| Basic Information | |
|---|---|
| Family ID | F074596 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 42 residues |
| Representative Sequence | WVSDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.96 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.269 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.815 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.697 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.39% β-sheet: 0.00% Coil/Unstructured: 82.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF12697 | Abhydrolase_6 | 10.08 |
| PF00296 | Bac_luciferase | 5.88 |
| PF02515 | CoA_transf_3 | 4.20 |
| PF04376 | ATE_N | 3.36 |
| PF04377 | ATE_C | 2.52 |
| PF01790 | LGT | 1.68 |
| PF16952 | Gln-synt_N_2 | 1.68 |
| PF02558 | ApbA | 1.68 |
| PF01370 | Epimerase | 0.84 |
| PF02781 | G6PD_C | 0.84 |
| PF12172 | DUF35_N | 0.84 |
| PF02738 | MoCoBD_1 | 0.84 |
| PF02518 | HATPase_c | 0.84 |
| PF04909 | Amidohydro_2 | 0.84 |
| PF01061 | ABC2_membrane | 0.84 |
| PF01135 | PCMT | 0.84 |
| PF03548 | LolA | 0.84 |
| PF01149 | Fapy_DNA_glyco | 0.84 |
| PF13714 | PEP_mutase | 0.84 |
| PF02636 | Methyltransf_28 | 0.84 |
| PF16868 | NMT1_3 | 0.84 |
| PF01593 | Amino_oxidase | 0.84 |
| PF00732 | GMC_oxred_N | 0.84 |
| PF13610 | DDE_Tnp_IS240 | 0.84 |
| PF12802 | MarR_2 | 0.84 |
| PF06738 | ThrE | 0.84 |
| PF00106 | adh_short | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 5.88 |
| COG2935 | Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 5.88 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 4.20 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.84 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.84 |
| COG1565 | SAM-dependent methyltransferase, MidA family | General function prediction only [R] | 0.84 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.84 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.84 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.84 |
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG2966 | Uncharacterized membrane protein YjjP, DUF1212 family | Function unknown [S] | 0.84 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.95 % |
| Unclassified | root | N/A | 26.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT02FOX6M | Not Available | 545 | Open in IMG/M |
| 3300003219|JGI26341J46601_10049189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1321 | Open in IMG/M |
| 3300004635|Ga0062388_102087087 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005332|Ga0066388_105916914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300005363|Ga0008090_13882259 | Not Available | 550 | Open in IMG/M |
| 3300005434|Ga0070709_10582100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300005436|Ga0070713_102392336 | Not Available | 511 | Open in IMG/M |
| 3300005439|Ga0070711_100345873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1194 | Open in IMG/M |
| 3300005568|Ga0066703_10340129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
| 3300005602|Ga0070762_10120629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1540 | Open in IMG/M |
| 3300005952|Ga0080026_10246517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 538 | Open in IMG/M |
| 3300006800|Ga0066660_10774671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300006954|Ga0079219_12514945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300009523|Ga0116221_1500835 | Not Available | 532 | Open in IMG/M |
