Basic Information | |
---|---|
Family ID | F074454 |
Family Type | Metagenome |
Number of Sequences | 119 |
Average Sequence Length | 36 residues |
Representative Sequence | MKNFLQLKLDMEVGIDGMLVNETKKISFHSKEVFTF |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 5.04 % |
% of genes near scaffold ends (potentially truncated) | 92.44 % |
% of genes from short scaffolds (< 2000 bps) | 80.67 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (68.908 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (32.773 % of family members) |
Environment Ontology (ENVO) | Unclassified (83.193 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.353 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF00486 | Trans_reg_C | 22.69 |
PF00672 | HAMP | 13.45 |
PF05221 | AdoHcyase | 7.56 |
PF02518 | HATPase_c | 6.72 |
PF00476 | DNA_pol_A | 4.20 |
PF02739 | 5_3_exonuc_N | 3.36 |
PF02367 | TsaE | 1.68 |
PF00300 | His_Phos_1 | 1.68 |
PF02632 | BioY | 1.68 |
PF01612 | DNA_pol_A_exo1 | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 7.56 |
COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 4.20 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 3.36 |
COG0802 | tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE | Translation, ribosomal structure and biogenesis [J] | 1.68 |
COG1268 | Biotin transporter BioY | Coenzyme transport and metabolism [H] | 1.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 68.91 % |
All Organisms | root | All Organisms | 31.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001354|JGI20155J14468_10047576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1853 | Open in IMG/M |
3300001354|JGI20155J14468_10108345 | Not Available | 962 | Open in IMG/M |
3300001951|GOS2249_1005536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1510 | Open in IMG/M |
3300002033|GOS24894_10130569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1706 | Open in IMG/M |
3300002033|GOS24894_10280414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1706 | Open in IMG/M |
3300005934|Ga0066377_10223808 | Not Available | 580 | Open in IMG/M |
3300005946|Ga0066378_10068886 | Not Available | 1098 | Open in IMG/M |
3300005960|Ga0066364_10005273 | Not Available | 3698 | Open in IMG/M |
3300005971|Ga0066370_10018502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1978 | Open in IMG/M |
3300005971|Ga0066370_10300688 | Not Available | 574 | Open in IMG/M |
3300006025|Ga0075474_10049012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1433 | Open in IMG/M |
3300007113|Ga0101666_1067724 | Not Available | 661 | Open in IMG/M |
3300007133|Ga0101671_1008841 | Not Available | 1332 | Open in IMG/M |
3300010883|Ga0133547_10187252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4431 | Open in IMG/M |
3300012920|Ga0160423_11073595 | Not Available | 538 | Open in IMG/M |
3300012928|Ga0163110_10201450 | Not Available | 1411 | Open in IMG/M |
3300017717|Ga0181404_1151037 | Not Available | 560 | Open in IMG/M |
3300017749|Ga0181392_1101077 | Not Available | 861 | Open in IMG/M |
3300017749|Ga0181392_1122335 | Not Available | 770 | Open in IMG/M |
3300017762|Ga0181422_1022808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2050 | Open in IMG/M |
3300017762|Ga0181422_1026424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1900 | Open in IMG/M |
3300017762|Ga0181422_1162917 | Not Available | 681 | Open in IMG/M |
