFS |
| Ga0134081_102809471 | 3300014150 | Grasslands Soil | MIQQGQVFKLKAKGHDGQPLWAYRYRIEGRGSERPQVGGFATRA |
| Ga0134078_101922742 | 3300014157 | Grasslands Soil | MWQQGKVFKLKTKGRVGQPLWAYRYRLDGRGSVRPQVG |
| Ga0134079_104716701 | 3300014166 | Grasslands Soil | MVQQGQVCKLKAKGANGQALWAYRYRLEGRGSARPQVGGFASRAEAKKA |
| Ga0120171_10800202 | 3300014827 | Permafrost | MWQQGQVFKLKAKGVDGQPLWAYRYRLEGRRSARPQVGGVRDSK* |
| Ga0132257_1039561561 | 3300015373 | Arabidopsis Rhizosphere | MVQQGQVFKLKAKGAEGESLWAYRYRVEGRGSARPQVGGF |
| Ga0182041_115624402 | 3300016294 | Soil | VIQQGQVFKLKARSVEGEPLWAYRYRAAGRGSARRQVGGFASRAEAQ |
| Ga0182037_120684651 | 3300016404 | Soil | VIQQGQLFKLKARSAEGEPLWAYRYRLEGRGSVRPQVGGF |
| Ga0134069_13706852 | 3300017654 | Grasslands Soil | VLKLKAKSEDGEPLWAYRYRVAGRGSERRQVGGFATKANAQ |
| Ga0183260_102339511 | 3300017787 | Polar Desert Sand | VIQQGQVFKLKDAGVDGRPLWAYRYRLNGRASSRPQGGRL |
| Ga0184621_101813543 | 3300018054 | Groundwater Sediment | VIWQQGQVFKLKAKSTDGQPLWAYRYRLEGRGSARPQVGGFATRADPASGGRSVD |
| Ga0184619_105042561 | 3300018061 | Groundwater Sediment | MVQQGQVFKLKARGANGEALWAYRYRLEGRGSARPQVGGFASRAE |
| Ga0184637_101656293 | 3300018063 | Groundwater Sediment | VIQQGQVFKLKARCADGEPLWAYRYRVAGRGSARLQVGGFSTRAEAQRA |
| Ga0184632_103598072 | 3300018075 | Groundwater Sediment | VIQQGQVFKLKARGADGRPLWAYRHRLDGRDSARPQVGGFASRAEAEQALRKAL |
| Ga0184612_101584491 | 3300018078 | Groundwater Sediment | VIQQGQVFKLKARCADGEPLWAYRYRVAGRGSARLQVG |
| Ga0066667_104036302 | 3300018433 | Grasslands Soil | MVQQGQVFKLKAKGANGQALWAYRYRLEGRGSARPQVGGVCESR |
| Ga0066667_107413832 | 3300018433 | Grasslands Soil | VIQQGQVFKLKARCADGEPLWAYRYRVAGRGSARLQVGGFSTR |
| Ga0193751_12580191 | 3300019888 | Soil | VIQQGQVFKLTAKGADGEPLWAYRYRLEGRSSTRPQV |
| Ga0210378_100729894 | 3300021073 | Groundwater Sediment | VIQQGQVFKLKARGADGQSLWAYRYRLEGRGSTRPQVGGFASRA |
| Ga0210382_104139371 | 3300021080 | Groundwater Sediment | VIQQGQVFKLTAKGADGEPLWAYRYRLEGRSSARPQ |
| Ga0247688_10778942 | 3300024186 | Soil | MIQQGQVFKLTAKGADGEPLWAYRYRLEGRSSARPQVGGFA |
| Ga0207665_114094201 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQQGQVFKLTAKGADGEPLWAYRYRLEGRSSARPQVGGFAT |
| Ga0209155_11870222 | 3300026316 | Soil | MWQQGQVFKLKAKGREGQPLWAYRYRAEGRSSVRPQVGGFATRTEAVKAL |
| Ga0209155_12364182 | 3300026316 | Soil | MIQQGQVFKLTAKGADGQPLWAYRYRLEGRSSARPQVGGFASRAEAQKAL |
| Ga0209687_12908712 | 3300026322 | Soil | MIQQGQVFKLTAKGADGEPLWAYRHRLEGRSSARPQVGG |
| Ga0209152_102515941 | 3300026325 | Soil | MIQQGQVFKLKATGVDGEPLWSYRYRVAGRGSARRQVGGFTT |
| Ga0209378_12792521 | 3300026528 | Soil | VIQQGQVFKLTAKGADGEPLWAYRYRLEGRSSARP |
| Ga0209474_100837321 | 3300026550 | Soil | MVQQGQVFKLKARGANGEALWAYRYRLEGRGSARPQVGGFASRAEAKK |
| Ga0209810_13318951 | 3300027773 | Surface Soil | MIQQGQVFRLKTKGSDGQPLWAYRYRLEGRDSERPQVGGFA |
| Ga0209580_104745621 | 3300027842 | Surface Soil | VIQQGQVLKLKANGSDGQPLWAYRYRLEGRASTRPQVGGFASRAEA |
| Ga0209283_106347662 | 3300027875 | Vadose Zone Soil | MVQQGQVFKLKARGANGQALRAYRYRLEGRGSARPQVGGFASRAE |
| Ga0209283_108014521 | 3300027875 | Vadose Zone Soil | MIQQGQVFKLKATSVDGEPLWAYRYRVAGRDSARRQAGGFTTK |
| Ga0207428_106242871 | 3300027907 | Populus Rhizosphere | VIQQGQVFKLQARRAEGEPLWAYRYRVAGRGSARLQVG |
| Ga0307290_101736722 | 3300028791 | Soil | VIQQGQVFKLKTRCADGEPLWAYRYRVAGRGSARLQVG |
| Ga0307497_106596921 | 3300031226 | Soil | VIQQGQVFKLQARSVDGEPLWAYRYRVAGRGSARLQVGGFSSRAE |
| Ga0318542_100652201 | 3300031668 | Soil | MIQQGQVFKLKSKGPDGQPLWAYRYRLEGRGSERPQVGGFATRAEAEKALR |
| Ga0310911_108033522 | 3300032035 | Soil | MIQQGQVFKLKSKGPDGQPLWAYRYRLEGRGSERPQVGGFATRAEAEK |
| Ga0318556_102986963 | 3300032043 | Soil | VIQQGQVFKLKACSAHGEPLWAYRYRVAGRGSARPQVGG |
| Ga0318575_100953382 | 3300032055 | Soil | MIQQGQVFKLKSKGPDGQPLWAYRYRLEGRGSERPQVGGFATRAEAEKAL |
| Ga0335077_118351702 | 3300033158 | Soil | VIQQGQVFKLTAKGADGQPLWAYRYRLEGRSSARPQVGGFASRAEAQKALRK |
| Ga0318519_102549391 | 3300033290 | Soil | MIQQGQVFKLKSKGPDGQPLWAYRYRLEGRGSERPQVGG |
| ⦗Top⦘ |