Metagenome Family F074530

Basic Information
Family ID	F074530
Family Type	Metagenome
Number of Sequences	119
Average Sequence Length	43 residues
Representative Sequence	MSASHHPTDIHLRQHRAKKRNKLRARIAAAPATGRAALEA
Number of Associated Samples	102
Number of Associated Scaffolds	119

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	99.16 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	97.48 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Most Common Taxonomy
Group	Bacteria (59.664 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.126 % of family members)
Environment Ontology (ENVO)	Unclassified (31.092 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (59.664 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF00753	Lactamase_B	3.36
PF09957	VapB_antitoxin	2.52
PF03551	PadR	2.52
PF00270	DEAD	2.52
PF13564	DoxX_2	1.68
PF01915	Glyco_hydro_3_C	1.68
PF01381	HTH_3	0.84
PF06439	3keto-disac_hyd	0.84
PF13883	Pyrid_oxidase_2	0.84
PF12681	Glyoxalase_2	0.84
PF13709	DUF4159	0.84
PF13242	Hydrolase_like	0.84
PF00069	Pkinase	0.84
PF01548	DEDD_Tnp_IS110	0.84
PF00857	Isochorismatase	0.84
PF07714	PK_Tyr_Ser-Thr	0.84
PF00171	Aldedh	0.84
PF01545	Cation_efflux	0.84
PF00326	Peptidase_S9	0.84
PF03466	LysR_substrate	0.84
PF01850	PIN	0.84
PF00271	Helicase_C	0.84
PF13360	PQQ_2	0.84
PF14255	Cys_rich_CPXG	0.84
PF13565	HTH_32	0.84
PF13620	CarboxypepD_reg	0.84
PF01636	APH	0.84
PF06983	3-dmu-9_3-mt	0.84
PF13602	ADH_zinc_N_2	0.84
PF00903	Glyoxalase	0.84
PF13276	HTH_21	0.84
PF08281	Sigma70_r4_2	0.84
PF04273	BLH_phosphatase	0.84
PF01564	Spermine_synth	0.84
PF01541	GIY-YIG	0.84

COG ID	Name	Functional Category	% Frequency in 119 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	6.72
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	2.52
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	2.52
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	2.52
COG1472	Periplasmic beta-glucosidase and related glycosidases	Carbohydrate transport and metabolism [G]	1.68
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.84
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.84
COG3965	Predicted Co/Zn/Cd cation transporter, cation efflux family	Inorganic ion transport and metabolism [P]	0.84
COG3865	Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase	General function prediction only [R]	0.84
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.84
COG3453	Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family	General function prediction only [R]	0.84
COG2764	Zn-dependent glyoxalase, PhnB family	Energy production and conversion [C]	0.84
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.84
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.84
COG1230	Co/Zn/Cd efflux system component	Inorganic ion transport and metabolism [P]	0.84
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.84
COG0053	Divalent metal cation (Fe/Co/Zn/Cd) efflux pump	Inorganic ion transport and metabolism [P]	0.84

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	59.66 %
Unclassified	root	N/A	40.34 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	59.66 %
Unclassified	root	N/A	40.34 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	59.66 %
Unclassified	root	N/A	40.34 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.34 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	21.85 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	5.88 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	2.52 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.68 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.84 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.34 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	10.08 %
Vicinamibacteria	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria	4.20 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.52 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2.52 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.68 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.68 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.84 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.84 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.34 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.40 %
Vicinamibacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales	4.20 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2.52 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.84 %
Acidimicrobiia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia	0.84 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.84 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.84 %