3300017770|Ga0187217_1100875 | Not Available | 982 | Open in IMG/M |
3300017771|Ga0181425_1027754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1869 | Open in IMG/M |
3300017771|Ga0181425_1070274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1131 | Open in IMG/M |
3300017783|Ga0181379_1273553 | Not Available | 578 | Open in IMG/M |
3300017786|Ga0181424_10013205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3566 | Open in IMG/M |
3300017786|Ga0181424_10025597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2558 | Open in IMG/M |
3300017786|Ga0181424_10123992 | Not Available | 1113 | Open in IMG/M |
3300017786|Ga0181424_10346234 | Not Available | 611 | Open in IMG/M |
3300017786|Ga0181424_10348546 | Not Available | 609 | Open in IMG/M |
3300017824|Ga0181552_10163496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1175 | Open in IMG/M |
3300017949|Ga0181584_10841878 | Not Available | 541 | Open in IMG/M |
3300017950|Ga0181607_10538595 | Not Available | 620 | Open in IMG/M |
3300017986|Ga0181569_11028114 | Not Available | 531 | Open in IMG/M |
3300020207|Ga0181570_10016194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4773 | Open in IMG/M |
3300020266|Ga0211519_1009304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2576 | Open in IMG/M |
3300020274|Ga0211658_1093554 | Not Available | 596 | Open in IMG/M |
3300020339|Ga0211605_1115093 | Not Available | 517 | Open in IMG/M |
3300020368|Ga0211674_10100323 | Not Available | 759 | Open in IMG/M |
3300020374|Ga0211477_10270013 | Not Available | 580 | Open in IMG/M |
3300020381|Ga0211476_10181272 | Not Available | 750 | Open in IMG/M |
3300020382|Ga0211686_10046640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1750 | Open in IMG/M |
3300020382|Ga0211686_10152224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 953 | Open in IMG/M |
3300020391|Ga0211675_10129710 | Not Available | 1136 | Open in IMG/M |
3300020391|Ga0211675_10304155 | Not Available | 674 | Open in IMG/M |
3300020396|Ga0211687_10062864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1634 | Open in IMG/M |
3300020396|Ga0211687_10379715 | Not Available | 546 | Open in IMG/M |
3300020400|Ga0211636_10208615 | Not Available | 758 | Open in IMG/M |
3300020400|Ga0211636_10280294 | Not Available | 637 | Open in IMG/M |
3300020413|Ga0211516_10200243 | Not Available | 918 | Open in IMG/M |
3300020414|Ga0211523_10155320 | Not Available | 957 | Open in IMG/M |
3300020419|Ga0211512_10318720 | Not Available | 704 | Open in IMG/M |
3300020420|Ga0211580_10004409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6778 | Open in IMG/M |
3300020440|Ga0211518_10313487 | Not Available | 739 | Open in IMG/M |
3300020440|Ga0211518_10515877 | Not Available | 537 | Open in IMG/M |
3300020441|Ga0211695_10363662 | Not Available | 542 | Open in IMG/M |
3300020448|Ga0211638_10339354 | Not Available | 700 | Open in IMG/M |
3300020448|Ga0211638_10508376 | Not Available | 567 | Open in IMG/M |
3300020450|Ga0211641_10490859 | Not Available | 587 | Open in IMG/M |
3300020451|Ga0211473_10428698 | Not Available | 676 | Open in IMG/M |
3300020451|Ga0211473_10687938 | Not Available | 513 | Open in IMG/M |
3300020452|Ga0211545_10529078 | Not Available | 530 | Open in IMG/M |
3300020454|Ga0211548_10275023 | Not Available | 820 | Open in IMG/M |
3300020457|Ga0211643_10304710 | Not Available | 782 | Open in IMG/M |
