| Basic Information | |
|---|---|
| Family ID | F074522 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MLPEKPEPVLLAKILNQVAGLGRIHASQPSFSFS |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.04 % |
| % of genes near scaffold ends (potentially truncated) | 95.80 % |
| % of genes from short scaffolds (< 2000 bps) | 84.03 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.908 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.210 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.378 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.03% β-sheet: 0.00% Coil/Unstructured: 70.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF13546 | DDE_5 | 5.04 |
| PF13358 | DDE_3 | 2.52 |
| PF04255 | DUF433 | 1.68 |
| PF00496 | SBP_bac_5 | 1.68 |
| PF14104 | DUF4277 | 1.68 |
| PF01609 | DDE_Tnp_1 | 1.68 |
| PF01075 | Glyco_transf_9 | 1.68 |
| PF00239 | Resolvase | 0.84 |
| PF13473 | Cupredoxin_1 | 0.84 |
| PF13613 | HTH_Tnp_4 | 0.84 |
| PF04304 | DUF454 | 0.84 |
| PF00296 | Bac_luciferase | 0.84 |
| PF04909 | Amidohydro_2 | 0.84 |
| PF13673 | Acetyltransf_10 | 0.84 |
| PF13700 | DUF4158 | 0.84 |
| PF01610 | DDE_Tnp_ISL3 | 0.84 |
| PF13683 | rve_3 | 0.84 |
| PF03972 | MmgE_PrpD | 0.84 |
| PF02810 | SEC-C | 0.84 |
| PF01568 | Molydop_binding | 0.84 |
| PF03400 | DDE_Tnp_IS1 | 0.84 |
| PF10042 | DUF2278 | 0.84 |
| PF14224 | DUF4331 | 0.84 |
| PF02653 | BPD_transp_2 | 0.84 |
| PF13495 | Phage_int_SAM_4 | 0.84 |
| PF07978 | NIPSNAP | 0.84 |
| PF02585 | PIG-L | 0.84 |
| PF00106 | adh_short | 0.84 |
| PF11255 | DUF3054 | 0.84 |
| PF01555 | N6_N4_Mtase | 0.84 |
| PF13359 | DDE_Tnp_4 | 0.84 |
| PF03050 | DDE_Tnp_IS66 | 0.84 |
| PF14319 | Zn_Tnp_IS91 | 0.84 |
| PF16277 | DUF4926 | 0.84 |
| PF03023 | MurJ | 0.84 |
| PF02371 | Transposase_20 | 0.84 |
| PF04191 | PEMT | 0.84 |
| PF08388 | GIIM | 0.84 |
| PF12728 | HTH_17 | 0.84 |
| PF02630 | SCO1-SenC | 0.84 |
| PF01850 | PIN | 0.84 |
| PF09827 | CRISPR_Cas2 | 0.84 |
| PF00067 | p450 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.68 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.68 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.68 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.68 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.68 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.68 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.68 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.84 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG2832 | Uncharacterized membrane protein YbaN, DUF454 family | Function unknown [S] | 0.84 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.84 |
| COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 0.84 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.84 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.84 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.84 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.84 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.84 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.84 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.84 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.84 |
| COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.91 % |