Thiotrichales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales	0.84 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.84 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.84 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.84 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.84 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.84 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.34 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.40 %
Vicinamibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae	4.20 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2.52 %
Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8	0.84 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.84 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.84 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.84 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.84 %
unclassified Acidimicrobiia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia	0.84 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.84 %
Piscirickettsiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae	0.84 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.84 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.84 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.34 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.40 %
Luteitalea	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea	4.20 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2.52 %
Pseudoroseicyclus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus	0.84 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.84 %
Acidimicrobiia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium	0.84 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.84 %
unclassified Piscirickettsiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → unclassified Piscirickettsiaceae	0.84 %
Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8	0.84 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.84 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.84 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.84 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.84 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.34 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.40 %
unclassified Luteitalea	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea	2.52 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2.52 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	1.68 %
Actinoplanes	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes	0.84 %
Piscirickettsiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → unclassified Piscirickettsiaceae → Piscirickettsiaceae bacterium	0.84 %
Pseudoroseicyclus tamaricis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	0.84 %
Acidimicrobiia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium	0.84 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.84 %
Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8	0.84 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.84 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.84 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.84 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.84 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.34 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.40 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2.52 %
Luteitalea sp. TBR-22	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22	1.68 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	1.68 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.84 %
Actinoplanes	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes	0.84 %
Piscirickettsiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → unclassified Piscirickettsiaceae → Piscirickettsiaceae bacterium	0.84 %
Pseudoroseicyclus tamaricis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	0.84 %
Acidimicrobiia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium	0.84 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.84 %
Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8	0.84 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.84 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.84 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.84 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.84 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.84 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459007\|GJ61VE201EGW9A	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	505	Open in IMG/M
