Basic Information | |
---|---|
Family ID | F074610 |
Family Type | Metagenome |
Number of Sequences | 119 |
Average Sequence Length | 40 residues |
Representative Sequence | TRAQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 5.08 % |
% of genes near scaffold ends (potentially truncated) | 94.12 % |
% of genes from short scaffolds (< 2000 bps) | 94.12 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.866 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.412 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.050 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.697 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.85% β-sheet: 0.00% Coil/Unstructured: 70.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF00230 | MIP | 9.24 |
PF00381 | PTS-HPr | 6.72 |
PF13738 | Pyr_redox_3 | 3.36 |
PF00296 | Bac_luciferase | 2.52 |
PF13450 | NAD_binding_8 | 2.52 |
PF03747 | ADP_ribosyl_GH | 2.52 |
PF12704 | MacB_PCD | 1.68 |
PF02687 | FtsX | 1.68 |
PF00406 | ADK | 1.68 |
PF03435 | Sacchrp_dh_NADP | 1.68 |
PF02705 | K_trans | 1.68 |
PF05721 | PhyH | 1.68 |
PF13556 | HTH_30 | 1.68 |
PF00190 | Cupin_1 | 1.68 |
PF02733 | Dak1 | 0.84 |
PF03109 | ABC1 | 0.84 |
PF00743 | FMO-like | 0.84 |
PF08386 | Abhydrolase_4 | 0.84 |
PF09339 | HTH_IclR | 0.84 |
PF02518 | HATPase_c | 0.84 |
PF00753 | Lactamase_B | 0.84 |
PF12762 | DDE_Tnp_IS1595 | 0.84 |
PF00248 | Aldo_ket_red | 0.84 |
PF07969 | Amidohydro_3 | 0.84 |
PF00005 | ABC_tran | 0.84 |
PF08327 | AHSA1 | 0.84 |
PF13189 | Cytidylate_kin2 | 0.84 |
PF00486 | Trans_reg_C | 0.84 |
PF00440 | TetR_N | 0.84 |
PF00903 | Glyoxalase | 0.84 |
PF13483 | Lactamase_B_3 | 0.84 |
PF12680 | SnoaL_2 | 0.84 |
PF08281 | Sigma70_r4_2 | 0.84 |
PF12802 | MarR_2 | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 9.24 |
COG1925 | HPr or related phosphotransfer protein | Signal transduction mechanisms [T] | 6.72 |
COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 2.52 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.52 |
COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 1.68 |
COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 1.68 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.68 |
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.84 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.84 |
COG2376 | Dihydroxyacetone kinase | Carbohydrate transport and metabolism [G] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.87 % |
Unclassified | root | N/A | 36.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005169|Ga0066810_10046544 | Not Available | 834 | Open in IMG/M |
3300005172|Ga0066683_10722223 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005177|Ga0066690_10183222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1388 | Open in IMG/M |
3300005178|Ga0066688_10919784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
3300005434|Ga0070709_11789393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Klenkia → Klenkia taihuensis | 502 | Open in IMG/M |
3300005435|Ga0070714_102356952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
3300005542|Ga0070732_10250969 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300005561|Ga0066699_10458581 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300005591|Ga0070761_10266138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1027 | Open in IMG/M |
3300005602|Ga0070762_10652297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
3300005764|Ga0066903_108397962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