| 3300010048|Ga0126373_12115471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300010341|Ga0074045_10119905 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300010358|Ga0126370_10004622 | All Organisms → cellular organisms → Bacteria | 6826 | Open in IMG/M |
| 3300010360|Ga0126372_10621978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
| 3300010361|Ga0126378_11000511 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300010362|Ga0126377_11243203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300010362|Ga0126377_12754079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300010398|Ga0126383_12753715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300012180|Ga0153974_1037438 | Not Available | 1058 | Open in IMG/M |
| 3300012205|Ga0137362_11303163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300012212|Ga0150985_114592128 | Not Available | 565 | Open in IMG/M |
| 3300012359|Ga0137385_11507002 | Not Available | 536 | Open in IMG/M |
| 3300012362|Ga0137361_10185518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1877 | Open in IMG/M |
| 3300012469|Ga0150984_105345452 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina → Glossina → Glossina morsitans → Glossina morsitans morsitans | 851 | Open in IMG/M |
| 3300012948|Ga0126375_11256169 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300015264|Ga0137403_10216729 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300016270|Ga0182036_10413473 | Not Available | 1053 | Open in IMG/M |
| 3300016319|Ga0182033_11750487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300016341|Ga0182035_10234962 | Not Available | 1471 | Open in IMG/M |
| 3300016341|Ga0182035_10605876 | Not Available | 947 | Open in IMG/M |
| 3300016341|Ga0182035_10659117 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300016371|Ga0182034_10358959 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300016371|Ga0182034_10523954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 992 | Open in IMG/M |
| 3300016387|Ga0182040_10032005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3091 | Open in IMG/M |
| 3300016387|Ga0182040_10496846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 974 | Open in IMG/M |
| 3300016404|Ga0182037_11531063 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300017961|Ga0187778_10885102 | Not Available | 613 | Open in IMG/M |
| 3300018006|Ga0187804_10268749 | Not Available | 738 | Open in IMG/M |
| 3300020579|Ga0210407_10188473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1600 | Open in IMG/M |
| 3300020579|Ga0210407_10509969 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300020579|Ga0210407_11289808 | Not Available | 546 | Open in IMG/M |
| 3300020583|Ga0210401_10480916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
| 3300021168|Ga0210406_10645659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300021374|Ga0213881_10024609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2508 | Open in IMG/M |
| 3300021401|Ga0210393_11543829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300021404|Ga0210389_10581176 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina → Glossina → Glossina morsitans → Glossina morsitans morsitans | 881 | Open in IMG/M |
| 3300021439|Ga0213879_10181324 | Not Available | 621 | Open in IMG/M |
| 3300021475|Ga0210392_10298261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1154 | Open in IMG/M |
| 3300021560|Ga0126371_11318437 | Not Available | 855 | Open in IMG/M |
| 3300021560|Ga0126371_12021995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300022531|Ga0242660_1035873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1023 | Open in IMG/M |