2170459020\|G1P06HT01E2546	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	566	Open in IMG/M
3300000891\|JGI10214J12806_13718141	Not Available	522	Open in IMG/M
3300000953\|JGI11615J12901_10262451	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	579	Open in IMG/M
3300000956\|JGI10216J12902_105571411	All Organisms → cellular organisms → Bacteria	1509	Open in IMG/M
3300001305\|C688J14111_10271639	All Organisms → cellular organisms → Bacteria	534	Open in IMG/M
3300002155\|JGI24033J26618_1046581	Not Available	615	Open in IMG/M
3300005293\|Ga0065715_10768278	Not Available	623	Open in IMG/M
3300005294\|Ga0065705_10372345	Not Available	922	Open in IMG/M
3300005444\|Ga0070694_100475030	All Organisms → cellular organisms → Bacteria → Acidobacteria	991	Open in IMG/M
3300005444\|Ga0070694_101318168	Not Available	608	Open in IMG/M
3300005455\|Ga0070663_100594415	All Organisms → cellular organisms → Bacteria	930	Open in IMG/M
3300005456\|Ga0070678_101904338	Not Available	562	Open in IMG/M
3300005518\|Ga0070699_100816417	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	853	Open in IMG/M
3300005534\|Ga0070735_10657052	Not Available	620	Open in IMG/M
3300005549\|Ga0070704_101742012	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	576	Open in IMG/M
3300005566\|Ga0066693_10356473	Not Available	590	Open in IMG/M
3300005617\|Ga0068859_101887778	Not Available	660	Open in IMG/M
3300005840\|Ga0068870_10123372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → unclassified Piscirickettsiaceae → Piscirickettsiaceae bacterium	1495	Open in IMG/M
3300005844\|Ga0068862_100808670	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium	916	Open in IMG/M
3300006028\|Ga0070717_10759103	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	882	Open in IMG/M
3300006042\|Ga0075368_10133944	All Organisms → cellular organisms → Bacteria	1031	Open in IMG/M
3300006046\|Ga0066652_100666748	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	987	Open in IMG/M
3300006047\|Ga0075024_100353447	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	735	Open in IMG/M
3300006048\|Ga0075363_100412106	Not Available	795	Open in IMG/M
3300006844\|Ga0075428_102701983	Not Available	506	Open in IMG/M
3300006845\|Ga0075421_101015741	Not Available	938	Open in IMG/M
3300006852\|Ga0075433_10271591	All Organisms → cellular organisms → Bacteria	1502	Open in IMG/M
3300006852\|Ga0075433_11000797	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	728	Open in IMG/M
3300006871\|Ga0075434_100898810	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	900	Open in IMG/M
3300006880\|Ga0075429_101855329	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300006904\|Ga0075424_101075057	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	857	Open in IMG/M
3300006918\|Ga0079216_10248730	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1014	Open in IMG/M
3300006954\|Ga0079219_11392513	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300006969\|Ga0075419_10588834	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	780	Open in IMG/M
3300009094\|Ga0111539_12995910	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300009147\|Ga0114129_12009306	Not Available	699	Open in IMG/M
3300009156\|Ga0111538_14023895	Not Available	508	Open in IMG/M
3300009162\|Ga0075423_10413378	All Organisms → cellular organisms → Bacteria	1416	Open in IMG/M
3300009162\|Ga0075423_11005040	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	886	Open in IMG/M
3300009177\|Ga0105248_13188106	Not Available	522	Open in IMG/M
3300010403\|Ga0134123_12247578	All Organisms → cellular organisms → Bacteria	608	Open in IMG/M
3300011430\|Ga0137423_1132336	All Organisms → cellular organisms → Bacteria → Acidobacteria	748	Open in IMG/M
3300011437\|Ga0137429_1114991	All Organisms → cellular organisms → Bacteria → Acidobacteria	823	Open in IMG/M
3300012212\|Ga0150985_122985898	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300012228\|Ga0137459_1208290	Not Available	570	Open in IMG/M
3300012582\|Ga0137358_10548106	Not Available	778	Open in IMG/M
3300012898\|Ga0157293_10174592	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22	627	Open in IMG/M
3300012898\|Ga0157293_10281289	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300012899\|Ga0157299_10069769	All Organisms → cellular organisms → Bacteria → Proteobacteria	840	Open in IMG/M
3300012912\|Ga0157306_10101714	Not Available	834	Open in IMG/M
3300014325\|Ga0163163_12093486	Not Available	625	Open in IMG/M
3300014326\|Ga0157380_11325574	All Organisms → cellular organisms → Bacteria → Acidobacteria	768	Open in IMG/M