| Unclassified | root | N/A | 31.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_102419036 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300005552|Ga0066701_10322710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 957 | Open in IMG/M |
| 3300005558|Ga0066698_10560992 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005577|Ga0068857_100885560 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005764|Ga0066903_100235541 | All Organisms → cellular organisms → Bacteria | 2799 | Open in IMG/M |
| 3300005764|Ga0066903_100497143 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300005764|Ga0066903_101375082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1324 | Open in IMG/M |
| 3300005764|Ga0066903_106692681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena → unclassified Anabaena → Anabaena sp. 90 | 599 | Open in IMG/M |
| 3300005764|Ga0066903_107073597 | Not Available | 581 | Open in IMG/M |
| 3300005764|Ga0066903_107603869 | Not Available | 558 | Open in IMG/M |
| 3300005981|Ga0081538_10253033 | Not Available | 670 | Open in IMG/M |
| 3300006846|Ga0075430_100296464 | Not Available | 1337 | Open in IMG/M |
| 3300006846|Ga0075430_100755392 | Not Available | 801 | Open in IMG/M |
| 3300006847|Ga0075431_100135231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2541 | Open in IMG/M |
| 3300006880|Ga0075429_101216197 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006904|Ga0075424_102801521 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006969|Ga0075419_10189647 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300009038|Ga0099829_10565247 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300009038|Ga0099829_10914667 | Not Available | 728 | Open in IMG/M |
| 3300009089|Ga0099828_10110643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2388 | Open in IMG/M |
| 3300009089|Ga0099828_10242219 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300009090|Ga0099827_10010188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6024 | Open in IMG/M |
| 3300009090|Ga0099827_10081955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2521 | Open in IMG/M |
| 3300009090|Ga0099827_10165962 | Not Available | 1817 | Open in IMG/M |
| 3300009100|Ga0075418_10234991 | Not Available | 1951 | Open in IMG/M |
| 3300009100|Ga0075418_12215279 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009137|Ga0066709_100287284 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300009137|Ga0066709_102883455 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300009147|Ga0114129_10102534 | All Organisms → cellular organisms → Bacteria | 3957 | Open in IMG/M |
| 3300009147|Ga0114129_10286054 | Not Available | 2201 | Open in IMG/M |
| 3300009147|Ga0114129_11645539 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009553|Ga0105249_10083161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2979 | Open in IMG/M |
| 3300010042|Ga0126314_10483445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 898 | Open in IMG/M |
| 3300010043|Ga0126380_10047372 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 2298 | Open in IMG/M |
| 3300010043|Ga0126380_11115615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 673 | Open in IMG/M |