| 3300022533|Ga0242662_10098138 | Not Available | 832 | Open in IMG/M |
| 3300022712|Ga0242653_1027823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300022715|Ga0242678_1057920 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025922|Ga0207646_10603641 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300026078|Ga0207702_11495562 | Not Available | 669 | Open in IMG/M |
| 3300026335|Ga0209804_1065587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1734 | Open in IMG/M |
| 3300026359|Ga0257163_1069120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300026490|Ga0257153_1095736 | Not Available | 591 | Open in IMG/M |
| 3300026548|Ga0209161_10570599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300027684|Ga0209626_1127306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
| 3300027727|Ga0209328_10170990 | Not Available | 659 | Open in IMG/M |
| 3300027824|Ga0209040_10166952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1173 | Open in IMG/M |
| 3300027968|Ga0209061_1048942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1764 | Open in IMG/M |
| 3300028906|Ga0308309_11268503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300031231|Ga0170824_124900386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300031236|Ga0302324_102584802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300031474|Ga0170818_115452652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300031545|Ga0318541_10290248 | Not Available | 911 | Open in IMG/M |
| 3300031545|Ga0318541_10635679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300031573|Ga0310915_11202949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300031668|Ga0318542_10228161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella | 943 | Open in IMG/M |
| 3300031680|Ga0318574_10345054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 868 | Open in IMG/M |
| 3300031719|Ga0306917_11218272 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
| 3300031744|Ga0306918_10923198 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300031753|Ga0307477_10397517 | Not Available | 944 | Open in IMG/M |
| 3300031753|Ga0307477_10959209 | Not Available | 562 | Open in IMG/M |
| 3300031768|Ga0318509_10037401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2413 | Open in IMG/M |
| 3300031768|Ga0318509_10605078 | Not Available | 610 | Open in IMG/M |
| 3300031770|Ga0318521_10093193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1645 | Open in IMG/M |
| 3300031770|Ga0318521_11045267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300031771|Ga0318546_10454716 | Not Available | 897 | Open in IMG/M |
| 3300031777|Ga0318543_10290051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300031779|Ga0318566_10383176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300031793|Ga0318548_10463830 | Not Available | 620 | Open in IMG/M |
| 3300031795|Ga0318557_10248646 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300031819|Ga0318568_11027704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300031821|Ga0318567_10563307 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300031833|Ga0310917_10334144 | Not Available | 1027 | Open in IMG/M |
| 3300031833|Ga0310917_10809820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300031860|Ga0318495_10431312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 579 | Open in IMG/M |
| 3300031880|Ga0318544_10422395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus | 519 | Open in IMG/M |