3300015371\|Ga0132258_10982084	All Organisms → cellular organisms → Bacteria	2134	Open in IMG/M
3300015371\|Ga0132258_11375031	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1784	Open in IMG/M
3300015372\|Ga0132256_100858960	Not Available	1024	Open in IMG/M
3300015372\|Ga0132256_101602240	Not Available	761	Open in IMG/M
3300015372\|Ga0132256_101706451	All Organisms → cellular organisms → Bacteria	739	Open in IMG/M
3300015372\|Ga0132256_102023526	Not Available	682	Open in IMG/M
3300015372\|Ga0132256_103545706	All Organisms → cellular organisms → Bacteria → Acidobacteria	525	Open in IMG/M
3300015373\|Ga0132257_101258464	All Organisms → cellular organisms → Bacteria	938	Open in IMG/M
3300015373\|Ga0132257_103250762	Not Available	592	Open in IMG/M
3300015374\|Ga0132255_102955728	Not Available	726	Open in IMG/M
3300015374\|Ga0132255_103830396	Not Available	639	Open in IMG/M
3300018073\|Ga0184624_10060097	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1560	Open in IMG/M
3300018422\|Ga0190265_11145083	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	897	Open in IMG/M
3300018429\|Ga0190272_11622920	Not Available	665	Open in IMG/M
3300018469\|Ga0190270_10591091	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	1079	Open in IMG/M
3300018469\|Ga0190270_12207715	Not Available	611	Open in IMG/M
3300018469\|Ga0190270_12389791	Not Available	590	Open in IMG/M
3300018476\|Ga0190274_12691845	All Organisms → cellular organisms → Bacteria	594	Open in IMG/M
3300018476\|Ga0190274_12797523	Not Available	584	Open in IMG/M
3300019361\|Ga0173482_10376596	Not Available	652	Open in IMG/M
3300019362\|Ga0173479_10846099	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22	511	Open in IMG/M
3300019377\|Ga0190264_11619227	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300021519\|Ga0194048_10301726	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300022886\|Ga0247746_1061914	All Organisms → cellular organisms → Bacteria	874	Open in IMG/M
3300023073\|Ga0247744_1019418	All Organisms → cellular organisms → Bacteria	973	Open in IMG/M
3300023261\|Ga0247796_1125893	Not Available	508	Open in IMG/M
3300025319\|Ga0209520_10516946	Not Available	698	Open in IMG/M
3300025899\|Ga0207642_11116695	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300025905\|Ga0207685_10486951	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300025917\|Ga0207660_10854062	Not Available	743	Open in IMG/M
3300025918\|Ga0207662_10629977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	748	Open in IMG/M
3300025920\|Ga0207649_10312905	All Organisms → cellular organisms → Bacteria → Proteobacteria	1151	Open in IMG/M
3300025926\|Ga0207659_10757933	All Organisms → cellular organisms → Bacteria	833	Open in IMG/M
3300025926\|Ga0207659_11847404	Not Available	513	Open in IMG/M
3300025927\|Ga0207687_11730923	All Organisms → cellular organisms → Bacteria → Acidobacteria	536	Open in IMG/M
3300025928\|Ga0207700_10819388	Not Available	833	Open in IMG/M
3300025930\|Ga0207701_10808750	Not Available	789	Open in IMG/M
3300025936\|Ga0207670_11751405	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300025942\|Ga0207689_11000607	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes	705	Open in IMG/M
3300025942\|Ga0207689_11167759	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	648	Open in IMG/M
3300026041\|Ga0207639_10652468	All Organisms → cellular organisms → Bacteria	974	Open in IMG/M
3300026088\|Ga0207641_11052107	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	812	Open in IMG/M
3300026089\|Ga0207648_11603166	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300027252\|Ga0209973_1040356	Not Available	683	Open in IMG/M
3300027866\|Ga0209813_10472428	Not Available	516	Open in IMG/M
3300027876\|Ga0209974_10257600	Not Available	658	Open in IMG/M
3300028065\|Ga0247685_1032572	All Organisms → cellular organisms → Bacteria	631	Open in IMG/M
3300028608\|Ga0247819_10834024	Not Available	573	Open in IMG/M
3300028803\|Ga0307281_10242593	Not Available	660	Open in IMG/M
3300030339\|Ga0311360_11223718	Not Available	590	Open in IMG/M
3300030620\|Ga0302046_10923586	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	697	Open in IMG/M
3300031226\|Ga0307497_10460933	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8	620	Open in IMG/M
3300031455\|Ga0307505_10022212	All Organisms → cellular organisms → Bacteria	2924	Open in IMG/M
3300031854\|Ga0310904_10462414	All Organisms → cellular organisms → Bacteria	844	Open in IMG/M
3300031858\|Ga0310892_10275686	All Organisms → cellular organisms → Bacteria	1049	Open in IMG/M