3300006797|Ga0066659_11119971 | Not Available | 658 | Open in IMG/M |
3300006804|Ga0079221_10794157 | Not Available | 677 | Open in IMG/M |
3300006903|Ga0075426_11033131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
3300007982|Ga0102924_1079398 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
3300009012|Ga0066710_103716302 | Not Available | 574 | Open in IMG/M |
3300009520|Ga0116214_1034332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1830 | Open in IMG/M |
3300009525|Ga0116220_10118573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
3300009545|Ga0105237_11281972 | Not Available | 739 | Open in IMG/M |
3300009551|Ga0105238_12236353 | Not Available | 582 | Open in IMG/M |
3300010049|Ga0123356_10738083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1154 | Open in IMG/M |
3300010321|Ga0134067_10118259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 921 | Open in IMG/M |
3300010343|Ga0074044_10183643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1392 | Open in IMG/M |
3300010360|Ga0126372_12815352 | Not Available | 538 | Open in IMG/M |
3300010376|Ga0126381_102480224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
3300010379|Ga0136449_100797389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1561 | Open in IMG/M |
3300012089|Ga0153924_1049585 | Not Available | 820 | Open in IMG/M |
3300012198|Ga0137364_10400338 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300012349|Ga0137387_10380966 | Not Available | 1022 | Open in IMG/M |
3300012971|Ga0126369_13590867 | Not Available | 508 | Open in IMG/M |
3300015373|Ga0132257_101041188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1031 | Open in IMG/M |
3300016270|Ga0182036_10942543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
3300016270|Ga0182036_10996294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
3300016422|Ga0182039_11133209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
3300017821|Ga0187812_1205926 | Not Available | 628 | Open in IMG/M |
3300017926|Ga0187807_1038162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1487 | Open in IMG/M |
3300017928|Ga0187806_1140498 | Not Available | 792 | Open in IMG/M |
3300017932|Ga0187814_10390376 | Not Available | 541 | Open in IMG/M |
3300017942|Ga0187808_10199142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 890 | Open in IMG/M |
3300017948|Ga0187847_10913420 | Not Available | 500 | Open in IMG/M |
3300018001|Ga0187815_10316751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 662 | Open in IMG/M |
3300018007|Ga0187805_10035970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2213 | Open in IMG/M |
3300018007|Ga0187805_10370968 | Not Available | 663 | Open in IMG/M |
3300018012|Ga0187810_10065862 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
3300018034|Ga0187863_10125398 | Not Available | 1435 | Open in IMG/M |
3300018042|Ga0187871_10476173 | Not Available | 691 | Open in IMG/M |
3300018468|Ga0066662_11372785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 729 | Open in IMG/M |
3300020582|Ga0210395_10241020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1358 | Open in IMG/M |
3300020583|Ga0210401_10937714 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300021180|Ga0210396_10364375 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300021403|Ga0210397_10337367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso899 | 1114 | Open in IMG/M |