| 3300031893|Ga0318536_10503283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300031896|Ga0318551_10406819 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300031897|Ga0318520_10744137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300031910|Ga0306923_10848806 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300031910|Ga0306923_11300916 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031945|Ga0310913_10511837 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300031954|Ga0306926_11209300 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300031954|Ga0306926_11520061 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300032001|Ga0306922_10558366 | Not Available | 1216 | Open in IMG/M |
| 3300032035|Ga0310911_10105842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1547 | Open in IMG/M |
| 3300032035|Ga0310911_10259576 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300032039|Ga0318559_10195356 | Not Available | 929 | Open in IMG/M |
| 3300032042|Ga0318545_10215591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300032063|Ga0318504_10222154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300032067|Ga0318524_10575322 | Not Available | 593 | Open in IMG/M |
| 3300032076|Ga0306924_10987336 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300032091|Ga0318577_10105605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1321 | Open in IMG/M |
| 3300032160|Ga0311301_10861266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1230 | Open in IMG/M |
| 3300032180|Ga0307471_100833114 | Not Available | 1090 | Open in IMG/M |
| 3300032261|Ga0306920_100171745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3232 | Open in IMG/M |
| 3300032261|Ga0306920_100353260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2187 | Open in IMG/M |
| 3300032261|Ga0306920_104177003 | Not Available | 521 | Open in IMG/M |
| 3300032782|Ga0335082_11637857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.36% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.52% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.84% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.84% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.84% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.84% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.84% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.84% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.84% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.84% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.84% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2ZMR_04053640 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | VLVRDGTVQLWISADEPPEKRQALRIAAETIPGVRGVEEHVMPAPLIPPL |
| JGI26341J46601_100491891 | 3300003219 | Bog Forest Soil | DKIVHLWCSDDQSDEERQALRVAAENTPGVRGVEVHIVHRPRRDWW* |
| Ga0062388_1020870871 | 3300004635 | Bog Forest Soil | WVSDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF* |
| Ga0066388_1059169141 | 3300005332 | Tropical Forest Soil | LWFSDDRSGDERQALRVAAENISGVRKVEEHIVPAPVFPSF* |
| Ga0008090_138822591 | 3300005363 | Tropical Rainforest Soil | VHFWISEDEPTEKRQALRVAAENISGVRGVEEHVVPAPLVPAF* |
| Ga0070709_105821002 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDDRPEEERQALRVAAENVTGVRSVEEHIVPAPLIPPAF* |
| Ga0070713_1023923362 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | FWISEDEPGEKRQALRVAAETIPGVRGVEEHVVPAPVIPAF* |
| Ga0070711_1003458731 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VHFWISEDEPSEKRQALRVAAETITGVRGVEEHVVPAPVVPAF* |