3300020457|Ga0211643_10544777 | Not Available | 570 | Open in IMG/M |
3300020459|Ga0211514_10101124 | Not Available | 1439 | Open in IMG/M |
3300020463|Ga0211676_10147336 | Not Available | 1485 | Open in IMG/M |
3300020465|Ga0211640_10209484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1097 | Open in IMG/M |
3300020468|Ga0211475_10010971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 5665 | Open in IMG/M |
3300020468|Ga0211475_10310783 | Not Available | 773 | Open in IMG/M |
3300020469|Ga0211577_10242780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1164 | Open in IMG/M |
3300020469|Ga0211577_10332336 | Not Available | 954 | Open in IMG/M |
3300020469|Ga0211577_10367654 | Not Available | 896 | Open in IMG/M |
3300020471|Ga0211614_10101863 | Not Available | 1218 | Open in IMG/M |
3300021335|Ga0213867_1107395 | Not Available | 993 | Open in IMG/M |
3300023172|Ga0255766_10311761 | Not Available | 796 | Open in IMG/M |
3300023229|Ga0222661_1013132 | Not Available | 1389 | Open in IMG/M |
(restricted) 3300024255|Ga0233438_10292659 | Not Available | 627 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10059407 | Not Available | 2214 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10065546 | Not Available | 2063 | Open in IMG/M |
3300025822|Ga0209714_1170132 | Not Available | 540 | Open in IMG/M |
3300025890|Ga0209631_10017818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5816 | Open in IMG/M |
3300025894|Ga0209335_10009824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 7870 | Open in IMG/M |
3300025894|Ga0209335_10291433 | Not Available | 698 | Open in IMG/M |
3300025897|Ga0209425_10063517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS40 | 2365 | Open in IMG/M |
3300025897|Ga0209425_10506708 | Not Available | 554 | Open in IMG/M |
3300026083|Ga0208878_1112195 | Not Available | 670 | Open in IMG/M |
3300026085|Ga0208880_1079741 | Not Available | 707 | Open in IMG/M |
3300026270|Ga0207993_1008514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3514 | Open in IMG/M |
3300026270|Ga0207993_1126765 | Not Available | 676 | Open in IMG/M |
3300026321|Ga0208764_10506474 | Not Available | 552 | Open in IMG/M |
3300026517|Ga0228607_1120284 | Not Available | 647 | Open in IMG/M |
3300027506|Ga0208973_1089523 | Not Available | 711 | Open in IMG/M |
3300027752|Ga0209192_10204682 | Not Available | 750 | Open in IMG/M |
3300027779|Ga0209709_10001961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 18426 | Open in IMG/M |
3300027780|Ga0209502_10023062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3739 | Open in IMG/M |
3300027788|Ga0209711_10059253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2067 | Open in IMG/M |
3300027788|Ga0209711_10171797 | Not Available | 1022 | Open in IMG/M |
3300027801|Ga0209091_10242096 | Not Available | 880 | Open in IMG/M |
3300027813|Ga0209090_10587634 | Not Available | 505 | Open in IMG/M |
3300028197|Ga0257110_1086872 | Not Available | 1324 | Open in IMG/M |
3300031143|Ga0308025_1223422 | Not Available | 635 | Open in IMG/M |
3300031519|Ga0307488_10217952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1280 | Open in IMG/M |
3300031598|Ga0308019_10032982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2284 | Open in IMG/M |
3300031598|Ga0308019_10297198 | Not Available | 602 | Open in IMG/M |
3300031599|Ga0308007_10204379 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300031659|Ga0307986_10213946 | Not Available | 854 | Open in IMG/M |
3300031696|Ga0307995_1023584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2772 | Open in IMG/M |
3300031696|Ga0307995_1169705 | Not Available | 795 | Open in IMG/M |
3300031774|Ga0315331_10226103 | Not Available | 1388 | Open in IMG/M |
3300032006|Ga0310344_10038926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3793 | Open in IMG/M |
3300032006|Ga0310344_11181466 | Not Available | 635 | Open in IMG/M |
3300032011|Ga0315316_10038149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3793 | Open in IMG/M |
3300032011|Ga0315316_10542929 | Not Available | 973 | Open in IMG/M |
3300032048|Ga0315329_10306489 | Not Available | 843 | Open in IMG/M |
3300032073|Ga0315315_10130183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2346 | Open in IMG/M |
3300032073|Ga0315315_10347240 | Not Available | 1381 | Open in IMG/M |
3300032820|Ga0310342_103321756 | Not Available | 533 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 32.77% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 16.81% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.61% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.88% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 5.88% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 5.04% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.04% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.52% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.52% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.68% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.68% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.68% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.84% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.84% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.84% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.84% |
Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 0.84% |
Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.84% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
3300005946 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A | Environmental | Open in IMG/M |
3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
3300007133 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', water-ds | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020266 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951) | Environmental | Open in IMG/M |
3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
3300020339 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX555929-ERR599080) | Environmental | Open in IMG/M |
3300020368 | Marine microbial communities from Tara Oceans - TARA_B100001027 (ERX556049-ERR599093) | Environmental | Open in IMG/M |
3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
3300023229 | Saline water microbial communities from Ace Lake, Antarctica - #551 | Environmental | Open in IMG/M |
3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
3300026083 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A (SPAdes) | Environmental | Open in IMG/M |
3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
3300026517 | Seawater microbial communities from Monterey Bay, California, United States - 8D | Environmental | Open in IMG/M |
3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI20155J14468_100475761 | 3300001354 | Pelagic Marine | SKKWMKNFQRLKLDMEVGIDGMLVNETKKISFHTKEVPFI* |
JGI20155J14468_101083451 | 3300001354 | Pelagic Marine | MKNFLQLKLDMEVGIDGMLVNETKKISFHSKEVFTF* |
GOS2249_10055361 | 3300001951 | Marine | KEWMKNFQQLKQGMEVDIDGMLVNEKEKNIFNFKKISTF* |
GOS24894_101305691 | 3300002033 | Marine | LKRSMKNFQQLKLGMEAGIDGMLVNEAKKISVNIKKIFII |
GOS24894_102804141 | 3300002033 | Marine | LKRSMKNFQQLKLGMEAGIDGMLVNEAKKISVNIKKIFII* |
Ga0066377_102238081 | 3300005934 | Marine | MKSFLRLKLDMEVDIDGMLANETKKIGFNSKEVFNF* |
Ga0066378_100688861 | 3300005946 | Marine | KWMKNFQQLKQDTEADIDGMLVNEKKKTSFDFKEIFSF* |
Ga0066364_100052731 | 3300005960 | Marine | MRNFQQLKLDMEVGIDGMLANETKKISFYSKEVFN |
Ga0066370_100185021 | 3300005971 | Marine | KNFQRLKLDMEAGIDGMLVNETKKNSIYIKEIPTI* |
Ga0066370_103006882 | 3300005971 | Marine | SFLQLKLDMEAGIDGMLANETKKISFYFKEVFNI* |
Ga0075474_100490123 | 3300006025 | Aqueous | MKSFQQLKQDMEVGIDGMLVNEPKKNIIYIKKIFII* |
Ga0101666_10677242 | 3300007113 | Volcanic Co2 Seep Seawater | KNFLQLKLDMEVGIDGMLANETKKISFYSKEVLNN* |
Ga0101671_10088411 | 3300007133 | Volcanic Co2 Seeps | MKNFLQLKLDMEVGIDGMLANETKKISFYSKEVLNN* |
Ga0133547_101872526 | 3300010883 | Marine | NSPQLKQGMEVGIDGMLANEPKKISIYIKKIFII* |
Ga0160423_110735951 | 3300012920 | Surface Seawater | LMKSFLQLKLDMEVGIDGMLANETKKISFYTKEVFNN* |
Ga0163110_102014502 | 3300012928 | Surface Seawater | KNFQQLKQGMEVDIDGMLVNEKEKNIINFKKIFTL* |
Ga0181404_11510371 | 3300017717 | Seawater | MKNFQRLKLGMEVGIDGMLANETKKISIHTKKIFII |
Ga0181392_11010772 | 3300017749 | Seawater | MKNFQRLKLDMEVGIDGMLVNETKKISFYIKEVPFI |
Ga0181392_11223352 | 3300017749 | Seawater | KSFLQLKLDMEVGIDGMLANETKKISFHFKEVSPF |
Ga0181422_10228081 | 3300017762 | Seawater | KSLKRLMKSFLQLKLDMEVGIDGMLANETKKISFYSKEVFNY |
Ga0181422_10264241 | 3300017762 | Seawater | KSFLQLKLDMEVGIDGMLANETKKISFYSKEVFNI |
Ga0181422_11629171 | 3300017762 | Seawater | MKSFLQLKLDMEVGIDGMLANETKKISFYSKEVFN |
Ga0187217_11008752 | 3300017770 | Seawater | EKSSKKWMKNFQRLKLDMEVGIDGMLVNETKKISFYTKEVPLI |
Ga0181425_10277541 | 3300017771 | Seawater | MKNFQRLKLDMEVGIDGMLVNETKKISFYTKEVPLI |
Ga0181425_10702741 | 3300017771 | Seawater | MKNFQQLKQGMEVVIDGMLVNEKEKNILNFKKIFT |
Ga0181379_12735531 | 3300017783 | Seawater | MKSFQRLKLDMEVGIDGMLVNETKKFSFYIKEVPFI |
Ga0181424_100132053 | 3300017786 | Seawater | MKNFLQLKLGMEVGIDGMLVNEPKKISLYIKKIFI |
Ga0181424_100255971 | 3300017786 | Seawater | KSFLQLKLDMEVGIDGMLANETKKISFYSKEVFNY |
Ga0181424_101239921 | 3300017786 | Seawater | MKSFQRLKLDMEVGIDGMLVNETKKNSFYTKEVPLI |
Ga0181424_103462341 | 3300017786 | Seawater | MKNFLQLKLGMEAGIDGMLVNETKKIRLYFKKVFTF |
Ga0181424_103485461 | 3300017786 | Seawater | EFVKNSKKLMKNFLQLKQDTEVDIDGMLVNEKEKNIFNLKKVSTF |
Ga0181552_101634963 | 3300017824 | Salt Marsh | MKSFQQLKQDMEVGIDGMLVNEPKKNIIYIKKIFII |
Ga0181584_108418782 | 3300017949 | Salt Marsh | MINFLQLKLDMEVGIDGMLANETKKISFYSKEVLNN |
Ga0181607_105385951 | 3300017950 | Salt Marsh | KSFLQLKLDMEVGIDGMLANETKKISFYSKEVFNN |
Ga0181569_110281141 | 3300017986 | Salt Marsh | LMKSFLQLKLDMEVGIDGMLANETKKISFYSKEVFNN |
Ga0181570_100161941 | 3300020207 | Salt Marsh | MKNFLQLKLDMEVGIDGMLANETKKISFYSKEVLNN |
Ga0211519_10093043 | 3300020266 | Marine | KNFLQLKLDMEVGIDGMLANETKKISFYSKEVLNN |
Ga0211658_10935542 | 3300020274 | Marine | MKSFLQLKLDMEVGIDGMLANETKKISFYSKEVFNN |
Ga0211605_11150932 | 3300020339 | Marine | MKSFLQLKLDMEVGIDGMLANETKKISFYSKEVFNY |
Ga0211674_101003232 | 3300020368 | Marine | KNFLQLKLDMEVGIDGMLVNETKKISFHFKEVFTI |
Ga0211477_102700131 | 3300020374 | Marine | MKNFLQLKLDMEVGIDGMLVNETKKICFHFKEVFTF |
Ga0211476_101812722 | 3300020381 | Marine | SSRKLIIIFLQLKQDMEVDIDGMLVNETEKISINFKKVFII |
Ga0211686_100466403 | 3300020382 | Marine | MKNFLQLKLGTEVGIDGMLTKNEEKKIIINTKEIFTI |
Ga0211686_101522243 | 3300020382 | Marine | MKDFLQLKLGMEVGIGGMLVNEAKKIIIYIKKIST |
Ga0211675_101297102 | 3300020391 | Marine | KNFLQLKLDMEAGIDGMLVNETKKIRLHFKEVFTF |
Ga0211675_103041551 | 3300020391 | Marine | KNFQQLKQDMEVDIDGMLVNEKEKNIINFKKVSTF |
Ga0211687_100628641 | 3300020396 | Marine | MINFQQLKQGMEVGIDGMLVNEPKKFNIYIKKISII |
Ga0211687_103797152 | 3300020396 | Marine | MKNFLQLKLGMEVGIDGMLVNETKKNSFHFKEVPTF |
Ga0211636_102086153 | 3300020400 | Marine | KNFLQLKLDMEAGIDGMLVNETKKNSFYIKKVFTI |
Ga0211636_102802942 | 3300020400 | Marine | TKNFQQLKQGMEVDIDGMLVNEKEKNIINFKKIFTL |
Ga0211516_102002431 | 3300020413 | Marine | KSFQQLKQGMEVDIDGMLVNEKEKNILNFKKVLTF |
Ga0211523_101553201 | 3300020414 | Marine | MKSFLQLKLDMEVGIDGMLANETKKISFYFKEVFNNKPNS |
Ga0211512_103187202 | 3300020419 | Marine | LMKNFLQLKLDMEAGIDGMLANETKKISFYTKEVFNN |
Ga0211580_100044091 | 3300020420 | Marine | MKSFLQLKLDMEAGIDGMLANETKKISFYSKEVFN |
Ga0211518_103134871 | 3300020440 | Marine | MRSFLQLKLDMEAGIDGMLANETKKISFYSKEVFNY |
Ga0211518_105158771 | 3300020440 | Marine | MKNSLQLKHDTEVDIDGMLVNEKKKNNIDIKKVFI |
Ga0211695_103636622 | 3300020441 | Marine | MKNFLLLKLDMEVDIDGMLADEKKKNFIYTKKVLSF |
Ga0211638_103393542 | 3300020448 | Marine | MKNFLQLKLDMEAGIDGMLANETKKNSFYFKEVFNI |
Ga0211638_105083761 | 3300020448 | Marine | SKKSMKNSQQLKLGTEVDIDGMLVNEKKENILNTKKVFTF |
Ga0211641_104908591 | 3300020450 | Marine | MKNFLQLKLDMEAGIDGMLANETKKISFYFKEVFNN |
Ga0211473_104286982 | 3300020451 | Marine | ESEKNLKRSMKNFQRLKLGMEVGIDGMLANETKKISIYTKKIFII |
Ga0211473_106879381 | 3300020451 | Marine | KEKMKNFQQLKQDMEVDIDGMLVNEKEKNIINFKKVSTF |
Ga0211545_105290782 | 3300020452 | Marine | TINFLQLKLGMEAGIDGMLVNEQKKISIHIKKIFTI |
Ga0211548_102750232 | 3300020454 | Marine | KIFLQLKQGTEVDIDGMLVNEKKKIVLNIKKISTF |
Ga0211643_103047102 | 3300020457 | Marine | NFLQLKQGTEVVIDGMLVNNEAKKISIYFKKIFTI |
Ga0211643_105447772 | 3300020457 | Marine | KNFQQLKLDMEVGIDGMLVNETKKISIDLTKISII |
Ga0211514_101011241 | 3300020459 | Marine | IIFQQLKQDMEVDIDGMLVNETEKISINFKKIFII |
Ga0211676_101473362 | 3300020463 | Marine | KNFLQLKLDMEVGIDGMLVNETKKICFHFKEVFTI |
Ga0211640_102094841 | 3300020465 | Marine | MKSFLQLKLGMEAGIDGMLVNEAEKISINFTKVLV |
Ga0211475_100109717 | 3300020468 | Marine | KNFLRLKLGTEVGIDGMLVNETKKISIYTKKILII |
Ga0211475_103107832 | 3300020468 | Marine | MKSFLRLKLGMEVGIDGMLVNETKKIGIHIKKIFTI |
Ga0211577_102427803 | 3300020469 | Marine | MKNFQQLKLDMEVGIDGMLANETKKNNIYFKKVFTI |
Ga0211577_103323362 | 3300020469 | Marine | KNFQQLKLDTEVGIGGMLVNESKKNSIYIKEIFTI |
Ga0211577_103676542 | 3300020469 | Marine | KSFLQLKLDMEVGIDGMLANETKKICFYTKEVFNN |
Ga0211614_101018632 | 3300020471 | Marine | KNFLQLKQGMEVGIDGMLVNETKKISIYIKKIFII |
Ga0213867_11073951 | 3300021335 | Seawater | EKSLKKSMKNFLQLKLDMEVGIDGMLANETKKISFYSKEVFNN |
Ga0255766_103117611 | 3300023172 | Salt Marsh | LRKLMKNFQQLKQDMEVGIDGMLVNEPKKIILYTKEIFTI |
Ga0222661_10131322 | 3300023229 | Saline Water | NSKKLMINFQQLKQGMEVGIDGMLVNDPKKISIYIKKVFII |
(restricted) Ga0233438_102926591 | 3300024255 | Seawater | MKNFLQLKLDMEVGIDGMLVNETKKISFHFKEVFT |
(restricted) Ga0233444_100594073 | 3300024264 | Seawater | MKSFQQLKLGMEVGIDGMLVNETKKISFHFKEVSTFQFN |
(restricted) Ga0233444_100655461 | 3300024264 | Seawater | KNFQRLKLDMEVGIDGMLVNETKKISFYTKEVSLI |
Ga0209714_11701322 | 3300025822 | Pelagic Marine | MKNFLQLKLGMEVGIDGMLVNETKKISFHFKEVFTF |
Ga0209631_100178181 | 3300025890 | Pelagic Marine | MKSFQRLKLDMEVGIDGMLVNETKKISFYIKEVPF |
Ga0209335_100098241 | 3300025894 | Pelagic Marine | MKNFLQLKLGMEVGIDGMLVNEAKKISIYIKKISII |
Ga0209335_102914331 | 3300025894 | Pelagic Marine | KKWMKNFQRLKLDMEVGIDGMLVNETKKISFYTKEVPLI |
Ga0209425_100635173 | 3300025897 | Pelagic Marine | SSKKWMKNFQRLKLDMEVGIDGMLVNETKKISFHTKEVPFI |
Ga0209425_105067082 | 3300025897 | Pelagic Marine | KNLRKLMINFQQLKLDMEVDIDGMLVNEQEKISIYTKEILII |
Ga0208878_11121951 | 3300026083 | Marine | MRNFLQLKQDTEAGIDGMLVNETKKNSIYIKKIFTLQFNNI |
Ga0208880_10797411 | 3300026085 | Marine | SLKRLMKSFLQLKLDMEVGIDGMLANETKKISFYTKEVFNN |
Ga0207993_10085143 | 3300026270 | Marine | MKNFLQLKLDMEVGIDGMLANETKKISFYSKEVLN |
Ga0207993_11267652 | 3300026270 | Marine | MKSFLQLKLDMEVGIDGMLANETKKISFYSKEVLN |
Ga0208764_105064742 | 3300026321 | Marine | MKSFLQLKLDMEVGIDGMLVNETKKISIYTKKISII |
Ga0228607_11202842 | 3300026517 | Seawater | EKSSKKSMKSFLQLKLDMEVGIDGMLVNETKKISFHSKEVFTI |
Ga0208973_10895232 | 3300027506 | Marine | KNFQRLKLDMEVGIDGMLVNETKKISFYIKEVPFI |
Ga0209192_102046822 | 3300027752 | Marine | SKKLMTNFQQLKQGMEVGIDGMLVNEPKKISIYIKKIFII |
Ga0209709_100019615 | 3300027779 | Marine | MKNFLQLKLGTEVGIDGMLTKNEEKKIIINTKKIFTI |
Ga0209502_100230621 | 3300027780 | Marine | MKSFQQLKHDMEVGIDGMLANEPKKNIIYITKIFTI |
Ga0209711_100592533 | 3300027788 | Marine | LKKLMRSFQQLKHGMEVGIDGMLVNEPKKINIYITKIFTI |
Ga0209711_101717972 | 3300027788 | Marine | RGLIISFQQLKQGMEVGIDGMLVNEPKKITIHIKKIFTF |
Ga0209091_102420961 | 3300027801 | Marine | KNFQQLKLDMEVDIDGTLVNEKKKISIFIKKISFF |
Ga0209090_105876342 | 3300027813 | Marine | MKNFQQLKLDMEVGIDGMLDNEAKKISIYIKKIFII |
Ga0257110_10868721 | 3300028197 | Marine | MKSFQRLKLDMEVGIDGMLVNETKKISFYIKEVPFI |
Ga0308025_12234221 | 3300031143 | Marine | WMISFQQLKHDMEVGIDGMLVNEPKKTTIYITKIFTI |
Ga0307488_102179523 | 3300031519 | Sackhole Brine | MKNFLQLKQDMEVDIDGMLVNEAKKTIINIKKVFTF |
Ga0308019_100329823 | 3300031598 | Marine | KRLMKSFQQLKHDMEVGIDGMLANEPKKNIIYITKIFTI |
Ga0308019_102971982 | 3300031598 | Marine | KSLQQLKQDTEVVTGGMLADEEKKISIYIKKISTI |
Ga0308007_102043792 | 3300031599 | Marine | MTSFQQLKHDMEVGIDGMLVNEPKKITIYITKIFT |
Ga0307986_102139461 | 3300031659 | Marine | MINFQQLKHGMEVGIDGMLVNEPKKITIYITKIFTI |
Ga0307995_10235843 | 3300031696 | Marine | MKNFQQLKQGMEVGIDGMLVNEPKKISIYIKKVFII |
Ga0307995_11697051 | 3300031696 | Marine | LMKNFQQLKQGMEVGIDGMLVNESKKISIYIKKVFII |
Ga0315331_102261032 | 3300031774 | Seawater | MINFLQLKLDMEVGIDGMLVNETKKISIYIKKIFII |
Ga0310344_100389263 | 3300032006 | Seawater | MKSFLQLKLDMEVGIDGMLVNNEKKKISIHTKKISII |
Ga0310344_111814661 | 3300032006 | Seawater | MRSFLQLKLGMEAGIDGMLVNEAEKISLNIKKIFI |
Ga0315316_100381491 | 3300032011 | Seawater | KRLMKSFLQLKLDMEVGIDGMLANETKKISFYSKEVFNY |
Ga0315316_105429292 | 3300032011 | Seawater | TKNFLQLKLDMEVGIDGMLANETKKISFYSKEVFNN |
Ga0315329_103064891 | 3300032048 | Seawater | MKSFLQLKLDMEVGIDGMLVNERKKISIYIKKISI |
Ga0315315_101301831 | 3300032073 | Seawater | MKSFLQLKLDMEVGIDGMLANETKKISFHSKEVSNN |
Ga0315315_103472402 | 3300032073 | Seawater | EKSLKRLMKSFLQLKLDMEVGIDGMLANETKKISFYSKEVFNY |
Ga0310342_1033217562 | 3300032820 | Seawater | MKSFLQLKLDMEVGIDGMLANETKKISFYFKEVFNNKLN |
⦗Top⦘ |