3300021405|Ga0210387_10514842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1064 | Open in IMG/M |
3300021405|Ga0210387_11272798 | Not Available | 636 | Open in IMG/M |
3300021406|Ga0210386_11460599 | Not Available | 571 | Open in IMG/M |
3300021406|Ga0210386_11576712 | Not Available | 545 | Open in IMG/M |
3300021474|Ga0210390_11062084 | Not Available | 659 | Open in IMG/M |
3300021479|Ga0210410_11243595 | Not Available | 636 | Open in IMG/M |
3300021559|Ga0210409_10946502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 735 | Open in IMG/M |
3300021559|Ga0210409_11716524 | Not Available | 504 | Open in IMG/M |
3300021560|Ga0126371_13874104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300024288|Ga0179589_10358837 | Not Available | 663 | Open in IMG/M |
3300025910|Ga0207684_10775851 | Not Available | 811 | Open in IMG/M |
3300025914|Ga0207671_11574003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
3300025917|Ga0207660_10331581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1217 | Open in IMG/M |
3300025924|Ga0207694_11410014 | Not Available | 589 | Open in IMG/M |
3300025927|Ga0207687_10315418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1264 | Open in IMG/M |
3300025949|Ga0207667_11822330 | Not Available | 572 | Open in IMG/M |
3300026078|Ga0207702_10824753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 917 | Open in IMG/M |
3300026121|Ga0207683_10432492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1212 | Open in IMG/M |
3300026327|Ga0209266_1266993 | Not Available | 543 | Open in IMG/M |
3300026552|Ga0209577_10147982 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
3300027725|Ga0209178_1090440 | Not Available | 1014 | Open in IMG/M |
3300027855|Ga0209693_10400653 | Not Available | 663 | Open in IMG/M |
3300027905|Ga0209415_10288889 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
3300028808|Ga0302228_10243725 | Not Available | 812 | Open in IMG/M |
3300028879|Ga0302229_10527675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Leisingera | 520 | Open in IMG/M |
3300029943|Ga0311340_11202683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
3300029943|Ga0311340_11588718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Leisingera | 508 | Open in IMG/M |
3300029999|Ga0311339_11590838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 577 | Open in IMG/M |
3300030056|Ga0302181_10049528 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
3300030058|Ga0302179_10203152 | Not Available | 875 | Open in IMG/M |
3300030058|Ga0302179_10524861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300030490|Ga0302184_10416239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 520 | Open in IMG/M |
3300030503|Ga0311370_11213286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
3300030580|Ga0311355_10160126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2407 | Open in IMG/M |
3300030580|Ga0311355_11882591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Leisingera | 505 | Open in IMG/M |
3300030739|Ga0302311_10368823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1019 | Open in IMG/M |
3300031640|Ga0318555_10033117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2531 | Open in IMG/M |
3300031668|Ga0318542_10446918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 670 | Open in IMG/M |
3300031668|Ga0318542_10746546 | Not Available | 512 | Open in IMG/M |
3300031680|Ga0318574_10051182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2174 | Open in IMG/M |