| Ga0066703_103401291 | 3300005568 | Soil | WFSDDRSEEERQAVRVAAENIPGVQRVEEHIVPAPVIPSF* |
| Ga0070762_101206291 | 3300005602 | Soil | IVRDGVVHFWLSSDEPEENKQALRVAAETTSGIRRVEEHVVPAPVFPAF* |
| Ga0080026_102465171 | 3300005952 | Permafrost Soil | VKDQVAHLWMCDDRPADQRQALRIAAENTAGVRGVQEHIVPGSPMPAF* |
| Ga0066660_107746713 | 3300006800 | Soil | GSVHLWISADESPEKRQALRVAAETIPGVRGVEEHVMPVALIPAL* |
| Ga0079219_125149452 | 3300006954 | Agricultural Soil | HIWVSEDRPREERQALRVAAENVPGVLGVEEHIVPAPIIPPPF* |
| Ga0116221_15008351 | 3300009523 | Peatlands Soil | WLSDDESGEKRDALRVAAESIIGVHGVEEHLLPAPLVPAF* |
| Ga0126373_121154713 | 3300010048 | Tropical Forest Soil | DDRPREERQALRIAAENIPGVHAVEEHLVPAPMIPPPF* |
| Ga0074045_101199051 | 3300010341 | Bog Forest Soil | DDQPEAERQAFRVAAENISGVKRVQEHIVPAPVIPSF* |
| Ga0126370_100046225 | 3300010358 | Tropical Forest Soil | ISEDEPTENRRALRVAAETIPGVRGVQEHDVPAPVITAF* |
| Ga0126372_106219782 | 3300010360 | Tropical Forest Soil | VHFWISEDEPGEKRQALRVAAEAITGVRGVEEHVVPAPLVPAF* |
| Ga0126378_110005112 | 3300010361 | Tropical Forest Soil | VVHVWVSDDSAPHERQALRVAAENTPGVRGVEEHLVPAPLIPPAF* |
| Ga0126377_112432032 | 3300010362 | Tropical Forest Soil | VRDGVVHIWVGDDRPQAEKEALRIAAENIAGVRGVEEHLVPAPMIPPAF* |
| Ga0126377_127540791 | 3300010362 | Tropical Forest Soil | RVVHLWFSDDRSEDERQAVRVAAENIPGVQRVEEHIVPAPVIPSF* |
| Ga0126383_127537152 | 3300010398 | Tropical Forest Soil | VVHLWFSDDRSEDERQAVRVAAENIPGVRQVQEHIVPAAVFPAF* |
| Ga0153974_10374382 | 3300012180 | Attine Ant Fungus Gardens | EPEEKRQALRVAAEAIAGVRGVQEHIMPAAYFPAF* |
| Ga0137362_113031631 | 3300012205 | Vadose Zone Soil | HLWFSDDRSEEERQAVRVAAENIPGVQRVEEHIVPAPIIPSF* |
| Ga0150985_1145921282 | 3300012212 | Avena Fatua Rhizosphere | AHIWVSDDRPEEERQALRVAAENVTGGRGVEEHLVPAPLIPPAF* |
| Ga0137385_115070022 | 3300012359 | Vadose Zone Soil | QPEEERQAIRVAAENIPGVREVEQHITPAPLIPSF* |
| Ga0137361_101855183 | 3300012362 | Vadose Zone Soil | VHLWFSDDRSEEERQAVRVAAENIPGVQRVEEHIVPAPIIPSF* |
| Ga0150984_1053454522 | 3300012469 | Avena Fatua Rhizosphere | DDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF* |
| Ga0126375_112561691 | 3300012948 | Tropical Forest Soil | LSKDQTEEERRALRVAAENIPGVRRVEEHIIPAV* |
| Ga0137403_102167291 | 3300015264 | Vadose Zone Soil | WFSDDQPLEERLTFRVAAENIAGVRGVEEHIVAPPGVPPGGGGGKR* |
| Ga0182036_104134731 | 3300016270 | Soil | SEDEPPEKRQALRVAAETIPGVRGIEEHVVPAPLVPAF |
| Ga0182033_117504872 | 3300016319 | Soil | IVHFWISEDEPNERKQALRVAAETIAGVRGVEEHVVPAPVMPAF |
| Ga0182035_102349621 | 3300016341 | Soil | DEPTEKRQALRVAAETIPGVRGIEEHVLLAPLVPAF |
| Ga0182035_106058762 | 3300016341 | Soil | SDDRSEAERQAVRVAAENIPGVRQVEEHIVPAPALPAF |
| Ga0182035_106591172 | 3300016341 | Soil | VHIWVSDDRSLEEREALRVAAENIPGVRGVEEHLVPAPLIPAAF |
| Ga0182034_103589593 | 3300016371 | Soil | RDRVVHLWFSDDRSDEERQAVRIAAENIPGVRQVEEHIVPVPAFPAF |
| Ga0182034_105239542 | 3300016371 | Soil | GVVHIWVSDDRPREERQALRVAAENIPGVHGVEEHLVPAPMIPPPF |
| Ga0182040_100320054 | 3300016387 | Soil | SDDRSEEERQAVRVAAENIPGVRQVEEHIVPAPVFPSF |
| Ga0182040_104968464 | 3300016387 | Soil | WFSDDRSEDERQALRVAAENISGVRKVEEHIVPAPVFPSF |
| Ga0182037_115310632 | 3300016404 | Soil | RDRVVHLWFSDDRSEDERQAVRIAAENIAGVRQVQEHIVPAAVFPAF |
| Ga0187778_108851021 | 3300017961 | Tropical Peatland | SADESDAERQAVRVAAENVAGVRKVEEHIVPAPVFPAF |
| Ga0187804_102687492 | 3300018006 | Freshwater Sediment | VHVWMADDQPEAEKQALRVAAENIPGVRRVEEHIVPAPAIPAF |
| Ga0210407_101884733 | 3300020579 | Soil | DGVVHIWVSDDRPEEEQRALRVAAENIPGVHGVEEHIVPAPMIPPAF |