| 3300010046|Ga0126384_11088053 | Not Available | 732 | Open in IMG/M |
| 3300010047|Ga0126382_10921798 | Not Available | 758 | Open in IMG/M |
| 3300010047|Ga0126382_11819805 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010047|Ga0126382_12356024 | Not Available | 516 | Open in IMG/M |
| 3300010047|Ga0126382_12402922 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010361|Ga0126378_10325998 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300010361|Ga0126378_12404403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 602 | Open in IMG/M |
| 3300010362|Ga0126377_12727180 | Not Available | 569 | Open in IMG/M |
| 3300010362|Ga0126377_12822220 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300010366|Ga0126379_13259608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 543 | Open in IMG/M |
| 3300010373|Ga0134128_13147894 | Not Available | 507 | Open in IMG/M |
| 3300010398|Ga0126383_11171797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 858 | Open in IMG/M |
| 3300010398|Ga0126383_11675696 | Not Available | 725 | Open in IMG/M |
| 3300011271|Ga0137393_10423382 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 1141 | Open in IMG/M |
| 3300012189|Ga0137388_10880269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Chlorogloeopsidaceae → Chlorogloeopsis → Chlorogloeopsis fritschii | 829 | Open in IMG/M |
| 3300012199|Ga0137383_10798625 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 689 | Open in IMG/M |
| 3300012199|Ga0137383_11103642 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 574 | Open in IMG/M |
| 3300012201|Ga0137365_11205350 | Not Available | 541 | Open in IMG/M |
| 3300012203|Ga0137399_11225664 | Not Available | 632 | Open in IMG/M |
| 3300012206|Ga0137380_10743555 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300012207|Ga0137381_11772156 | Not Available | 507 | Open in IMG/M |
| 3300012209|Ga0137379_10398173 | Not Available | 1286 | Open in IMG/M |
| 3300012210|Ga0137378_11825816 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012211|Ga0137377_11875605 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012349|Ga0137387_11014130 | Not Available | 595 | Open in IMG/M |
| 3300012355|Ga0137369_10491389 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300012362|Ga0137361_10323155 | Not Available | 1414 | Open in IMG/M |
| 3300012362|Ga0137361_11671172 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012918|Ga0137396_10718196 | Not Available | 737 | Open in IMG/M |
| 3300012918|Ga0137396_11180288 | Not Available | 541 | Open in IMG/M |
| 3300012929|Ga0137404_11178104 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012930|Ga0137407_11170822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 729 | Open in IMG/M |
| 3300012938|Ga0162651_100052564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 644 | Open in IMG/M |
| 3300012948|Ga0126375_11632210 | Not Available | 556 | Open in IMG/M |
| 3300012971|Ga0126369_10043652 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter | 3782 | Open in IMG/M |
| 3300012971|Ga0126369_10108307 | Not Available | 2532 | Open in IMG/M |
| 3300012971|Ga0126369_10770630 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 1043 | Open in IMG/M |
| 3300014968|Ga0157379_10260743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1575 | Open in IMG/M |
| 3300016319|Ga0182033_10115369 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300016357|Ga0182032_11178583 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300016445|Ga0182038_10094022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2157 | Open in IMG/M |
| 3300018063|Ga0184637_10555434 | Not Available | 659 | Open in IMG/M |
| 3300018078|Ga0184612_10478037 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300018079|Ga0184627_10031563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2674 | Open in IMG/M |
| 3300018082|Ga0184639_10222028 | Not Available | 1001 | Open in IMG/M |
| 3300018481|Ga0190271_12591442 | Not Available | 608 | Open in IMG/M |
| 3300019249|Ga0184648_1258344 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300020170|Ga0179594_10073092 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300021073|Ga0210378_10347376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 554 | Open in IMG/M |
| 3300025922|Ga0207646_11265036 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300026023|Ga0207677_11084647 | Not Available | 729 | Open in IMG/M |
| 3300026301|Ga0209238_1048054 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300026317|Ga0209154_1093848 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300026326|Ga0209801_1090224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
| 3300026333|Ga0209158_1153065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 842 | Open in IMG/M |
| 3300026540|Ga0209376_1085730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1659 | Open in IMG/M |
| 3300027013|Ga0209884_1014151 | Not Available | 776 | Open in IMG/M |
| 3300027655|Ga0209388_1096851 | Not Available | 847 | Open in IMG/M |
| 3300027671|Ga0209588_1238130 | Not Available | 559 | Open in IMG/M |
| 3300027846|Ga0209180_10373273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300027880|Ga0209481_10029037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus wardiae | 2492 | Open in IMG/M |
| 3300027880|Ga0209481_10136492 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300027880|Ga0209481_10632799 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027907|Ga0207428_10047966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3429 | Open in IMG/M |
| 3300027907|Ga0207428_10128074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. JS1663 | 1944 | Open in IMG/M |
| 3300027909|Ga0209382_10378128 | Not Available | 1581 | Open in IMG/M |
| 3300027948|Ga0209858_1012886 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300028587|Ga0247828_11115434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_2_20CM_53_11 | 523 | Open in IMG/M |
| 3300030499|Ga0268259_10014895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1390 | Open in IMG/M |
| 3300031096|Ga0308193_1089809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 515 | Open in IMG/M |
| 3300031114|Ga0308187_10467901 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031546|Ga0318538_10085321 | Not Available | 1609 | Open in IMG/M |
| 3300031573|Ga0310915_10608411 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 774 | Open in IMG/M |
| 3300031576|Ga0247727_10573020 | Not Available | 856 | Open in IMG/M |
| 3300031736|Ga0318501_10591649 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 609 | Open in IMG/M |
| 3300031747|Ga0318502_10465982 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300031796|Ga0318576_10611305 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 513 | Open in IMG/M |
| 3300031852|Ga0307410_11768641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300031893|Ga0318536_10424526 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300031947|Ga0310909_10027044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4210 | Open in IMG/M |
| 3300032060|Ga0318505_10328701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300032261|Ga0306920_102778215 | Not Available | 667 | Open in IMG/M |
| 3300033181|Ga0272431_10106870 | Not Available | 1908 | Open in IMG/M |
| 3300033551|Ga0247830_10288210 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.13% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.04% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.84% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.84% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.84% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027948 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033181 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sud | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1024190363 | 3300000559 | Soil | AEPINMLPEKPEPVLFATMLTQVASLGRIHAVQPCFSFS* |
| Ga0066701_103227103 | 3300005552 | Soil | MLPEKPEPILLRQMLNKVAGLGRIHASQPSFSFS* |
| Ga0066698_105609921 | 3300005558 | Soil | MLPEKPEPILLAKILNQVAGLGRIHAIEPSFSFS* |
| Ga0068857_1008855602 | 3300005577 | Corn Rhizosphere | MLPEKPEPILLAKIRNQVAGLGRIHAAQASFSFA* |
| Ga0066903_1002355411 | 3300005764 | Tropical Forest Soil | MLPEKPEPILLRQILHKVAGLGRIHASQPSSSFS* |
| Ga0066903_1004971431 | 3300005764 | Tropical Forest Soil | MLPEKPEPVLLAKILNRVAGLGRIHATPPSFSFS* |
| Ga0066903_1013750822 | 3300005764 | Tropical Forest Soil | MLPEKPEPILLAKIRNQVASLGRIHAAQPAFSFS* |
| Ga0066903_1066926811 | 3300005764 | Tropical Forest Soil | MLPEKPEPVLLEQIRTKVACLGRIHGSQPSFSFS* |
| Ga0066903_1070735972 | 3300005764 | Tropical Forest Soil | MLPEKPEPVLLAKILNQVAGLGRIHAAQPSFSFS* |
| Ga0066903_1076038691 | 3300005764 | Tropical Forest Soil | QMLPEKPEPVLLAKIRTQVASLGRIHAPQPCFSSL* |
| Ga0081538_102530331 | 3300005981 | Tabebuia Heterophylla Rhizosphere | ETIKMLPAKPEPVLFAKVLNQVAGLGRIHTSQPSFSFS* |
| Ga0075430_1002964644 | 3300006846 | Populus Rhizosphere | LLPEKPEPILLAKILNQVASVGRIHAAQPPFSLS* |
| Ga0075430_1007553921 | 3300006846 | Populus Rhizosphere | MLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS* |
| Ga0075431_1001352316 | 3300006847 | Populus Rhizosphere | MLPEKPEPILLAKIRNQVAGLGRIHIAQPSFSFS* |
| Ga0075429_1012161971 | 3300006880 | Populus Rhizosphere | QMLPEKPEPVLLRQILNKVASLGRIHASQPSFSFS* |
| Ga0075424_1028015211 | 3300006904 | Populus Rhizosphere | TIKMLPEKPEPVLLAKLLKQVAGLGRIHAAQPSFSFS* |
| Ga0075419_101896471 | 3300006969 | Populus Rhizosphere | KMLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS* |
| Ga0099829_105652472 | 3300009038 | Vadose Zone Soil | IQMLPEKPEPVLLAKILNQVAGLGRIHASQPSFSFS* |
| Ga0099829_109146671 | 3300009038 | Vadose Zone Soil | PMLPEKPEPVLLAKILNQVARLGRIHASQPPFSFA* |
| Ga0099828_101106431 | 3300009089 | Vadose Zone Soil | MLPEKPEPVLLAKILNQVAGLGRIHASQPSFSFS* |
| Ga0099828_102422191 | 3300009089 | Vadose Zone Soil | MLPEKPEPVLLAQIFNKVAGLGRIHAVQSSFNPG* |
| Ga0099827_100101882 | 3300009090 | Vadose Zone Soil | MLPEKPEPVLLRQILNKVAGLGRIHAAQTSFSFS* |
| Ga0099827_100819551 | 3300009090 | Vadose Zone Soil | MLPEKPEPVLLGRILNEGAGLGRIHASQPSFSFA* |
| Ga0099827_101659622 | 3300009090 | Vadose Zone Soil | KMLPEKPEPVLLRQILNKVAGLGRIHAAQPSFSFS* |
| Ga0075418_102349911 | 3300009100 | Populus Rhizosphere | KLLPEKPEPILLAKILNQVASVGRIHAAQPPFSLS* |
| Ga0075418_122152792 | 3300009100 | Populus Rhizosphere | QMLPEKPEPGLLAKIRHQVAGLGRIHTSQSSFSVL* |
| Ga0066709_1002872841 | 3300009137 | Grasslands Soil | KMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS* |
| Ga0066709_1028834551 | 3300009137 | Grasslands Soil | KMLPEKPEPILLAKILNQVAGLGRIHAIEPSFSFS* |
| Ga0114129_101025341 | 3300009147 | Populus Rhizosphere | MLPEKPEPVLLAKILNQVAGLGRIHATQPSFSFS* |
| Ga0114129_102860541 | 3300009147 | Populus Rhizosphere | MLPEKPEPVLLRQILNKVAGLGRIHASQPSFSFS* |
| Ga0114129_116455391 | 3300009147 | Populus Rhizosphere | MLPEKPEPVLLEQIRNKVACLGRIHASQPSFSFS* |
| Ga0105249_100831614 | 3300009553 | Switchgrass Rhizosphere | MSTEKPEPILFAKILNQVAGLGRIHAVLPAFSFS* |
| Ga0126314_104834453 | 3300010042 | Serpentine Soil | MLPEKPEPILLAKILNRVAGLGRIHAAQSSFSFS* |
| Ga0126380_100473721 | 3300010043 | Tropical Forest Soil | MLPQKPEPVLLRQIFHKVAGLGRIHAAQPSFSFA* |
| Ga0126380_111156151 | 3300010043 | Tropical Forest Soil | KMLPEKPESDLLAKIRYHVACLGRIHTSQPCFSFV* |
| Ga0126384_110880531 | 3300010046 | Tropical Forest Soil | MLPEKPEPVLLAKILHQVAGLGRIHATQPSFSFS* |
| Ga0126382_109217981 | 3300010047 | Tropical Forest Soil | MLPEKPEPVLLGQILHKVAGLGRIHASQPSFSFS* |
| Ga0126382_118198051 | 3300010047 | Tropical Forest Soil | KMLPEKPEPVLLAKILKQVAGLGRIHATQPSFSFS* |
| Ga0126382_123560242 | 3300010047 | Tropical Forest Soil | KMLPEKPEPVLLRQILHKVAGLGRIHAAQPSFSFS* |
| Ga0126382_124029221 | 3300010047 | Tropical Forest Soil | IKMLPEKPEPILFAKILHQVASLGRIHASQASFSFS* |
| Ga0126378_103259981 | 3300010361 | Tropical Forest Soil | MLPEKPEPILLRQILHKVAGLGRIHAAPPSFSFS* |
| Ga0126378_124044031 | 3300010361 | Tropical Forest Soil | KMLPEKPEPVLLAKILNQVAGLGRIHAAQPSFSFS* |
| Ga0126377_127271802 | 3300010362 | Tropical Forest Soil | MLPEKPEPVLLEQILNKVACLGRIHAAQPSFSVS* |
| Ga0126377_128222201 | 3300010362 | Tropical Forest Soil | EETIKMLPEKPEPVLLGQILHKVTCLGRIHASQRSGSFS* |
| Ga0126379_132596081 | 3300010366 | Tropical Forest Soil | MLPEKPEPILLRQILHKVAGLGRIHAAQPSFSFS* |
| Ga0134128_131478941 | 3300010373 | Terrestrial Soil | YVEERIKMLPEKPEPVFLGQILHKIACLSRIHASQPSCSFS* |
| Ga0126383_111717971 | 3300010398 | Tropical Forest Soil | KMLPEKPEPVVLRQILRKVAGLGRIHASQPAFSFA* |
| Ga0126383_116756961 | 3300010398 | Tropical Forest Soil | ETIKMLPEKPEPILLRQILHKVAGLGRIHAAQPSFSFS* |
| Ga0137393_104233821 | 3300011271 | Vadose Zone Soil | MLPEKPEPVLLAKILNQVAGLGRIHAAEPSFSFS* |
| Ga0137388_108802691 | 3300012189 | Vadose Zone Soil | TIKMLPEKPEPVLLAKILHQVAGLGRIHAAPPSFSFS* |
| Ga0137383_107986251 | 3300012199 | Vadose Zone Soil | QMLPEKPEPILLCQILNKVAGLGRIHASQPSFSFS* |
| Ga0137383_111036422 | 3300012199 | Vadose Zone Soil | EETIKMLPEKPEPVLFAKILHKVACLGRIHASQPSVSFS* |
| Ga0137365_112053501 | 3300012201 | Vadose Zone Soil | RLPEKPEPVLLRQILNKVAGLGRIHASQPSFSFS* |
| Ga0137399_112256641 | 3300012203 | Vadose Zone Soil | QMLPEKPEPVLLAKIRNQVAGLGRIHVSPPSFSFS* |
| Ga0137380_107435551 | 3300012206 | Vadose Zone Soil | MLPEKPEPILLCQILNKVAGLGRIHASQPSFSFS* |
| Ga0137381_117721561 | 3300012207 | Vadose Zone Soil | MLPEKPEPVLLAKLLNQVTSLGRIHLSQPSFRFAELAMVLP |
| Ga0137379_103981731 | 3300012209 | Vadose Zone Soil | KMLPEKPEPVLFAKILNQVAGLGRIHAAQPSFSFS* |
| Ga0137378_118258161 | 3300012210 | Vadose Zone Soil | MLPEKPEPVLFAKILNQVAGLGRIHAAQPSFSFS* |
| Ga0137377_118756052 | 3300012211 | Vadose Zone Soil | EETRQMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS* |
| Ga0137387_110141301 | 3300012349 | Vadose Zone Soil | MLPEKPEPVLFAKILNQVAGLGRIHATQPSLSFS* |
| Ga0137369_104913892 | 3300012355 | Vadose Zone Soil | MLPEKPEPILLAKILKQVAGLGRIHAAQPTFSCSELA* |
| Ga0137361_103231551 | 3300012362 | Vadose Zone Soil | MLPETPEPVLLHQILNKVAGLGRLHASQPTFSFS* |
| Ga0137361_116711721 | 3300012362 | Vadose Zone Soil | KMLPEKPEPILFAKILNQVAGLGRIHATQPSCSFS* |
| Ga0137396_107181961 | 3300012918 | Vadose Zone Soil | ETIQMLPEKPEPVLLAKILNQVAGLGRIHAAPPSFSFS* |
| Ga0137396_111802881 | 3300012918 | Vadose Zone Soil | KMLPEKPEPVLFAKILNQVAGLGRIHAFQPSVSFS* |
| Ga0137404_111781041 | 3300012929 | Vadose Zone Soil | QMLPEKPEPVLLGQILHKVACLGRMHVSQPAFSFS* |
| Ga0137407_111708223 | 3300012930 | Vadose Zone Soil | ETIKMLPEKPEPILFAKILNRVAGLGRIHVSPPSFSFS* |
| Ga0162651_1000525641 | 3300012938 | Soil | IKMLPEKPEPILFAKILNQVAGLGRIHASLPSFSFS* |
| Ga0126375_116322101 | 3300012948 | Tropical Forest Soil | MLPEKPEPVLLAKILNQVAGLGRIHAAQPSFRFS* |
| Ga0126369_100436521 | 3300012971 | Tropical Forest Soil | MLPEKPEPILLVKIRNRVASLGRIHAAQPSFSFA* |
| Ga0126369_101083071 | 3300012971 | Tropical Forest Soil | IKMLPEKPEPILFAKILNQVASLGRIHASQASFSFS* |
| Ga0126369_107706301 | 3300012971 | Tropical Forest Soil | KMLPEKPEPVLLEQIRTKVACLGRIHGSQPSFSFS* |
| Ga0157379_102607431 | 3300014968 | Switchgrass Rhizosphere | YVEEMLQMLPEKPEPILLRQMLNKVACVGRIHAAQRSFSLS* |
| Ga0182033_101153693 | 3300016319 | Soil | EETIKMLPEKPEPVLFRQIRQEVAALGRIHASQPSFSFS |
| Ga0182032_111785831 | 3300016357 | Soil | QMLPEKPEPVLLAKILNRVAGLGRIHATQPSFSFS |
| Ga0182038_100940223 | 3300016445 | Soil | QMLPEKPEPILLAKIRNRVASLGRIHAAPPSFSFA |
| Ga0184637_105554341 | 3300018063 | Groundwater Sediment | QMLPEKPEPVLLGQILNKVACLGRIHASQPSFSFS |
| Ga0184612_104780371 | 3300018078 | Groundwater Sediment | QMLPEKPEPVLLRRILNKVACLGRIHASQPSFSFS |
| Ga0184627_100315631 | 3300018079 | Groundwater Sediment | KMLPEKPEPVLLAKIRNQVAGLGRIHVSPPSFSFS |
| Ga0184639_102220281 | 3300018082 | Groundwater Sediment | QLLPEKPEPVLLAKILNQVARLGRIHASQPSFSFA |
| Ga0190271_125914421 | 3300018481 | Soil | IKMLPEKPEPILLHEILTKVSGFGRIHASQPSFSFS |
| Ga0184648_12583441 | 3300019249 | Groundwater Sediment | MLPEKPELVLLGHILNKVAGLGRMHASQPVCSFSS |
| Ga0179594_100730922 | 3300020170 | Vadose Zone Soil | IKMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS |
| Ga0210378_103473762 | 3300021073 | Groundwater Sediment | EETIKMLPEKPEPILFAKILNRVAGLGRIHVSPPSFSFS |
| Ga0207646_112650363 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IQMLPEKPEPVLLERILNKVACLGRIHAAQPSFSFS |
| Ga0207677_110846472 | 3300026023 | Miscanthus Rhizosphere | QMLPEKPEPILLRQMLNKVACLGRIHAAQPSFSLS |
| Ga0209238_10480542 | 3300026301 | Grasslands Soil | IKMLPEKPEPVLFAKILNQVAGLGRIHAAQPSFSFS |
| Ga0209154_10938483 | 3300026317 | Soil | IQMLPEKPEPILFAKILNQVAGLGRIHASQPSVSFS |
| Ga0209801_10902243 | 3300026326 | Soil | TIKMLPEKPEPILLRQILNKVAGLGRIHASQPSFSFS |
| Ga0209158_11530651 | 3300026333 | Soil | IQMRPEKPAPVLLAKILNQVASLGRMHAAQPSFSFS |
| Ga0209376_10857301 | 3300026540 | Soil | QMLPEKPEPILLRQMLNKVAGLGRIHASQPSFSFS |
| Ga0209884_10141513 | 3300027013 | Groundwater Sand | KMLPEKPEPVLLAKILNQVAGLGRIHVSPPSFSFS |
| Ga0209388_10968512 | 3300027655 | Vadose Zone Soil | KMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS |
| Ga0209588_12381301 | 3300027671 | Vadose Zone Soil | KMLPEKPEPILFAKILNQVARLGRIHASPVSFSFS |
| Ga0209180_103732732 | 3300027846 | Vadose Zone Soil | IKMLPEKPEPVLLGRILNEVAGLGRIHASQPSFSFA |
| Ga0209481_100290375 | 3300027880 | Populus Rhizosphere | KMLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS |
| Ga0209481_101364921 | 3300027880 | Populus Rhizosphere | IKMLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS |
| Ga0209481_106327991 | 3300027880 | Populus Rhizosphere | IKLLPEKPEPILLAKILNQVASVGRIHAAQPPFSLS |
| Ga0207428_100479665 | 3300027907 | Populus Rhizosphere | IKMLPEKPEPVLLAKLLKQVAGLGRIHAAQPSFSFS |
| Ga0207428_101280742 | 3300027907 | Populus Rhizosphere | QMLPEKPEPVLLEQIRNKVACLGRIHASQPSFSFS |
| Ga0209382_103781281 | 3300027909 | Populus Rhizosphere | IKMLPEKPEPVLLRQILNKVAGLGRIHSSQPSFSFS |
| Ga0209858_10128862 | 3300027948 | Groundwater Sand | EETIKMLPEKPEPVLLAKILNQVAGLGRIHVSPPSFSFS |
| Ga0247828_111154341 | 3300028587 | Soil | IKMLPEKPEPVLLRQILRKVAGLGRIHASHSSFSFS |
| Ga0268259_100148951 | 3300030499 | Agave | IKLLPEKPEPILLAKIRTQVAGLGRIHAAQPSFSFA |
| Ga0308193_10898091 | 3300031096 | Soil | QMLPEKPEPILLRQILDRVACLGRIHIPQPSFSFS |
| Ga0308187_104679011 | 3300031114 | Soil | EETIKMLPEKPEPVLFAKILHHVAGLGRIHTTQPSLSFS |
| Ga0318538_100853212 | 3300031546 | Soil | IKMLPEKPEPVLLAKILHQVAGLGRIHATQPSFSFS |
| Ga0310915_106084111 | 3300031573 | Soil | IKLLPEKPEPILLAKIRNQVAGLGRIHAAQPSFSFS |
| Ga0247727_105730202 | 3300031576 | Biofilm | KLLPQKPEPVLLAQIFNTVAALGRIHPVQPDFSPG |
| Ga0318501_105916491 | 3300031736 | Soil | IKMLPEKPEPVLLAKIRNHVAGLGRIHAAQPSFSFS |
| Ga0318502_104659821 | 3300031747 | Soil | IQMLPEKPEPVLLAKILNRVAGLGRIHATQPSFSFS |
| Ga0318576_106113051 | 3300031796 | Soil | IKMLPEKPEPVLFRQILHKVAGLGRIHASQPSFSFS |
| Ga0307410_117686411 | 3300031852 | Rhizosphere | KMLPEKPEPILLAKIRNQVAGLGRIHAAPPSFSFA |
| Ga0318536_104245261 | 3300031893 | Soil | IKMLPEKPEPVLLAKILNQVAGLGRIHATQPSFSFS |
| Ga0310909_100270441 | 3300031947 | Soil | IKMLPEKPEPVLLAKILNQVAGLGRIHAAQPSFSFS |
| Ga0318505_103287011 | 3300032060 | Soil | KMLPEKPEPVLFRQILHKVAGLGRIHASQPSFSFS |
| Ga0306920_1027782151 | 3300032261 | Soil | IKMLPEKPEPVLFAKILNQVTGLGRIHATQPSLSFA |
| Ga0272431_101068703 | 3300033181 | Rock | LTMLPEKPEPILVARIFAKMASLGRVHAVPPDSLAS |
| Ga0247830_102882101 | 3300033551 | Soil | KMLPEKPEPVLLRQILRKVAGLGRIHASHSSFSFS |
| ⦗Top⦘ |