3300031713|Ga0318496_10294858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 895 | Open in IMG/M |
3300031747|Ga0318502_10290587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 960 | Open in IMG/M |
3300031751|Ga0318494_10565325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 664 | Open in IMG/M |
3300031770|Ga0318521_10755284 | Not Available | 592 | Open in IMG/M |
3300031771|Ga0318546_10961250 | Not Available | 601 | Open in IMG/M |
3300031778|Ga0318498_10079489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1478 | Open in IMG/M |
3300031794|Ga0318503_10285135 | Not Available | 536 | Open in IMG/M |
3300031798|Ga0318523_10380006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 702 | Open in IMG/M |
3300031805|Ga0318497_10432929 | Not Available | 736 | Open in IMG/M |
3300031846|Ga0318512_10293786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 807 | Open in IMG/M |
3300031859|Ga0318527_10105077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1162 | Open in IMG/M |
3300031860|Ga0318495_10264860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
3300031860|Ga0318495_10310826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
3300031912|Ga0306921_11900389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
3300031941|Ga0310912_10610734 | Not Available | 848 | Open in IMG/M |
3300031954|Ga0306926_12819928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300031959|Ga0318530_10455543 | Not Available | 531 | Open in IMG/M |
3300032008|Ga0318562_10777908 | Not Available | 548 | Open in IMG/M |
3300032054|Ga0318570_10208011 | Not Available | 884 | Open in IMG/M |
3300032063|Ga0318504_10616728 | Not Available | 521 | Open in IMG/M |
3300032066|Ga0318514_10368670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 761 | Open in IMG/M |
3300032076|Ga0306924_10075714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 3764 | Open in IMG/M |
3300032076|Ga0306924_11792878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 640 | Open in IMG/M |
3300032160|Ga0311301_10615019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1560 | Open in IMG/M |
3300032261|Ga0306920_104380216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
3300033134|Ga0335073_11480206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
3300033828|Ga0334850_080501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.41% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.20% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.36% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.52% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.68% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.84% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.84% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066810_100465441 | 3300005169 | Soil | VLSGAVTRAQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH* |
Ga0066683_107222232 | 3300005172 | Soil | GAVTSTQLEANLAALTVGQLSALRLAEPPDAYWAARAARPWH* |
Ga0066690_101832222 | 3300005177 | Soil | VHAGFAGVTRAQLEENLAALTVGQLPELSPAEAPDAYWAERAARPWH* |
Ga0066688_109197842 | 3300005178 | Soil | GAVTRAQLDQNLAALTVDQLPALSLAEAPDDYWAERAARPWH* |
Ga0070709_117893931 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRAQLDENLAALTVGQVPPLSLAEAPGAYWAERAARPWH* |
Ga0070714_1023569522 | 3300005435 | Agricultural Soil | VTRAQLEENLAALTVGQLPELSLAEAPDAYWAERAARPWR* |
Ga0070732_102509693 | 3300005542 | Surface Soil | AVTRAQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH* |
Ga0066699_104585811 | 3300005561 | Soil | VHAGFAGVTRAQLEENLAALTVGQLPELSPAEAPDAYWAERAAR |
Ga0070761_102661382 | 3300005591 | Soil | VTRAQLDENLAALTVGQLPVLSLAESPDAYWTERAARPWH* |
Ga0070762_106522971 | 3300005602 | Soil | AQLDENLAALAVGELPPLSLAEAPDAYWAERAARPWH* |
Ga0066903_1083979622 | 3300005764 | Tropical Forest Soil | AQLGQNLAALTVGGLPELDLAESPGAYWAARSARPWQ* |
Ga0066659_111199712 | 3300006797 | Soil | VHAGFAGVTRAQLEENLAALTVGHIPELIPAEAPDAYWAERAARPWH* |
Ga0079221_107941572 | 3300006804 | Agricultural Soil | SGAVTRAQLAENLAALTVGPLPALSLAEAPDAYWAERAARPWH* |
Ga0075426_110331311 | 3300006903 | Populus Rhizosphere | GAVTRPQLEANLAALTVGELPVLSLAEAPGTYWAARAARPWR* |
Ga0102924_10793983 | 3300007982 | Iron-Sulfur Acid Spring | VVSGAVTRAQLDENLTALTVGQLPALSLAEADGAYWAQRAARPWH* |
Ga0066710_1037163022 | 3300009012 | Grasslands Soil | CAWEVVHAGFAGVTRAQLEENLAALTVGHIPELIPAEAPDAYWAERAARPWH |
Ga0116214_10343323 | 3300009520 | Peatlands Soil | DENLAALTVGQLPALSLAEAPDAYWAERAARPWH* |
Ga0116220_101185733 | 3300009525 | Peatlands Soil | GAVTRAQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH* |
Ga0105237_112819721 | 3300009545 | Corn Rhizosphere | DENLAALTVGQVPPLSLAEAPGAYWAERAARPWH* |
Ga0105238_122363531 | 3300009551 | Corn Rhizosphere | TRAQLDENLAALSVGQLPALGLAEAPGAYWAQRAARPWH* |
Ga0123356_107380832 | 3300010049 | Termite Gut | VLSGAVTRAQLGENLAALTVGELPALGLAEAPDAYWAQRAVRPWH* |
Ga0134067_101182591 | 3300010321 | Grasslands Soil | VTRAQLDQNLAALTVGQLPALSLAEAPDAYWAERAARPWH* |
Ga0074044_101836431 | 3300010343 | Bog Forest Soil | VVLSGAVTRAQLDENLAALSVGPLPALSLAEAPGAYWAQRAARPWH* |
Ga0126372_128153521 | 3300010360 | Tropical Forest Soil | QLDENLAALTVGQLPELSLAEAPGAYWAERSARPWH* |
Ga0126381_1024802242 | 3300010376 | Tropical Forest Soil | VTGAQLDENLAALAVGRLPALSLAEAPDAYWAERAARPWH* |
Ga0136449_1007973894 | 3300010379 | Peatlands Soil | TRAQLDENLAALTVGQLPALNLAEAPDAYWAQRAARPWH* |
Ga0153924_10495851 | 3300012089 | Attine Ant Fungus Gardens | RAQLAENLAALTVGQVLPLSLAEDPDAYWAERAARPWH* |
Ga0137364_104003381 | 3300012198 | Vadose Zone Soil | VHAGFAGVTRAQLEENLAALTVGHIPELIPAEAPDAYWAERAAR |
Ga0137387_103809661 | 3300012349 | Vadose Zone Soil | AQLDENLAALTVGQVPPLSLAEAPGAYWAERAARPWH* |
Ga0126369_135908672 | 3300012971 | Tropical Forest Soil | VLSGAVTRAQLDENLAALTVGQLPELSLAEAPGAYWAERSARPWH* |
Ga0132257_1010411882 | 3300015373 | Arabidopsis Rhizosphere | EENLAALTVGQLPELSPAEAPDAYWAERAARPWH* |
Ga0182036_109425431 | 3300016270 | Soil | VLSGAVTRAQLDENLAALTVGPLPALSLAEAPDAYWAQRAARPWH |
Ga0182036_109962942 | 3300016270 | Soil | LSGAVTRKQLDENLAALTVGQLPALGLTEAPDAYWAERAARPWH |
Ga0182039_111332091 | 3300016422 | Soil | LDQNLAALTVGQLPALSLAEAPGAYWAERAARPWH |
Ga0187812_12059262 | 3300017821 | Freshwater Sediment | QLEQNLTALTVGPLPELSLAETPDTYWAERAARPWH |
Ga0187807_10381624 | 3300017926 | Freshwater Sediment | VTRAQLDENLAALTLSQLPSLRLAESPGSYWAERAARPWQ |
Ga0187806_11404982 | 3300017928 | Freshwater Sediment | VTRVQLDENLAALTVGEIPALSLAEAPDAYWAERAARPWR |
Ga0187814_103903761 | 3300017932 | Freshwater Sediment | QLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH |
Ga0187808_101991422 | 3300017942 | Freshwater Sediment | SGAVTSTQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH |
Ga0187847_109134201 | 3300017948 | Peatland | LSGAVTRAQLDENLAALTVGQLPALSLAEDPGAYWAERTARPWH |
Ga0187815_103167512 | 3300018001 | Freshwater Sediment | SGAVTRAQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH |
Ga0187805_100359703 | 3300018007 | Freshwater Sediment | VLSGAVTRAQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH |
Ga0187805_103709681 | 3300018007 | Freshwater Sediment | VTRAQLDENLAALTVGQLPALSLAEAPDAYWAQRAARPWH |
Ga0187810_100658623 | 3300018012 | Freshwater Sediment | VLSGAVTPAQLEQKLTALTVGPLPELSLAETPDTYWAERAARPWH |
Ga0187863_101253981 | 3300018034 | Peatland | LDENLAALTVGQLPALSLAEDPGAYWAERTARPWH |
Ga0187871_104761732 | 3300018042 | Peatland | LDENLAALTVGQLPPLSLAEDPGAYWAQRAARPWH |
Ga0066662_113727852 | 3300018468 | Grasslands Soil | VTRAQLEENLAALTVGQLPELSLAEAPDAYWAERAARPWH |
Ga0210395_102410203 | 3300020582 | Soil | RAQLDENLAALTVGQLPALGLAEPPDAYWAERAARPWH |
Ga0210401_109377141 | 3300020583 | Soil | LDENLAALTVGQLPALSLAEAPGAYWAERAARPWH |
Ga0210396_103643751 | 3300021180 | Soil | QLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH |
Ga0210397_103373673 | 3300021403 | Soil | GQLQSNLAALAVTDLPPLDLAEPPGAYWAERAARPWQ |
Ga0210387_105148421 | 3300021405 | Soil | AQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH |
Ga0210387_112727982 | 3300021405 | Soil | LSGAVTRAQLDENLAALTVGQLPALDLAEAPNAYWAERAARPWH |
Ga0210386_114605991 | 3300021406 | Soil | SGAVTRGQLDENLAALTVGQLPALSLAEAPVAYWEERAARPWH |
Ga0210386_115767121 | 3300021406 | Soil | TRAQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH |
Ga0210390_110620842 | 3300021474 | Soil | VTRGQLDENLAALTVGQLPALSLAEAPVAYWEERAARPWH |
Ga0210410_112435952 | 3300021479 | Soil | AVTRAQLDENLAALTVGQLPALDLAEAPDAYWAERAARPWH |
Ga0210409_109465022 | 3300021559 | Soil | SGAVTRAQLDGNLAALTVGQLPPLSLAEAPDAYWAERAARPWH |
Ga0210409_117165241 | 3300021559 | Soil | QLDENLAALTVGPLPALSLAEAPGAYWAERAARPWH |
Ga0126371_138741042 | 3300021560 | Tropical Forest Soil | GAVTRAQLDQNLAALNAGQFPALSLAEIPDTYWAERAARPWH |
Ga0179589_103588371 | 3300024288 | Vadose Zone Soil | AQLDENLAALTVGQVPPLSLAEAPGAYWAERAARPWH |
Ga0207684_100979391 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PRQLQSNLAALAVSDLHDLDIAEPPGSYWASRAARPWQ |
Ga0207684_107758511 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AVTRAQLDENLAALTVGQVPPLGLAEAPGAYWAERAARPWH |
Ga0207671_115740031 | 3300025914 | Corn Rhizosphere | TRAQLDENLAALTVGQLPALSLAEAPGAYWAQRAARPWH |
Ga0207660_103315811 | 3300025917 | Corn Rhizosphere | SGAVTSTQLEANLAALRVGELPALRLAEPPDAYWAARAARPWH |
Ga0207694_114100142 | 3300025924 | Corn Rhizosphere | AVTRAQLDENLAALSVGQLPALGLAEAPGAYWAQRAARPWH |
Ga0207687_103154181 | 3300025927 | Miscanthus Rhizosphere | VVLSGAVTRALLDENLAALTVGQVPPLSLAEAPGAYWAERAARPWH |
Ga0207667_118223301 | 3300025949 | Corn Rhizosphere | AVTRAQLEENLAALTVGQLPELSPAEAPDAYWAERAARPWH |
Ga0207702_108247531 | 3300026078 | Corn Rhizosphere | RAQLEENLAALTVGQLPELSLAEAPDAYWAERAARPWH |
Ga0207683_104324923 | 3300026121 | Miscanthus Rhizosphere | TRSQLEANLAALTVGELPALRLAEPPDAYWAARAARPWH |
Ga0209266_12669931 | 3300026327 | Soil | VTSTQLEANLAALTVGQLSALRLAEPPDAYWAARAARPWH |
Ga0209577_101479822 | 3300026552 | Soil | VHAGFAGVTRAQLEENLAALTVGHIPELIPAEAPDAYWAERAARPWH |
Ga0209178_10904401 | 3300027725 | Agricultural Soil | LEGNLAALTVGQVPTLSLAEAPDAYWAERAARPWH |
Ga0209693_104006531 | 3300027855 | Soil | AQLDENLAALTVGQLPALSLAEAPGAYWAQRAARPWH |
Ga0209415_102888891 | 3300027905 | Peatlands Soil | VTRAQLDENLAALTVGQLPALSLAEPPDAYWAERAARPWH |
Ga0302228_102437252 | 3300028808 | Palsa | QLDENLAALTVGQLPELSLAEDPSAYWAERAARPWH |
Ga0302229_105276752 | 3300028879 | Palsa | LSGAVTRAQLDENLAALTVGQLPGLSLAEDPGAYWAERAARPWH |
Ga0311340_112026832 | 3300029943 | Palsa | LAENLTALTVGQLPALSLAEDPAAYWQERAARPWH |
Ga0311340_115887181 | 3300029943 | Palsa | RAQLDENLAALTVGQLPGLSLAEDPGAYWAERAARPWH |