3300031908\|Ga0310900_10011003	All Organisms → cellular organisms → Bacteria → Acidobacteria	4453	Open in IMG/M
3300031908\|Ga0310900_11564076	Not Available	557	Open in IMG/M
3300031940\|Ga0310901_10339021	Not Available	641	Open in IMG/M
3300031943\|Ga0310885_10832983	Not Available	525	Open in IMG/M
3300032003\|Ga0310897_10726560	Not Available	500	Open in IMG/M
3300032017\|Ga0310899_10300474	All Organisms → cellular organisms → Bacteria → Acidobacteria	745	Open in IMG/M
3300032180\|Ga0307471_101637797	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	799	Open in IMG/M
3300032205\|Ga0307472_101140999	Not Available	740	Open in IMG/M
3300033550\|Ga0247829_10608730	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	908	Open in IMG/M
3300034690\|Ga0364923_0117019	Not Available	679	Open in IMG/M
3300034819\|Ga0373958_0112080	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	56.30%
Host-Associated	Host-Associated	42.86%
Engineered	Engineered	0.84%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	51.26%
Plants	Host-Associated → Plants	42.86%
Aquatic	Environmental → Aquatic	5.04%
Solid Waste	Engineered → Solid Waste	0.84%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	49.58%
Rhizosphere	Host-Associated → Plants → Rhizosphere	21.85%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.65%
Sediment	Environmental → Aquatic → Sediment	4.20%
Roots	Host-Associated → Plants → Roots	3.36%
Freshwater	Environmental → Aquatic → Freshwater	0.84%
Peat	Environmental → Terrestrial → Peat	0.84%
Floodplain	Environmental → Terrestrial → Floodplain	0.84%
Grass	Engineered → Solid Waste → Grass	0.84%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	40.34%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.45%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.08%
Loam	Environmental → Terrestrial → Soil → Loam	9.24%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.40%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	6.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.20%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	2.52%
Lake	Environmental → Aquatic → Freshwater → Lake	0.84%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.84%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.84%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.84%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.84%
Composting	Engineered → Solid Waste → Grass → Composting	0.84%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.08%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	8.40%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.40%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.40%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	6.72%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.20%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.20%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.52%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	2.52%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.84%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.84%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.84%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.84%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.84%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.84%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.84%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	15.13%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	10.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	8.40%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.88%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	5.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.20%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	4.20%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.52%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.52%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.52%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	