Metagenome / Metatranscriptome Family F074522

Overview

Basic Information

• Family ID: F074522
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 119
• Average Sequence Length: 36 residues
• Representative Sequence: MLPEKPEPVLLAKILNQVAGLGRIHASQPSFSFS
• Number of Associated Samples: 90
• Number of Associated Scaffolds: 119

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 5.04 %
• % of genes near scaffold ends (potentially truncated): 95.80 %
• % of genes from short scaffolds (< 2000 bps): 84.03 %
• Associated GOLD sequencing projects: 88
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (68.908 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.210 % of family members)
• Environment Ontology (ENVO): Unclassified (28.571 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (45.378 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 29.03%
  β-sheet: 0.00%
  Coil/Unstructured: 70.97%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF13546	DDE_5	5.04
PF13358	DDE_3	2.52
PF04255	DUF433	1.68
PF00496	SBP_bac_5	1.68
PF14104	DUF4277	1.68
PF01609	DDE_Tnp_1	1.68
PF01075	Glyco_transf_9	1.68
PF00239	Resolvase	0.84
PF13473	Cupredoxin_1	0.84
PF13613	HTH_Tnp_4	0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 119 Family Scaffolds
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	1.68
COG0859	ADP-heptose:LPS heptosyltransferase	Cell wall/membrane/envelope biogenesis [M]	1.68
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	1.68
COG5421	Transposase	Mobilome: prophages, transposons [X]	1.68
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	1.68
COG3293	Transposase	Mobilome: prophages, transposons [X]	1.68
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	1.68
COG2442	Predicted antitoxin component of a toxin-antitoxin system, DUF433 family	Defense mechanisms [V]	1.68
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.84
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.84

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	68.91 %
Unclassified	root	N/A	31.09 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	68.91 %
Unclassified	root	N/A	31.09 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	68.91 %
Unclassified	root	N/A	31.09 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.68 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.84 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.84 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	5.04 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	11.76 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	14.29 %
Unclassified	root	N/A	31.09 %

Level 5

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.52 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.68 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.84 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.84 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	4.20 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.84 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	11.76 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	2.52 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.84 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.52 %
Nitrospinae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae	0.84 %
Unclassified	root	N/A	31.09 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.84 %

Level 6

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.84 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.84 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.84 %
candidate division KSB1	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1	0.84 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	4.20 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.84 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.84 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	11.76 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.84 %
Ktedonobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria	0.84 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.68 %
Unclassified	root	N/A	31.09 %
unclassified Nitrospinota	no rank	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota	0.84 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.84 %

Level 7

Name	Rank	Taxonomy	Distribution
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.84 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.84 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.84 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.84 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.84 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.84 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.84 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.84 %
Ktedonobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales	0.84 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.84 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	3.36 %
Unclassified	root	N/A	31.09 %
unclassified candidate division KSB1	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1	0.84 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.84 %
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	0.84 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.68 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	0.84 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.84 %

Level 8

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.84 %
candidate division KSB1 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium	0.84 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.84 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %
Chlorogloeopsidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Chlorogloeopsidaceae	0.84 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.84 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.84 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.68 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.84 %
Ktedonobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae	0.84 %
Nitrosococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus	0.84 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.84 %
Nostocaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae	0.84 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.84 %
Rhodovastum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum	0.84 %
Unclassified	root	N/A	31.09 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.84 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.84 %

Level 9

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %
Anabaena	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena	0.84 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.84 %
candidate division KSB1 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium	0.84 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.84 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %
Chlorogloeopsis	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Chlorogloeopsidaceae → Chlorogloeopsis	0.84 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.84 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.68 %
Hymenobacteraceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae	0.84 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.84 %
Ktedonobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter	0.84 %
Nitrosococcus wardiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus wardiae	0.84 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.84 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.84 %
Rhodovastum atsumiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense	0.84 %
Unclassified	root	N/A	31.09 %
unclassified Variovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax	0.84 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.84 %

Level 10

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.84 %
candidate division KSB1 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium	0.84 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.84 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %
Chlorogloeopsis fritschii	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Chlorogloeopsidaceae → Chlorogloeopsis → Chlorogloeopsis fritschii	0.84 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.84 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.68 %
Hymenobacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter	0.84 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.84 %
Nitrosococcus wardiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus wardiae	0.84 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.84 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.84 %
Rhodovastum atsumiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense	0.84 %
Unclassified	root	N/A	31.09 %
unclassified Anabaena	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena → unclassified Anabaena	0.84 %
unclassified Ktedonobacter	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter	0.84 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.84 %
Variovorax sp. JS1663	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. JS1663	0.84 %

Level 11

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %
Anabaena sp. 90	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena → unclassified Anabaena → Anabaena sp. 90	0.84 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.84 %
candidate division KSB1 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium	0.84 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.84 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %
Chlorogloeopsis fritschii	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Chlorogloeopsidaceae → Chlorogloeopsis → Chlorogloeopsis fritschii	0.84 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.84 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.68 %
Hymenobacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter	0.84 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.84 %
Ktedonobacter sp. 13_2_20CM_53_11	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_2_20CM_53_11	0.84 %
Nitrosococcus wardiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus wardiae	0.84 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.84 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.84 %
Rhodovastum atsumiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense	0.84 %
Unclassified	root	N/A	31.09 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.84 %
Variovorax sp. JS1663	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. JS1663	0.84 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000559|F14TC_102419036	All Organisms → cellular organisms → Bacteria	951
3300005552|Ga0066701_10322710	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	957
3300005558|Ga0066698_10560992	All Organisms → cellular organisms → Bacteria	774
3300005577|Ga0068857_100885560	All Organisms → cellular organisms → Bacteria	855
3300005764|Ga0066903_100235541	All Organisms → cellular organisms → Bacteria	2799
3300005764|Ga0066903_100497143	All Organisms → cellular organisms → Bacteria	2064
3300005764|Ga0066903_101375082	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1324
3300005764|Ga0066903_106692681	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena → unclassified Anabaena → Anabaena sp. 90	599
3300005764|Ga0066903_107073597	Not Available	581
3300005764|Ga0066903_107603869	Not Available	558

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	79.83%
Host-Associated	Host-Associated	20.17%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	5.04%
Plants	Host-Associated → Plants	20.17%
Terrestrial	Environmental → Terrestrial	74.79%

Category

Habitat	Taxonomy	Distribution
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.84%
Cave	Environmental → Terrestrial → Cave	0.84%
Freshwater	Environmental → Aquatic → Freshwater	1.68%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.84%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.68%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.81%
Rock-Dwelling (Endoliths)	Environmental → Terrestrial → Rock-Dwelling (Endoliths)	0.84%
Roots	Host-Associated → Plants → Roots	0.84%
Sediment	Environmental → Aquatic → Sediment	3.36%
Soil	Environmental → Terrestrial → Soil	72.27%

Type

Habitat	Taxonomy	Distribution
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.68%
Loam	Environmental → Terrestrial → Soil → Loam	6.72%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.84%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.84%
Sand	Environmental → Terrestrial → Soil → Sand	1.68%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.68%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	63.87%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	16.81%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.36%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified	0.84%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.84%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.84%

Subtype

Habitat	Taxonomy	Distribution
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.68%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.84%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.08%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.04%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.56%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.84%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	44.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	16.81%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.36%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.68%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.68%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified	0.84%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.84%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.84%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.84%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.84%

Habitat

Habitat	Taxonomy	Distribution
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.84%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.84%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.84%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.84%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.52%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.68%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.36%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.84%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	14.29%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.84%
Rock	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock	0.84%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.52%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.68%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.84%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.84%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere	0.84%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.84%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	15.13%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.04%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	25.21%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Host-Associated
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F14TC_1024190363	3300000559	Soil	AEPINMLPEKPEPVLFATMLTQVASLGRIHAVQPCFSFS*
Ga0066701_103227103	3300005552	Soil	MLPEKPEPILLRQMLNKVAGLGRIHASQPSFSFS*
Ga0066698_105609921	3300005558	Soil	MLPEKPEPILLAKILNQVAGLGRIHAIEPSFSFS*
Ga0068857_1008855602	3300005577	Corn Rhizosphere	MLPEKPEPILLAKIRNQVAGLGRIHAAQASFSFA*
Ga0066903_1002355411	3300005764	Tropical Forest Soil	MLPEKPEPILLRQILHKVAGLGRIHASQPSSSFS*
Ga0066903_1004971431	3300005764	Tropical Forest Soil	MLPEKPEPVLLAKILNRVAGLGRIHATPPSFSFS*
Ga0066903_1013750822	3300005764	Tropical Forest Soil	MLPEKPEPILLAKIRNQVASLGRIHAAQPAFSFS*
Ga0066903_1066926811	3300005764	Tropical Forest Soil	MLPEKPEPVLLEQIRTKVACLGRIHGSQPSFSFS*
Ga0066903_1070735972	3300005764	Tropical Forest Soil	MLPEKPEPVLLAKILNQVAGLGRIHAAQPSFSFS*
Ga0066903_1076038691	3300005764	Tropical Forest Soil	QMLPEKPEPVLLAKIRTQVASLGRIHAPQPCFSSL*
Ga0081538_102530331	3300005981	Tabebuia Heterophylla Rhizosphere	ETIKMLPAKPEPVLFAKVLNQVAGLGRIHTSQPSFSFS*
Ga0075430_1002964644	3300006846	Populus Rhizosphere	LLPEKPEPILLAKILNQVASVGRIHAAQPPFSLS*
Ga0075430_1007553921	3300006846	Populus Rhizosphere	MLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS*
Ga0075431_1001352316	3300006847	Populus Rhizosphere	MLPEKPEPILLAKIRNQVAGLGRIHIAQPSFSFS*
Ga0075429_1012161971	3300006880	Populus Rhizosphere	QMLPEKPEPVLLRQILNKVASLGRIHASQPSFSFS*
Ga0075424_1028015211	3300006904	Populus Rhizosphere	TIKMLPEKPEPVLLAKLLKQVAGLGRIHAAQPSFSFS*
Ga0075419_101896471	3300006969	Populus Rhizosphere	KMLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS*
Ga0099829_105652472	3300009038	Vadose Zone Soil	IQMLPEKPEPVLLAKILNQVAGLGRIHASQPSFSFS*
Ga0099829_109146671	3300009038	Vadose Zone Soil	PMLPEKPEPVLLAKILNQVARLGRIHASQPPFSFA*
Ga0099828_101106431	3300009089	Vadose Zone Soil	MLPEKPEPVLLAKILNQVAGLGRIHASQPSFSFS*
Ga0099828_102422191	3300009089	Vadose Zone Soil	MLPEKPEPVLLAQIFNKVAGLGRIHAVQSSFNPG*
Ga0099827_100101882	3300009090	Vadose Zone Soil	MLPEKPEPVLLRQILNKVAGLGRIHAAQTSFSFS*
Ga0099827_100819551	3300009090	Vadose Zone Soil	MLPEKPEPVLLGRILNEGAGLGRIHASQPSFSFA*
Ga0099827_101659622	3300009090	Vadose Zone Soil	KMLPEKPEPVLLRQILNKVAGLGRIHAAQPSFSFS*
Ga0075418_102349911	3300009100	Populus Rhizosphere	KLLPEKPEPILLAKILNQVASVGRIHAAQPPFSLS*
Ga0075418_122152792	3300009100	Populus Rhizosphere	QMLPEKPEPGLLAKIRHQVAGLGRIHTSQSSFSVL*
Ga0066709_1002872841	3300009137	Grasslands Soil	KMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS*
Ga0066709_1028834551	3300009137	Grasslands Soil	KMLPEKPEPILLAKILNQVAGLGRIHAIEPSFSFS*
Ga0114129_101025341	3300009147	Populus Rhizosphere	MLPEKPEPVLLAKILNQVAGLGRIHATQPSFSFS*
Ga0114129_102860541	3300009147	Populus Rhizosphere	MLPEKPEPVLLRQILNKVAGLGRIHASQPSFSFS*
Ga0114129_116455391	3300009147	Populus Rhizosphere	MLPEKPEPVLLEQIRNKVACLGRIHASQPSFSFS*
Ga0105249_100831614	3300009553	Switchgrass Rhizosphere	MSTEKPEPILFAKILNQVAGLGRIHAVLPAFSFS*
Ga0126314_104834453	3300010042	Serpentine Soil	MLPEKPEPILLAKILNRVAGLGRIHAAQSSFSFS*
Ga0126380_100473721	3300010043	Tropical Forest Soil	MLPQKPEPVLLRQIFHKVAGLGRIHAAQPSFSFA*
Ga0126380_111156151	3300010043	Tropical Forest Soil	KMLPEKPESDLLAKIRYHVACLGRIHTSQPCFSFV*
Ga0126384_110880531	3300010046	Tropical Forest Soil	MLPEKPEPVLLAKILHQVAGLGRIHATQPSFSFS*
Ga0126382_109217981	3300010047	Tropical Forest Soil	MLPEKPEPVLLGQILHKVAGLGRIHASQPSFSFS*
Ga0126382_118198051	3300010047	Tropical Forest Soil	KMLPEKPEPVLLAKILKQVAGLGRIHATQPSFSFS*
Ga0126382_123560242	3300010047	Tropical Forest Soil	KMLPEKPEPVLLRQILHKVAGLGRIHAAQPSFSFS*
Ga0126382_124029221	3300010047	Tropical Forest Soil	IKMLPEKPEPILFAKILHQVASLGRIHASQASFSFS*
Ga0126378_103259981	3300010361	Tropical Forest Soil	MLPEKPEPILLRQILHKVAGLGRIHAAPPSFSFS*
Ga0126378_124044031	3300010361	Tropical Forest Soil	KMLPEKPEPVLLAKILNQVAGLGRIHAAQPSFSFS*
Ga0126377_127271802	3300010362	Tropical Forest Soil	MLPEKPEPVLLEQILNKVACLGRIHAAQPSFSVS*
Ga0126377_128222201	3300010362	Tropical Forest Soil	EETIKMLPEKPEPVLLGQILHKVTCLGRIHASQRSGSFS*
Ga0126379_132596081	3300010366	Tropical Forest Soil	MLPEKPEPILLRQILHKVAGLGRIHAAQPSFSFS*
Ga0134128_131478941	3300010373	Terrestrial Soil	YVEERIKMLPEKPEPVFLGQILHKIACLSRIHASQPSCSFS*
Ga0126383_111717971	3300010398	Tropical Forest Soil	KMLPEKPEPVVLRQILRKVAGLGRIHASQPAFSFA*
Ga0126383_116756961	3300010398	Tropical Forest Soil	ETIKMLPEKPEPILLRQILHKVAGLGRIHAAQPSFSFS*
Ga0137393_104233821	3300011271	Vadose Zone Soil	MLPEKPEPVLLAKILNQVAGLGRIHAAEPSFSFS*
Ga0137388_108802691	3300012189	Vadose Zone Soil	TIKMLPEKPEPVLLAKILHQVAGLGRIHAAPPSFSFS*
Ga0137383_107986251	3300012199	Vadose Zone Soil	QMLPEKPEPILLCQILNKVAGLGRIHASQPSFSFS*
Ga0137383_111036422	3300012199	Vadose Zone Soil	EETIKMLPEKPEPVLFAKILHKVACLGRIHASQPSVSFS*
Ga0137365_112053501	3300012201	Vadose Zone Soil	RLPEKPEPVLLRQILNKVAGLGRIHASQPSFSFS*
Ga0137399_112256641	3300012203	Vadose Zone Soil	QMLPEKPEPVLLAKIRNQVAGLGRIHVSPPSFSFS*
Ga0137380_107435551	3300012206	Vadose Zone Soil	MLPEKPEPILLCQILNKVAGLGRIHASQPSFSFS*
Ga0137381_117721561	3300012207	Vadose Zone Soil	MLPEKPEPVLLAKLLNQVTSLGRIHLSQPSFRFAELAMVLP
Ga0137379_103981731	3300012209	Vadose Zone Soil	KMLPEKPEPVLFAKILNQVAGLGRIHAAQPSFSFS*
Ga0137378_118258161	3300012210	Vadose Zone Soil	MLPEKPEPVLFAKILNQVAGLGRIHAAQPSFSFS*
Ga0137377_118756052	3300012211	Vadose Zone Soil	EETRQMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS*
Ga0137387_110141301	3300012349	Vadose Zone Soil	MLPEKPEPVLFAKILNQVAGLGRIHATQPSLSFS*
Ga0137369_104913892	3300012355	Vadose Zone Soil	MLPEKPEPILLAKILKQVAGLGRIHAAQPTFSCSELA*
Ga0137361_103231551	3300012362	Vadose Zone Soil	MLPETPEPVLLHQILNKVAGLGRLHASQPTFSFS*
Ga0137361_116711721	3300012362	Vadose Zone Soil	KMLPEKPEPILFAKILNQVAGLGRIHATQPSCSFS*
Ga0137396_107181961	3300012918	Vadose Zone Soil	ETIQMLPEKPEPVLLAKILNQVAGLGRIHAAPPSFSFS*
Ga0137396_111802881	3300012918	Vadose Zone Soil	KMLPEKPEPVLFAKILNQVAGLGRIHAFQPSVSFS*
Ga0137404_111781041	3300012929	Vadose Zone Soil	QMLPEKPEPVLLGQILHKVACLGRMHVSQPAFSFS*
Ga0137407_111708223	3300012930	Vadose Zone Soil	ETIKMLPEKPEPILFAKILNRVAGLGRIHVSPPSFSFS*
Ga0162651_1000525641	3300012938	Soil	IKMLPEKPEPILFAKILNQVAGLGRIHASLPSFSFS*
Ga0126375_116322101	3300012948	Tropical Forest Soil	MLPEKPEPVLLAKILNQVAGLGRIHAAQPSFRFS*
Ga0126369_100436521	3300012971	Tropical Forest Soil	MLPEKPEPILLVKIRNRVASLGRIHAAQPSFSFA*
Ga0126369_101083071	3300012971	Tropical Forest Soil	IKMLPEKPEPILFAKILNQVASLGRIHASQASFSFS*
Ga0126369_107706301	3300012971	Tropical Forest Soil	KMLPEKPEPVLLEQIRTKVACLGRIHGSQPSFSFS*
Ga0157379_102607431	3300014968	Switchgrass Rhizosphere	YVEEMLQMLPEKPEPILLRQMLNKVACVGRIHAAQRSFSLS*
Ga0182033_101153693	3300016319	Soil	EETIKMLPEKPEPVLFRQIRQEVAALGRIHASQPSFSFS
Ga0182032_111785831	3300016357	Soil	QMLPEKPEPVLLAKILNRVAGLGRIHATQPSFSFS
Ga0182038_100940223	3300016445	Soil	QMLPEKPEPILLAKIRNRVASLGRIHAAPPSFSFA
Ga0184637_105554341	3300018063	Groundwater Sediment	QMLPEKPEPVLLGQILNKVACLGRIHASQPSFSFS
Ga0184612_104780371	3300018078	Groundwater Sediment	QMLPEKPEPVLLRRILNKVACLGRIHASQPSFSFS
Ga0184627_100315631	3300018079	Groundwater Sediment	KMLPEKPEPVLLAKIRNQVAGLGRIHVSPPSFSFS
Ga0184639_102220281	3300018082	Groundwater Sediment	QLLPEKPEPVLLAKILNQVARLGRIHASQPSFSFA
Ga0190271_125914421	3300018481	Soil	IKMLPEKPEPILLHEILTKVSGFGRIHASQPSFSFS
Ga0184648_12583441	3300019249	Groundwater Sediment	MLPEKPELVLLGHILNKVAGLGRMHASQPVCSFSS
Ga0179594_100730922	3300020170	Vadose Zone Soil	IKMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS
Ga0210378_103473762	3300021073	Groundwater Sediment	EETIKMLPEKPEPILFAKILNRVAGLGRIHVSPPSFSFS
Ga0207646_112650363	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	IQMLPEKPEPVLLERILNKVACLGRIHAAQPSFSFS
Ga0207677_110846472	3300026023	Miscanthus Rhizosphere	QMLPEKPEPILLRQMLNKVACLGRIHAAQPSFSLS
Ga0209238_10480542	3300026301	Grasslands Soil	IKMLPEKPEPVLFAKILNQVAGLGRIHAAQPSFSFS
Ga0209154_10938483	3300026317	Soil	IQMLPEKPEPILFAKILNQVAGLGRIHASQPSVSFS
Ga0209801_10902243	3300026326	Soil	TIKMLPEKPEPILLRQILNKVAGLGRIHASQPSFSFS
Ga0209158_11530651	3300026333	Soil	IQMRPEKPAPVLLAKILNQVASLGRMHAAQPSFSFS
Ga0209376_10857301	3300026540	Soil	QMLPEKPEPILLRQMLNKVAGLGRIHASQPSFSFS
Ga0209884_10141513	3300027013	Groundwater Sand	KMLPEKPEPVLLAKILNQVAGLGRIHVSPPSFSFS
Ga0209388_10968512	3300027655	Vadose Zone Soil	KMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS
Ga0209588_12381301	3300027671	Vadose Zone Soil	KMLPEKPEPILFAKILNQVARLGRIHASPVSFSFS
Ga0209180_103732732	3300027846	Vadose Zone Soil	IKMLPEKPEPVLLGRILNEVAGLGRIHASQPSFSFA
Ga0209481_100290375	3300027880	Populus Rhizosphere	KMLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS
Ga0209481_101364921	3300027880	Populus Rhizosphere	IKMLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS
Ga0209481_106327991	3300027880	Populus Rhizosphere	IKLLPEKPEPILLAKILNQVASVGRIHAAQPPFSLS
Ga0207428_100479665	3300027907	Populus Rhizosphere	IKMLPEKPEPVLLAKLLKQVAGLGRIHAAQPSFSFS
Ga0207428_101280742	3300027907	Populus Rhizosphere	QMLPEKPEPVLLEQIRNKVACLGRIHASQPSFSFS
Ga0209382_103781281	3300027909	Populus Rhizosphere	IKMLPEKPEPVLLRQILNKVAGLGRIHSSQPSFSFS
Ga0209858_10128862	3300027948	Groundwater Sand	EETIKMLPEKPEPVLLAKILNQVAGLGRIHVSPPSFSFS
Ga0247828_111154341	3300028587	Soil	IKMLPEKPEPVLLRQILRKVAGLGRIHASHSSFSFS
Ga0268259_100148951	3300030499	Agave	IKLLPEKPEPILLAKIRTQVAGLGRIHAAQPSFSFA
Ga0308193_10898091	3300031096	Soil	QMLPEKPEPILLRQILDRVACLGRIHIPQPSFSFS
Ga0308187_104679011	3300031114	Soil	EETIKMLPEKPEPVLFAKILHHVAGLGRIHTTQPSLSFS
Ga0318538_100853212	3300031546	Soil	IKMLPEKPEPVLLAKILHQVAGLGRIHATQPSFSFS
Ga0310915_106084111	3300031573	Soil	IKLLPEKPEPILLAKIRNQVAGLGRIHAAQPSFSFS
Ga0247727_105730202	3300031576	Biofilm	KLLPQKPEPVLLAQIFNTVAALGRIHPVQPDFSPG
Ga0318501_105916491	3300031736	Soil	IKMLPEKPEPVLLAKIRNHVAGLGRIHAAQPSFSFS
Ga0318502_104659821	3300031747	Soil	IQMLPEKPEPVLLAKILNRVAGLGRIHATQPSFSFS
Ga0318576_106113051	3300031796	Soil	IKMLPEKPEPVLFRQILHKVAGLGRIHASQPSFSFS
Ga0307410_117686411	3300031852	Rhizosphere	KMLPEKPEPILLAKIRNQVAGLGRIHAAPPSFSFA
Ga0318536_104245261	3300031893	Soil	IKMLPEKPEPVLLAKILNQVAGLGRIHATQPSFSFS
Ga0310909_100270441	3300031947	Soil	IKMLPEKPEPVLLAKILNQVAGLGRIHAAQPSFSFS
Ga0318505_103287011	3300032060	Soil	KMLPEKPEPVLFRQILHKVAGLGRIHASQPSFSFS
Ga0306920_1027782151	3300032261	Soil	IKMLPEKPEPVLFAKILNQVTGLGRIHATQPSLSFA
Ga0272431_101068703	3300033181	Rock	LTMLPEKPEPILVARIFAKMASLGRVHAVPPDSLAS
Ga0247830_102882101	3300033551	Soil	KMLPEKPEPVLLRQILRKVAGLGRIHASHSSFSFS