Ga0311339_115908381 | 3300029999 | Palsa | SGAVTRAQLDENLAALTVGQLPGLSLAEDPGAYWAERAARPWH |
Ga0302181_100495284 | 3300030056 | Palsa | VTRAQLDENLAALTVGQLPGLSLAEDPGAYWAERAARPWH |
Ga0302179_102031521 | 3300030058 | Palsa | VTRAQLDENLAALTVGPLPELSLAEDPGAYWAERAARPWH |
Ga0302179_105248611 | 3300030058 | Palsa | AVTSGQLHANLAALAVGRLPRLDLAEPPDAYWRARSARPWR |
Ga0302184_104162391 | 3300030490 | Palsa | RAQLDENLAALTVGQLPELSLAEDPGAYWAERAARPWH |
Ga0311370_112132862 | 3300030503 | Palsa | SGAVTRAQLDENLAALTVGQLPELSLAEDPGAYWAERAARPWH |
Ga0311355_101601261 | 3300030580 | Palsa | GAVTRAQLDENLAALTVGQLPELSLAEDPSAYWAERAARPWH |
Ga0311355_118825912 | 3300030580 | Palsa | TRAQLDENLAALTVGQLPGLSLAEDPGAYWAERAARPWH |
Ga0302311_103688233 | 3300030739 | Palsa | TRAQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH |
Ga0318555_100331171 | 3300031640 | Soil | QQLDANLAALTVGELPGLDLAESPAGYWAARSARPWR |
Ga0318542_104469181 | 3300031668 | Soil | RRQLGANLAALTVGELPGLDLAESPAGYWAARSARPWR |
Ga0318542_107465461 | 3300031668 | Soil | VLSGAVTRAQLEENLAALTVGRLPALSLAEAPGAYWAQRAARPWR |
Ga0318574_100511821 | 3300031680 | Soil | RAQLEENLAALTVGRLPALSLAEAPGAYWAQRAARPWR |
Ga0318496_102948581 | 3300031713 | Soil | SMQLEANLAALRVGGLPALSLAESPDAYWAARAARPWH |
Ga0318502_102905872 | 3300031747 | Soil | AVTSRQLGANLAALTVGELPGLDLAESPAGYWAARSARPWR |
Ga0318494_105653251 | 3300031751 | Soil | VTRRQLGANLAALTVGELPGLDLAESPAGYWAARSARPWR |
Ga0318521_107552841 | 3300031770 | Soil | LNENLAALTVGPLPAPSLAEAPDAYWAGRAARPWH |
Ga0318546_109612501 | 3300031771 | Soil | VLSGAVTRAQLNENLAALTVGPLPALSLAEAPDAYWAGRAARPWH |
Ga0318498_100794891 | 3300031778 | Soil | VLSGAVTSMQLQANLAALTVGELPALRLAEPPDAYWAARAARPWH |
Ga0318503_102851351 | 3300031794 | Soil | TRTQLEENLAALTVGQLPELSLAEAPDAYWTERAARPWH |
Ga0318523_103800061 | 3300031798 | Soil | VTSTQLEANLAALTVGELPALRLAEPPDAYRAARAARPWH |
Ga0318497_104329291 | 3300031805 | Soil | SGAVTRTQLDENLAALTVGQLPALGLTEAPDAYWAERAARPWH |
Ga0318512_102937862 | 3300031846 | Soil | SGAVTRAQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH |
Ga0318527_101050771 | 3300031859 | Soil | RAQLEENLAALTVGQLPALSLAEAPDAYWAERAARPWH |
Ga0318495_102648601 | 3300031860 | Soil | VLSGAVTRAQLDENLAALTVGPLPALSLAEAPDAYWVERAARPWH |
Ga0318495_103108261 | 3300031860 | Soil | VVLSGAVTRTQLEENLAALTVGQLPELSLAEAPDAYWTERAARPWH |
Ga0306921_119003892 | 3300031912 | Soil | SGAVTRAQLGENLAALAVGPLPALSLAEAPGAYWAERAGRPWH |
Ga0310912_106107342 | 3300031941 | Soil | LEENLAALTVGRLPALSLAEAPGAYWAQRAARPWR |
Ga0306926_128199281 | 3300031954 | Soil | QLDENLAALTVGPLPALSLAEAPDAYWAQRAARPWH |
Ga0318530_104555431 | 3300031959 | Soil | RTQLDENLAALTVGQLPALGLTEAPDAYWAERAARPWH |
Ga0318562_107779082 | 3300032008 | Soil | VTRAQLGENLAALAVGPLPALSLAEAPGAYWSERAGRPWH |
Ga0318570_102080111 | 3300032054 | Soil | VTRTQLDENLAALTVGQLPALGLTEAPDAYWAERAARPWH |
Ga0318504_106167281 | 3300032063 | Soil | RKQLDENLAALTVGQLPALGLTEAPDAYWAERAARPWH |
Ga0318514_103686702 | 3300032066 | Soil | GSPRRQLGANLAALTVGELPGLDLAESPAGYWAARSARPWR |
Ga0306924_100757141 | 3300032076 | Soil | RQQLDANLAALTVGELPGLDLAESPAGYWAARSARPWR |
Ga0306924_117928781 | 3300032076 | Soil | RAQLEENLAALTVGELPALSLAEAPVAYWAERAARPWH |
Ga0311301_106150194 | 3300032160 | Peatlands Soil | TRAQLDENLAALTVGQLPALNLAEAPDAYWAQRAARPWH |
Ga0306920_1043802161 | 3300032261 | Soil | VTRAQLDENLAALGVGQLPALSLAEAPDAYWAERAARPWH |
Ga0335073_114802061 | 3300033134 | Soil | VTRPELDENLAALTVGQPPALNLAEAPDAYWAERAARPWH |
Ga0334850_080501_3_119 | 3300033828 | Soil | SRQLHANLAALAVGELPRLDLAEPPAAYWQARSARPWR |
⦗Top⦘ |