| Ga0210407_105099692 | 3300020579 | Soil | PPEERQAMRVAAENIPGVQGVEEHLVPAPIVLPAF |
| Ga0210407_112898081 | 3300020579 | Soil | HFWISEDEPSEKRLALRVAAETITGVRGIEEHVVPAPVVPAF |
| Ga0210401_104809162 | 3300020583 | Soil | IVHFWISEDEPSEKRLALRVAAETITGVRGIEEHVVPAPVVPAF |
| Ga0210406_106456592 | 3300021168 | Soil | WVSDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF |
| Ga0213881_100246094 | 3300021374 | Exposed Rock | KFVRDGVVHFWISADEPTEKRQALRVAAETIAGVRGVEEHLVPAPMIPAF |
| Ga0210393_115438292 | 3300021401 | Soil | FWLSSDEPDEKKQALRVAAETIPGVRGVEEHAVPAPSIPAF |
| Ga0210389_105811761 | 3300021404 | Soil | SDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF |
| Ga0213879_101813242 | 3300021439 | Bulk Soil | HFWVSEDEPSEKRQALRVAAETIPGVRGVEEHDVPGAVITAF |
| Ga0210392_102982611 | 3300021475 | Soil | RSEEERQAVRVAAENIPGVQRVEEHIVPAPVIPSF |
| Ga0126371_113184371 | 3300021560 | Tropical Forest Soil | EPSGKRQALRVAAETITGVRGVEEHVVPAPMIPAF |
| Ga0126371_120219951 | 3300021560 | Tropical Forest Soil | LWVSDDRLQEERQALRVAAEDIPGVRGVEEHLVPAPMIPPPF |
| Ga0242660_10358731 | 3300022531 | Soil | SDDRPEEERQALRVAAENIPGVHGVEEHIVPAPMIPPAF |
| Ga0242662_100981381 | 3300022533 | Soil | DDRPDGERQALRVAAENIPGVRGVEEHIVPAPMVPPAF |
| Ga0242653_10278232 | 3300022712 | Soil | VVHIWVSDDRPEEERQALRVAAENIPGVHGVEEHIVPAPMIPPAF |
| Ga0242678_10579202 | 3300022715 | Soil | SDDRSEDERQALRIAAENIPGVRQVQEHIVPAAVFPAF |
| Ga0207646_106036412 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RDRAVHIWVSDDRPPEERQALRIAAENIPGVRTVEEHLVPAPLIPPAF |
| Ga0207702_114955621 | 3300026078 | Corn Rhizosphere | IVSDSVVHLWFSSDEPEEKRQAVRIAAENIPGVRGVEEYVVPAPLIPTF |
| Ga0209804_10655873 | 3300026335 | Soil | PDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF |
| Ga0257163_10691201 | 3300026359 | Soil | DRPPEERQAMRVAAENIPGVQGVEEHLVPAPLVPPAF |
| Ga0257153_10957361 | 3300026490 | Soil | WVSDDRPPEERQAMRVAAENIPGVQGVEEHLVPAPLVPPAF |
| Ga0209161_105705992 | 3300026548 | Soil | VHIWVSDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF |
| Ga0209626_11273061 | 3300027684 | Forest Soil | DRPEEERQALRVAAENIPGVRGVEEHIVPAPLIPPAF |
| Ga0209328_101709901 | 3300027727 | Forest Soil | VVHLWVSDDRPPEERQAMRVAAENIPGVQGVEEHLVPAPIVLPAF |
| Ga0209040_101669523 | 3300027824 | Bog Forest Soil | DGIVHFWISEDEPNEKRQALRVAAETITGVRGVEEHLVPAAVIPAF |
| Ga0209061_10489423 | 3300027968 | Surface Soil | DRSEDERAALRVAAENVPGVRRVEEHLVPVPVIPGF |
| Ga0308309_112685032 | 3300028906 | Soil | IWVSDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF |
| Ga0170824_1249003862 | 3300031231 | Forest Soil | DRVVHLWFSDDRSEEERQAVRVAAENITGVQRVEEHIVPAPVIPVF |
| Ga0302324_1025848022 | 3300031236 | Palsa | RDGTVHFWLSDDEHEEKRQALRVAAETIAGVRSVEEHFLPAPAVPAF |
| Ga0170818_1154526522 | 3300031474 | Forest Soil | LWFSDDRSEDERQALRVAAENIPGVRQVQEHIVPAAVFPAF |
| Ga0318541_102902481 | 3300031545 | Soil | LWFSDEQPREERLTFRVAAENIPGVRRVEEHIVTVPAITSA |
| Ga0318541_106356792 | 3300031545 | Soil | VVHIWVSDDRPGEERQALRVAAENIPGVHGVEEHLVPAPMIPPPF |
| Ga0310915_112029491 | 3300031573 | Soil | GIVHFWISEDEPNERKQALRVAAETIAGVRGVEEHVVPAPVMPAF |
| Ga0318542_102281613 | 3300031668 | Soil | RDGIVHFWVSEDELSEKRQALRVAAETILGVRGVEEHTVPARVIPAF |
| Ga0318574_103450542 | 3300031680 | Soil | DRVVHLWFSDDQPREERLTFRVAAENIPGVRRVEEHIVAPPAPDRGEGQR |
| Ga0306917_112182722 | 3300031719 | Soil | FWISEDEPTGKRQALRVAAETIPGVRGVEEHVVPAPLVPAF |
| Ga0306918_109231982 | 3300031744 | Soil | DDRPEEERRALRVAAENIPGVRGVEEHIVPAPIVPAF |
| Ga0307477_103975171 | 3300031753 | Hardwood Forest Soil | KVVHVWMADDQPEAEKQALRIAAENIPGVRRVEEHIVPAPVIPAF |