2.52%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.68%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.68%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.68%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.68%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.68%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.84%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.84%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.84%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.84%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.84%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.84%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.84%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.84%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.84%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.84%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.84%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.84%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.84%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.84%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.84%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.84%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.84%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.84%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.84%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.84%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459007	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm	Environmental	Open in IMG/M
2170459020	Litter degradation NP2	Engineered	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Host-Associated	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006042	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006048	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental	Open in IMG/M
3300011437	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012228	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300022886	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5	Environmental	Open in IMG/M
3300023073	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5	Environmental	Open in IMG/M
3300023261	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6	Environmental	Open in IMG/M
3300025319	Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027866	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)	Host-Associated	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300028065	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26	Environmental	Open in IMG/M
3300028608	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300030339	III_Bog_N1 coassembly	Environmental	Open in IMG/M
3300030620	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031455	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031940	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300034690	Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17	Environmental	Open in IMG/M
3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F074530

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
L02_00771110	2170459007	Grass Soil	MSASHHPTDTHLRQQRKKKRNKLRARIAAAPAAGRAVLEAKVQRTYSL
2NP_02902390	2170459020	Switchgrass, Maize And Mischanthus Litter	MSASHHPTDIHLRQQRKKKRNKLRARIAAAPAAGRAVLEAKVQRT
JGI10214J12806_137181411	3300000891	Soil	MSASHRRTDIHRRQHRVAKRKKLRARIAAAPATGAAFEAKLRRTYS
JGI11615J12901_102624511	3300000953	Soil	MSASHHPTDIHLRQHRAKKRNKLRARIAAAPAAGRAALEA
JGI10216J12902_1055714111	3300000956	Soil	MSASHHPTDIHRRQQRKNKRNRLRARIAAAPAFGFAALEAKLQRTY
C688J14111_102716392	3300001305	Soil	MSASHKATDTHLRQHRLKKRAKLRARIAAAPASGRPALEAKVQRTYS
JGI24033J26618_10465812	3300002155	Corn, Switchgrass And Miscanthus Rhizosphere	MSASHRRTDIHRRQYRKAKRDKLRARIAAASVSATGRAAFEAKLQ
Ga0065715_107682781	3300005293	Miscanthus Rhizosphere	MSASHTPTDLHLRQHRAKKRNKLRARIAASPMVGRAALEAKVL
Ga0065705_103723451	3300005294	Switchgrass Rhizosphere	MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGRAALEAKVLRTYS
Ga0070694_1004750302	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGRAALEAK
Ga0070694_1013181683	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MSASHHPTDTHLRQHRLKKRNKLRARIAAAPATGRAALEAKVQR
Ga0070663_1005944152	3300005455	Corn Rhizosphere	MSASHHPTDVHLRQHRLKKRNKLRARIAAAPAHGRAALEAKVLKTFSPF
Ga0070678_1019043381	3300005456	Miscanthus Rhizosphere	MSASHHPTDVHLRQHRTKKRDKLRARIAASPMVGRAALEAKVQRTY
Ga0070699_1008164172	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MSASHHPTDIHLRQHRAKKRNKLRARIAAASATGRAVLEAKLQR
Ga0070735_106570521	3300005534	Surface Soil	MSASHHPADIHRRQQRKKKRNKLRARIAAAPAVGRAALEAKVQR
Ga0070704_1017420121	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MSASHHPTDMHLRQHRLKKRNKLRARIAAAPAAGRAALEAKVQR
Ga0066693_103564731	3300005566	Soil	MSASHHPTDIHRRQQRKKKRNKLRARIAAAPAVGRAALEAKVQRT
Ga0068859_1018877784	3300005617	Switchgrass Rhizosphere	MSASHHPTDIHLRQHRTKKRNKLRARIAAAPASGRAALEAKLQRTYSPFH
Ga0068870_101233724	3300005840	Miscanthus Rhizosphere	MIMSASHHPTDIHLRQHRSKKRDKLRARIAAAPATG
Ga0068862_1008086701	3300005844	Switchgrass Rhizosphere	MSASHHPTDTHLRQHRAKKRAKLRARIAAAPATGRAA
Ga0070717_107591033	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MSASHHPTDIHRRQHRRKKRNKLRARIAAAPAVGRAALE
