| Basic Information | |
|---|---|
| Family ID | F074576 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 45 residues |
| Representative Sequence | QRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.72 % |
| % of genes near scaffold ends (potentially truncated) | 36.13 % |
| % of genes from short scaffolds (< 2000 bps) | 44.54 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (85.714 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (18.487 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.546 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.109 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.78% β-sheet: 17.78% Coil/Unstructured: 64.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF11750 | DUF3307 | 12.61 |
| PF03692 | CxxCxxCC | 9.24 |
| PF04851 | ResIII | 6.72 |
| PF09511 | RNA_lig_T4_1 | 4.20 |
| PF00383 | dCMP_cyt_deam_1 | 3.36 |
| PF00149 | Metallophos | 2.52 |
| PF13528 | Glyco_trans_1_3 | 1.68 |
| PF01541 | GIY-YIG | 0.84 |
| PF15891 | Nuc_deoxyri_tr2 | 0.84 |
| PF14572 | Pribosyl_synth | 0.84 |
| PF13704 | Glyco_tranf_2_4 | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 85.71 % |
| All Organisms | root | All Organisms | 14.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 18.49% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.29% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.92% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.88% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.04% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.52% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.68% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.68% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.84% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.84% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.84% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002389 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024554 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024564 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024856 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027287 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29643_1014031 | 3300002389 | Freshwater | RTVIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT* |
| metazooDRAFT_14447491 | 3300002471 | Lake | DRTVIEAINHATDMNFFYSFEEDFFWFNDQIPDWKLAKVS* |
| JGI25908J49247_100193913 | 3300003277 | Freshwater Lake | MEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| JGI25908J49247_100240132 | 3300003277 | Freshwater Lake | MEFRGKQRTLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNTK* |
| JGI25908J49247_100302064 | 3300003277 | Freshwater Lake | YPHMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNTK* |
| JGI25912J50252_100271303 | 3300003412 | Freshwater Lake | LNDRTIIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKKV* |
| JGI25912J50252_100542682 | 3300003412 | Freshwater Lake | MEFRGKQRQLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNVS* |
| Ga0049083_101352243 | 3300005580 | Freshwater Lentic | TVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| Ga0049081_102757463 | 3300005581 | Freshwater Lentic | LNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKI* |
| Ga0049082_101010872 | 3300005584 | Freshwater Lentic | QLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| Ga0049084_100207484 | 3300005585 | Freshwater Lentic | MEFRGKQRQLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNTK* |
| Ga0049084_100485672 | 3300005585 | Freshwater Lentic | YPHMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| Ga0073922_10198381 | 3300005955 | Sand | IEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| Ga0070749_103045963 | 3300006802 | Aqueous | PHMEFRGKPRQLNDRTVIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT* |
| Ga0102820_10427223 | 3300007554 | Estuarine | LNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNTK* |
| Ga0105747_12494673 | 3300007974 | Estuary Water | RTVIEAYNNATNQTFHYSFEEDFFWFSGQIPDWKLKKI* |
| Ga0105748_101069303 | 3300007992 | Estuary Water | QLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKKV* |
| Ga0114340_10891263 | 3300008107 | Freshwater, Plankton | MEFRGKQRQMNDRTVMEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKI* |
| Ga0114340_12435792 | 3300008107 | Freshwater, Plankton | MEFRGKQRQLNDRTVMEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT* |
| Ga0114341_1001589514 | 3300008108 | Freshwater, Plankton | MEFRGKQRQLNDRKVIEAYNPATNQTFFYSFDEDFFWFPGQIPDWKLKNTI* |
| Ga0114341_100868817 | 3300008108 | Freshwater, Plankton | RGKRRELNNREVMEAYNPVTGQTFFYSFEEDFFWFSGQIPDYKLPKIS* |
| Ga0114343_11777432 | 3300008110 | Freshwater, Plankton | MEFRGKQRHMNDRTVMEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKET* |
| Ga0114346_11872692 | 3300008113 | Freshwater, Plankton | MEFRGKQRHMNDRTVMEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKVT* |
| Ga0114346_12177023 | 3300008113 | Freshwater, Plankton | IEAYNPATEQHFFYSFDEDFFWFKDQIPDWKLQKIS* |
| Ga0114346_13176651 | 3300008113 | Freshwater, Plankton | AYNPATNQTFFYSFDEDFFWFPGQIPDWKLKNTI* |
| Ga0114347_11130262 | 3300008114 | Freshwater, Plankton | MEFRGKQRQLNDRTVMEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKI* |
| Ga0114840_10605273 | 3300008258 | Freshwater, Plankton | MEFRGKQRQLNDRTVMEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSI |
| Ga0114363_10869484 | 3300008266 | Freshwater, Plankton | EAYNPATNQTFFYSFDEDFFWFPGQIPDYKLSKSILT* |
| Ga0114363_11959492 | 3300008266 | Freshwater, Plankton | QRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| Ga0114363_11979703 | 3300008266 | Freshwater, Plankton | MEFRGKQRQMNDRTVIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT* |
| Ga0102886_10993181 | 3300009052 | Estuarine | TVIEAYNNATNQTFHYSFDEDLFWFAGQIPDWKLKKVS* |
| Ga0114973_104555801 | 3300009068 | Freshwater Lake | QRQFNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKV* |
| Ga0114973_106339142 | 3300009068 | Freshwater Lake | MEFRGKQRQFNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| Ga0114968_104057782 | 3300009155 | Freshwater Lake | IEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNVS* |
| Ga0114968_104168063 | 3300009155 | Freshwater Lake | PHMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNVS* |
| Ga0114968_105628971 | 3300009155 | Freshwater Lake | PHMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| Ga0114977_101059651 | 3300009158 | Freshwater Lake | KYPHMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| Ga0114977_104233222 | 3300009158 | Freshwater Lake | TVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNVS* |
| Ga0114981_101726171 | 3300009160 | Freshwater Lake | VIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNVS* |
| Ga0114966_102982481 | 3300009161 | Freshwater Lake | KQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNVS* |
| Ga0114979_105330372 | 3300009180 | Freshwater Lake | RGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNTK* |
| Ga0114974_106758192 | 3300009183 | Freshwater Lake | MEFRGKQRQLNDRTVIEAYNNATNQTFHYSFEEDFFWFSGQIPDWKLKKI* |
| Ga0114976_101430801 | 3300009184 | Freshwater Lake | VIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| Ga0114971_106602532 | 3300009185 | Freshwater Lake | RTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNVS* |
| Ga0133913_115417614 | 3300010885 | Freshwater Lake | HMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVA* |
| Ga0151620_12169711 | 3300011268 | Freshwater | IEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNTK* |
| Ga0119955_11900702 | 3300012006 | Freshwater | QLNDRIVIEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKVS* |
| Ga0153799_10093731 | 3300012012 | Freshwater | LNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS* |
| Ga0164293_109573621 | 3300013004 | Freshwater | DRIVIEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKI* |