| Ga0307477_109592091 | 3300031753 | Hardwood Forest Soil | ISEDEPSEKRHALRVAAETITGVRGIEEHVVPAPVVPAF |
| Ga0318509_100374011 | 3300031768 | Soil | RVVHLWFSDDQPREERLTFRVAAENIPGVRRVEEHIVAPPAPDRGEGQR |
| Ga0318509_106050782 | 3300031768 | Soil | VRDRIVHLWFSDDRSEDERQALRVAAENISGVRKVEEHIVPAPVFPSF |
| Ga0318521_100931931 | 3300031770 | Soil | RDRVVHLWFSDDRSEEERQALRVAAENIPGVRQVEEHVVPAPVFPSF |
| Ga0318521_110452671 | 3300031770 | Soil | LWFSDDRSEEERQALRIAAENIPGVRQVQEHIVPAPVFPSF |
| Ga0318546_104547161 | 3300031771 | Soil | VRDRVVYLWFSDEQPREERLTFRVAAENIPGVRRVEEHIVTVPAITSA |
| Ga0318543_102900511 | 3300031777 | Soil | LWFSDDRSEEERQALRVAAENIPGVRQVEEHVVPAPVFPSF |
| Ga0318566_103831762 | 3300031779 | Soil | DRVVHLWFSDDRSEEERQALRIAAENIPGVRQVQEHIVPAPVFPSF |
| Ga0318548_104638302 | 3300031793 | Soil | WFSDDRSDEERQAVRIAAENIPGVRQVQEHIVPVPAFPAF |
| Ga0318557_102486463 | 3300031795 | Soil | FWVSEDELSEKRQALRVAAETILGVRGVEEHTVPAPVIPAF |
| Ga0318568_110277041 | 3300031819 | Soil | DRVVHLWFSDDRSDEERQAVRIAAENIPGVRQVQEHIVPVPAFPAF |
| Ga0318567_105633072 | 3300031821 | Soil | LWFSDDRSEEERQAVRVAAENIPGVRQVEEHIVPVPVFPSF |
| Ga0310917_103341441 | 3300031833 | Soil | VVHLWFSDDRSEAERQAVRVAAENIPGVRQVEEHIVPAPALPAF |
| Ga0310917_108098202 | 3300031833 | Soil | SDDRSEDERQALRVAAENISGVRKVEEHIVPAPVFPSF |
| Ga0318495_104313121 | 3300031860 | Soil | VHVWVSDDRSPEERQALRIAAENIPGVRSVEEHLVPAPLIPPAF |
| Ga0318544_104223952 | 3300031880 | Soil | RSPEERQALRIAAENIPGVRSVEEHLVPAPLIPPAF |
| Ga0318536_105032831 | 3300031893 | Soil | VVHLWFSDDRSEEERQALRVAAENIPGVRQVQEHIVPAPVFPSF |
| Ga0318551_104068191 | 3300031896 | Soil | LWFSDDRSEEERQAVRVAAENIPGVRQVEEHIVPAPVFPSF |
| Ga0318520_107441371 | 3300031897 | Soil | SDDRSDEERQAVRIAAENIPGVRQVQEHIVPVPAFPAF |
| Ga0306923_108488061 | 3300031910 | Soil | HIWVSDDRSLEEREALRVAAENIPGVRGVEEHLVPAPLIPAAF |
| Ga0306923_113009163 | 3300031910 | Soil | HFWLSNDQSEEERLALRVAAENIAGVRGVEEHMIPAP |
| Ga0310913_105118372 | 3300031945 | Soil | HIWISEDEPVEKREALRVAAETTPGVRGVEEHAVPAPLIPAF |
| Ga0306926_112093001 | 3300031954 | Soil | RSDEERQAVRIAAENIPGVRQVQEHIVPVPAFPAF |
| Ga0306926_115200611 | 3300031954 | Soil | LWFSDDRSEDERQAVRIAAENIAGVRQVQEHIVPAAVFPAF |
| Ga0306922_105583664 | 3300032001 | Soil | VHFWISEDEPTEKRQALRVAAETIPGVRGIEEHVLLAPLVPAF |
| Ga0310911_101058421 | 3300032035 | Soil | DDRSEEERQALRVAAENVPGVRQVEEHVVPAPVFPSF |
| Ga0310911_102595761 | 3300032035 | Soil | FSDDRSDEERQAVRIAAENIPGVRQVQEHIVPVPAFPAF |
| Ga0318559_101953562 | 3300032039 | Soil | WFSDDRSEEERQALRVAAENVPGVRQVEEHVVPAPVFPSF |
| Ga0318545_102155911 | 3300032042 | Soil | ADIIVRDRIVHLWFSDDRSEDERQALRVAAENISGVRKVEEHIVPAPVFPSF |
| Ga0318504_102221542 | 3300032063 | Soil | VRDGVVHIWVGDDRPPAEKEALRVAAENIAGVRGVEEHLVPAPMIPPAF |
| Ga0318524_105753221 | 3300032067 | Soil | MVRDKVVHIWMSDDQPMAERDALRVAAENISGVRRVEEHIVPAAVVPAF |
| Ga0306924_109873362 | 3300032076 | Soil | RPEEERRALRVAAENIPGVRGVEEHIVPAPIVPAF |
| Ga0318577_101056053 | 3300032091 | Soil | IIVRDGIVHFWISADEPSEKRQALRVAAETIAGVRSVEEHVVSAPVIPAF |
| Ga0311301_108612662 | 3300032160 | Peatlands Soil | MVRDKVVHVWLSDDQPIAERDALRVAAENIPGVRRVEEHIVPAPVVPAF |
| Ga0307471_1008331141 | 3300032180 | Hardwood Forest Soil | DDRSEDERQALRVAAENIPGVRQVQEHIVPAAVFPAF |
| Ga0306920_1001717453 | 3300032261 | Soil | PEEKRQALRVAAETIPGVRGVEEHILPAVSVPGTFA |
| Ga0306920_1003532603 | 3300032261 | Soil | RSEDERQAVRIAAENIAGVRQVQEHIVPAAVFPAF |
| Ga0306920_1041770032 | 3300032261 | Soil | ESDAERQAVRVAAENVAGVRKVEEHIVPAPVFPAF |
| Ga0335082_116378571 | 3300032782 | Soil | RVVHLWFSDDRSEDERQAVRVAAENIPGVQRVEEHIVPAPVIPAF |
| ⦗Top⦘ |