Ga0075368_101339441	3300006042	Populus Endosphere	MSASHRPTDIHLRQHRAKKRNKLLARIAAAPASGRAALEARVQRTYSP
Ga0066652_1006667481	3300006046	Soil	MSASHHPTDTHLRQHRAKKRAKLRARLAAAPPAGRAALE
Ga0075024_1003534471	3300006047	Watersheds	MSASHHPTDVHLRQHRAKKRDNLRARIAAAPTTGRAALEAKVQRTY
Ga0075363_1004121061	3300006048	Populus Endosphere	MSASHRPTDIHLRQHRAKKRGKLRARIAAAPAAGRTALEARVRRTYSPFH
Ga0075428_1027019831	3300006844	Populus Rhizosphere	MSASHRRTDIHRRQQRTKKRNKLRARIAAAPATGLDALEAKVQRTYSP
Ga0075421_1010157413	3300006845	Populus Rhizosphere	MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGRAALEAKVQR
Ga0075433_102715913	3300006852	Populus Rhizosphere	MSASHHPTDIHLRQHRTKKRDKLRARIAAAPATGRAALEAKVQR
Ga0075433_110007972	3300006852	Populus Rhizosphere	MSASHHPTDIHLRRQRKKKRNKLRARIAAAPAAGRAV
Ga0075434_1008988102	3300006871	Populus Rhizosphere	MSASHHPTDIHLRQHRAKKRNKLRARIAAASATGRAVLEAKLQRTYS
Ga0075429_1018553292	3300006880	Populus Rhizosphere	MSASHRPTDIHLRQHRAKKRNKLRARIAAAPATGRAA
Ga0075424_1010750571	3300006904	Populus Rhizosphere	MSASHHPTDIHLRQHRAKKRNKLRARIAAASATGRAVLEA
Ga0079216_102487303	3300006918	Agricultural Soil	MSASHRPTDIHLRQHRAKKRGKLRARIAAAPETGRAALEAKVQR
Ga0079219_113925132	3300006954	Agricultural Soil	MSASHHPTDIHLRQHRAKKRNKLRARIAAAPATGRAALE
Ga0075419_105888343	3300006969	Populus Rhizosphere	MSASRRPTDTHLRQHRAKKRNKLRARIAAAPATGRAA
Ga0111539_129959102	3300009094	Populus Rhizosphere	MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGR
Ga0114129_120093063	3300009147	Populus Rhizosphere	MSASHRPTDIHRRQHRVAKRNKLRARIAAEPTKRAALEAKLQRTYS
Ga0111538_140238952	3300009156	Populus Rhizosphere	MSASHHPTDIHLRQHRAKKRNKLRARIAAAPPTGRAALEA
Ga0075423_104133782	3300009162	Populus Rhizosphere	MSASHHPTDIHLRRHRAKKRNKLRARIAAAPATGRAALEA
Ga0075423_110050402	3300009162	Populus Rhizosphere	MSASHHPTDVHLRQHRAKKRNKLRARIAAAPTTGRAALEAKV
Ga0105248_131881061	3300009177	Switchgrass Rhizosphere	MSASHHPTDIHLRQHRLKKRNKLRARIAAAPASGRA
Ga0134123_122475782	3300010403	Terrestrial Soil	MSASHHPTDIHLRRHRAKKRNKLRARIAAAPATGRAALEAK
Ga0137423_11323363	3300011430	Soil	MIMSASHKPTDTHLRQHRVKKRNKLRARIAAAPATGRAALEAKV
Ga0137429_11149913	3300011437	Soil	MIMSASHKPTDTHLRQHRVKKRNKLRARIAAAPATGRAALEAKL
Ga0150985_1229858983	3300012212	Avena Fatua Rhizosphere	MSASHRRTDIHRRQQRIKKRKKLQARIAAAPPTGRAALEARVLKTYSVF
Ga0137459_12082902	3300012228	Soil	MSASHRPTDIHLRQHRAKKRDKLRGRIAAAPASGRAALEA
Ga0137358_105481062	3300012582	Vadose Zone Soil	MIMSASHKPTDTHLRQHRAKKRNKLRARIAAAPATGRAALEAKVQRTYSPS
Ga0157293_101745922	3300012898	Soil	MSASHRPTDIHLRQHRLKKRNKLRGRIAAAPANGRAALE
Ga0157293_102812891	3300012898	Soil	MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATGRAVLEAKVLRT
Ga0157299_100697691	3300012899	Soil	MSESHHPTDIHLRQNRAKKRDKLRARIAAAPATGRAV
Ga0157306_101017142	3300012912	Soil	MIMSASHHPTDIHLRQHRLKKREKLRARIAAAPATGRAALEA
Ga0163163_120934861	3300014325	Switchgrass Rhizosphere	MSASHRPTDIHLRQHREKKRNKLRARIAAAPAAGRAALEARVLRT
Ga0157380_113255741	3300014326	Switchgrass Rhizosphere	MIMSASHKPTDTHLRQHRVKKRNKLRARIAAAPATGRAAL
Ga0132258_109820841	3300015371	Arabidopsis Rhizosphere	MSQSHRPTDIHLRQHRLKKRNKLRARIAAAPATGRAALEARVLRTYS
Ga0132258_113750311	3300015371	Arabidopsis Rhizosphere	MIMSASHHPTDIHLRQHRAKKRNKLRARIAAAPAT
Ga0132256_1008589602	3300015372	Arabidopsis Rhizosphere	MSASHRPTDIHLRQHRTKKRNKLRARIAAAPATGRAALEA
Ga0132256_1016022401	3300015372	Arabidopsis Rhizosphere	MSASHHPTDIHLRQHRAKKRNKLRARIAAAPATGR
Ga0132256_1017064512	3300015372	Arabidopsis Rhizosphere	MSASHHPTDVHLRQHRAKKRAKLRARIAAGPASGRAALEARVLR
Ga0132256_1020235262	3300015372	Arabidopsis Rhizosphere	MIMSASHHPTDIHLRQHRAKKRDKLRARIAAAPATARAALEAKVQRTYS
Ga0132256_1035457062	3300015372	Arabidopsis Rhizosphere	MSASHHPTDIHLRQHRAKKRHKLRARIAAAPTTGRAAL
Ga0132257_1012584642	3300015373	Arabidopsis Rhizosphere	MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATGRAALEAKLLRTYS
Ga0132257_1032507621	3300015373	Arabidopsis Rhizosphere	MSASHRRTDIHRRQHRLAKRNKLRARIAAAPATGRAASEAKLQRTYSP
Ga0132255_1029557281	3300015374	Arabidopsis Rhizosphere	MSASHHPTDTHLRQHPARKRNKLRARIAAAPAAGRAAL
Ga0132255_1038303961	3300015374	Arabidopsis Rhizosphere	MSASHHPTDIHLRRHRAKKRNKLRARIAAAPATGRAALEAKVQRTYS
Ga0184624_100600974	3300018073	Groundwater Sediment	MSASHRPTDIHLRQYRVKKRNKLRARIAAAPATERAALE
Ga0190265_111450832	3300018422	Soil	MSASHRPTDIHLRQHRTKKRDKLRARIAAAPATGRAALEA
Ga0190272_116229201	3300018429	Soil	MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATGRAAL
Ga0190270_105910911	3300018469	Soil	SHHPTDIHLRQHRAKKRNKLRARIAAAPAAGRAALEAKVQRTY
Ga0190270_122077151	3300018469	Soil	MSASHRPTDIHRRQHRVKKRNKLRARIAAAPVGRAALEAKVQRTY
Ga0190270_123897911	3300018469	Soil	MSASHHPTDIHLRQHRTKKRNKLRARIAAAPATGRAALEAR