| Ga0164295_114754241 | 3300013014 | Freshwater | TVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNVS* |
| (restricted) Ga0172367_102809423 | 3300013126 | Freshwater | IEAYNPSTDMSFYYSFDEDFFWFTGQIPDWKLPKS* |
| (restricted) Ga0172364_103180612 | 3300013129 | Sediment | IEAYNHATEQNFYYSFEEDFFWFAGQIPDYKLPKVS* |
| Ga0177922_106350892 | 3300013372 | Freshwater | YPHMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFPGQIPDWKLKKI* |
| Ga0181364_10340352 | 3300017701 | Freshwater Lake | MEFRGKQRTLNDRTVIEAYNNATNQTFHYSFEEDFFWFSGQIPDWKLKNVS |
| Ga0181365_10362691 | 3300017736 | Freshwater Lake | MEFRGKQRQLNDRTVIEAYNNVTNQTFHYSFEEDFFWFAGQIPDWKLKNTK |
| Ga0181352_11151022 | 3300017747 | Freshwater Lake | QMNDRTVIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0181348_11591083 | 3300017784 | Freshwater Lake | YPHMEFRGKQRTLNDRTVIEAYNNATNQTFHYSFDEDFFWFVGQIPDWKLKNVS |
| Ga0181348_12341822 | 3300017784 | Freshwater Lake | YPHMEFRGKQRTLNDRTVIEAYNNATNQTFHYSFDEDFFWFSGQIPDWKLKKVS |
| Ga0181359_10429301 | 3300019784 | Freshwater Lake | QRTLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNVS |
| Ga0181359_11451123 | 3300019784 | Freshwater Lake | NDRTVMEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0211732_11838921 | 3300020141 | Freshwater | ILNNRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLTKTS |
| Ga0211736_104366181 | 3300020151 | Freshwater | NRTVIEAYNNATNQTFHYSFDEDFFWFPSQIPDYKLPKI |
| Ga0211733_107639831 | 3300020160 | Freshwater | KQRILNNRTVIEAYNNATNQTFHYSFDEDFFWFSGQIPDWKLPKT |
| Ga0208091_10362763 | 3300020506 | Freshwater | VMEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKI |
| Ga0181351_11213161 | 3300022407 | Freshwater Lake | EAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNVS |
| Ga0181351_11269721 | 3300022407 | Freshwater Lake | QRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS |
| Ga0181351_12308142 | 3300022407 | Freshwater Lake | TVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNVS |
| Ga0214921_101409494 | 3300023174 | Freshwater | PHMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNVS |
| Ga0244775_109489232 | 3300024346 | Estuarine | IEAYNHATNQNFFYSFDEDFFWFPGQIPDYKLPKVS |
| Ga0244775_110378372 | 3300024346 | Estuarine | EFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS |
| Ga0244775_111228962 | 3300024346 | Estuarine | QRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVA |
| Ga0256308_10185665 | 3300024549 | Freshwater | MEFRGKQRQMNDRTVIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0255242_10336133 | 3300024554 | Freshwater | MEFRGKQRQLNDRIVIEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0255237_11006292 | 3300024564 | Freshwater | RQMNDRTVIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0256304_10830252 | 3300024856 | Freshwater | MEFRGKQRQLNDRTVIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0208048_10218161 | 3300025283 | Freshwater | IINDRTVIEAYNHVTEQNFYYSFEEDFFWFAGQIPDYKLPKVS |
| Ga0255090_10083505 | 3300027123 | Freshwater | MEFRGKPRQLNDRTVMEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0255066_10149804 | 3300027131 | Freshwater | VIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0255080_10775621 | 3300027140 | Freshwater | YPHMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFVGQIPDWKLTKVS |
| Ga0255114_10617152 | 3300027145 | Freshwater | MEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS |
| Ga0255063_10826912 | 3300027151 | Freshwater | RTVIEAYNNATNQTFHYSFDEDFFWFVGQIPDWKLTKVS |
| Ga0255135_10212313 | 3300027287 | Freshwater | RQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS |
| Ga0255085_11267501 | 3300027538 | Freshwater | LNDRTVMEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0208960_10246441 | 3300027649 | Freshwater Lentic | DRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNTK |
| Ga0209553_11982771 | 3300027688 | Freshwater Lake | EFRGKQRTLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNTK |
| Ga0209443_12240832 | 3300027707 | Freshwater Lake | TIIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKKV |
| Ga0209596_10864372 | 3300027754 | Freshwater Lake | MEFRGKQRQLNDRTVIEAYNNATNQTFHYSFEEDFFWFSGQIPDWKLKKI |
| Ga0209296_12788292 | 3300027759 | Freshwater Lake | MEFRGKQRQLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNVS |
| Ga0209088_100370743 | 3300027763 | Freshwater Lake | MEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNTK |
| Ga0209088_101119711 | 3300027763 | Freshwater Lake | FRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS |
| Ga0209086_102838351 | 3300027770 | Freshwater Lake | VIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVA |
| Ga0209768_102064143 | 3300027772 | Freshwater Lake | KQRQLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKNVS |
| Ga0209246_100335056 | 3300027785 | Freshwater Lake | MEFRGKQRQLNDRTVIEAYNNATNQTFHYSFEEDFFWFAGQIPDWKLKKVS |
| Ga0209353_102177661 | 3300027798 | Freshwater Lake | QRTLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNVS |
| Ga0209400_11486731 | 3300027963 | Freshwater Lake | YPHMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNVS |
| Ga0209191_13409381 | 3300027969 | Freshwater Lake | GRQRQLNDRTIIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKV |
| Ga0209079_101418662 | 3300027972 | Freshwater Sediment | RTLNDRTVMEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKVS |
| Ga0209299_12080732 | 3300027974 | Freshwater Lake | LNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNTK |
| Ga0315907_106604731 | 3300031758 | Freshwater | VIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLSKSILT |
| Ga0315899_110931941 | 3300031784 | Freshwater | IEAYNPATEQHFFYSFDEDFFWFKDQIPDWKLQKIS |
| Ga0315900_110550562 | 3300031787 | Freshwater | QRQLNDRIVIEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKVS |
| Ga0315909_106382212 | 3300031857 | Freshwater | RGKQRQLNDRIVIEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKVS |
| Ga0315909_106611412 | 3300031857 | Freshwater | RTLNDRTVIEAYNHATNQNFFYSFEEDFFWFPSQIPDYKLPKVS |
| Ga0315274_112577573 | 3300031999 | Sediment | TIIEAYNNATNQTFHYSFDEDFFWFAGQIPDWELKKI |
| Ga0315274_113948623 | 3300031999 | Sediment | VIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKNVS |
| Ga0315906_103060451 | 3300032050 | Freshwater | GKQRQLHDRIVIEAHNPATEQHFFYSFDEDFFWFKDQIPDWKLQKIS |
| Ga0315906_105367361 | 3300032050 | Freshwater | RSIKNRTVIEAINQATNMNFYYSFDEDFFWFTNCEIPDWKMEKV |
| Ga0334980_0092701_1120_1257 | 3300033816 | Freshwater | QRQLHDRIVIEAYNPATEQHFFYSFDEDFFWFKDQIPDWKLQKIS |
| Ga0334996_0003794_5130_5285 | 3300033994 | Freshwater | MEFRGKQRQLHDRTIIEAYNPATEQHFFYSFDEDFFWFKDQIPDWKLQKIS |
| Ga0334996_0381370_485_646 | 3300033994 | Freshwater | MEFRGKHRQLNDRKGIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0335004_0350702_696_851 | 3300034021 | Freshwater | MEFRGKQRTLNDRTVMEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKVS |
| Ga0334995_0086947_2280_2408 | 3300034062 | Freshwater | MNDRTVMEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKVS |
| Ga0334995_0645012_3_140 | 3300034062 | Freshwater | KQRQMNDRTVMEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKI |
| Ga0335027_0543308_2_136 | 3300034101 | Freshwater | QRILNDRTVIEAYNHAINQNFFYSFDEDFFWFPGQIPDWKLKKI |
| Ga0335035_0404462_639_773 | 3300034105 | Freshwater | RILNDRTVIEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKVS |
| Ga0335055_0302489_21_149 | 3300034110 | Freshwater | LNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLTKVS |
| Ga0335068_0569650_369_512 | 3300034116 | Freshwater | QRQLNDRKVIEAYNPATNQTFFYSFDEDFFWFPGQIPDYKLPKSILT |
| Ga0335016_0270886_3_122 | 3300034166 | Freshwater | RTVMEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKVS |
| Ga0335065_0513226_592_714 | 3300034200 | Freshwater | DRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS |
| ⦗Top⦘ |