Ga0190274_126918451	3300018476	Soil	MSASHHPTDIHLRQHRAKKRSKLLARIAAAPASGRAALEA
Ga0190274_127975231	3300018476	Soil	MSASHRPTDIHRRQHRVKKRNKLRARIAAAPATGRTAFEAKLQRTYS
Ga0173482_103765962	3300019361	Soil	MSASHRPTDIHLRQHRTKKRNKLRARIAAAPATGRAALEARVLR
Ga0173479_108460991	3300019362	Soil	MSASHRPTDIHLRQHRLKKRNKLRGRIAAAPANGRAALEARVL
Ga0190264_116192272	3300019377	Soil	MSASHHPNDIHLRQHRAKKRDKLRARIAAAPATGRAALE
Ga0194048_103017262	3300021519	Anoxic Zone Freshwater	MSASRIHNYLHLSRHRAKKRAKLKARIAAAPIAERAALEARVLR
Ga0247746_10619141	3300022886	Soil	MSASHHPTDIHLRQHRAKKRDKLLARIAAAPATGRAVLEAKVLRTYSPF
Ga0247744_10194181	3300023073	Soil	MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATGRAVLEAKVLRTYSPF
Ga0247796_11258932	3300023261	Soil	MSASHHPTDIHLRQHRLKKREKLRARIAAAPATGRAALEAKVQRTY
Ga0209520_105169461	3300025319	Soil	MSASHHPTDTHLRQHRAKKRDKLRARIAAAPATARAALEAKL
Ga0207642_111166952	3300025899	Miscanthus Rhizosphere	MSASHRPTDIHRRQHRVKKRNKLRARIAAAPATGRTTFEAKLLRTYSR
Ga0207685_104869511	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MSASHHPTDIHLRQHRAKKRNKLRARIAAASATGRAALEAKVQRTYSP
Ga0207660_108540621	3300025917	Corn Rhizosphere	MSASHHPTDIHLRQHRAKKRNKLRARIAAAPASGRAALEAKLQRT
Ga0207662_106299771	3300025918	Switchgrass Rhizosphere	MSASHRRTDIHLRQHREKKRNKLRARIAAAPATGRAALEVKV
Ga0207649_103129051	3300025920	Corn Rhizosphere	MSASHRRTDIHLRQHREKKRNKLRARIAAAPATGRA
Ga0207659_107579331	3300025926	Miscanthus Rhizosphere	MSASHHPTDIHLRQHRAKKRNKLRARIAAAPPTGR
Ga0207659_118474042	3300025926	Miscanthus Rhizosphere	MSASHHPTDIHLRQHRANKRAKLLARIAAAPAAGRAALEARVQRTYS
Ga0207687_117309232	3300025927	Miscanthus Rhizosphere	MSASHHPTDIHLRQHRAKKRNKLRARIAAAPAVAVAALEARV
Ga0207700_108193881	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MSASHHPTDIHLRQKRKKKRDNLRARIAAAPAAGRAALEAKVQ
Ga0207701_108087501	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MSASHRPTDIHLRQHRAKKRDKLRARIAAAPATGRAALEAKLQRTYSPF
Ga0207670_117514052	3300025936	Switchgrass Rhizosphere	MSASHRPTDIHRRQHRVKKRNKLRARIAAAPATGRTTFEAKL
Ga0207689_110006071	3300025942	Miscanthus Rhizosphere	MSASHHPTDIHLRQHRAKKRNKLRARIAAAPASGRAALEAKVQ
Ga0207689_111677591	3300025942	Miscanthus Rhizosphere	MSASHHPTDIHLRQHRAKKRDKLRALIAAAPTTGRAALEA
Ga0207639_106524681	3300026041	Corn Rhizosphere	MSASHHPTDVHLRQHRAKKRAKLRARIAAGPASVRAALEARVLRTYSPFH
Ga0207641_110521071	3300026088	Switchgrass Rhizosphere	MSASHHPTDIHLRQHRLEKRNKLRARLAAAPATGRAALEARLQRTYSPF
Ga0207648_116031661	3300026089	Miscanthus Rhizosphere	MSASHHPTDMHLRQHRLKKRNKLRARIAAAPAAGRAALEARVL
Ga0209973_10403562	3300027252	Arabidopsis Thaliana Rhizosphere	MSASHHPTDIHLRQHRAKKRKKLRARIAAAPATGRASLEAKLQR
Ga0209813_104724282	3300027866	Populus Endosphere	MSASHRPTDIHLRQHRTKKREKLRARIAAAPATGRAALEARVR
Ga0209974_102576001	3300027876	Arabidopsis Thaliana Rhizosphere	MSASHRPTDIHLRQHRLKKRNKLRARIAAASAAGRPA
Ga0247685_10325723	3300028065	Soil	MSASHHPTDVHLRQHRTKKRDKLRARIAASPMVGRA
Ga0247819_108340241	3300028608	Soil	MSASHRRTDIHRRQYRKAKRDKLRARIATASVSATGRAAFEAKLQRTYSP
Ga0307281_102425931	3300028803	Soil	MSASHRPTDIHLRQHRAKKRDKLLARIAAAPATGRAALEARVQ
Ga0311360_112237181	3300030339	Bog	MSASHTPTDLHLRQHRIKKRNKLRARIAAAPASGRAALEAKVLRT
Ga0302046_109235861	3300030620	Soil	MSASHRRTDIHLRQHRTKKRDKLRARIAAAPAIERAPLEAKVQRTYSA
Ga0307497_104609332	3300031226	Soil	MSASHHPTDQHLRQHRAEKRAKLRARIAAAPTTGR
Ga0307505_100222125	3300031455	Soil	MSASHRPTDIHLRQHRVKKRKKLLARIAAGPATARAALEARVLRTF
Ga0310904_104624142	3300031854	Soil	MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGRA
Ga0310892_102756861	3300031858	Soil	MSASHHPTDIHLRQHRAKKRNKLRARIAAAPATGRAALEA
Ga0310900_100110031	3300031908	Soil	MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATERAALEARVQRTYSP
Ga0310900_115640763	3300031908	Soil	MSASHHPTDVHLRQHRTKKRDKLRARIAASPMVGRAAL
Ga0310901_103390212	3300031940	Soil	MSASHRPTDIHRRQHRLKKRNKLRARIAAAPATGRAAFEAKLK
Ga0310885_108329831	3300031943	Soil	VSASHHPTDIHLRQHRAKKRNKLRARIAAAPATGRAALEAKLQRTYSPSH
Ga0310897_107265601	3300032003	Soil	LSASHHPTDIHLRQHRLKKRNKLRARIAAAPVTGRAALEAKV
Ga0310899_103004741	3300032017	Soil	MSQSQHPTVVHLRRHRAKKRNKLRARIAAAPASTGRAALEA
Ga0307471_1016377972	3300032180	Hardwood Forest Soil	MSASHHPTDIHLRQHRVKKRNKLRARIAAAPASGR
Ga0307472_1011409991	3300032205	Hardwood Forest Soil	MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATGRAALEARMQRTYSPF
Ga0247829_106087302	3300033550	Soil	MSASHRPTDIHLRQHRAKKRNKLRARIAAAPATGRAALEAKVQRTYSPFH
Ga0364923_0117019_537_677	3300034690	Sediment	MSASHKPTDTHLRQHRVKKRNKLRARIAAAPATGRAALEAKVQRTYS
Ga0373958_0112080_3_116	3300034819	Rhizosphere Soil	MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGRAAL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign