| Basic Information | |
|---|---|
| Family ID | F074421 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MIGQYEKKYQEALGQLNRLGTGLERGDAYRDGQAKIKVNP |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.57 % |
| % of genes near scaffold ends (potentially truncated) | 89.92 % |
| % of genes from short scaffolds (< 2000 bps) | 80.67 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.706 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (21.849 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.790 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (77.311 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 0.84 |
| PF07460 | NUMOD3 | 0.84 |
| PF00041 | fn3 | 0.84 |
| PF13392 | HNH_3 | 0.84 |
| PF09636 | XkdW | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.71 % |
| All Organisms | root | All Organisms | 35.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 21.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 7.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.36% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 3.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.52% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.52% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.68% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.84% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.84% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.84% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.84% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.84% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.84% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001239 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002201 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003814 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004687 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004688 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Aug07 (version 2) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300007522 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012689 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES065 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020688 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020725 | Freshwater microbial communities from Trout Bog Lake, WI - 23OCT2008 epilimnion | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025418 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025449 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029442 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM13 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| 3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TBL_comb47_HYPODRAFT_100801394 | 3300000553 | Freshwater | QDMVAYYEKMYQEALAQLNRLGTGLERGDAYRNGQARIMVKQ* |
| Draft_101003091 | 3300001239 | Hydrocarbon Resource Environments | GEVDMMGAYDKKYQEALGQLNRLGTGLERNDAYRVGQASIKVNP* |
| JGI24028J26656_10009583 | 3300002091 | Lentic | MVMYDAKYKEALALAKRLGDGLERGDAYRDGQTKIKVTT* |
| JGI24218J26658_10260521 | 3300002092 | Lentic | ETKYQEAVMQLNRLGTGLERGDAYRDGQARIKVSP* |
| JGI24219J26650_10236973 | 3300002098 | Lentic | AYQYMKGENDLMVMYDAKYKEALALAKRLGDGLERGDAYRDGQTKIKVTT* |
| metazooDRAFT_12720773 | 3300002201 | Lake | YEQKYQEALQQLVRLGDGLERGDAYRDGQARIKVPT* |
| JGI24890J29729_10384313 | 3300002307 | Lentic | LFMKGEQDLIGYYETKYQEAVMQLNRLGTGLERGDAYRDGQARIKVNP* |
| B570J29032_1092821223 | 3300002408 | Freshwater | KQFQDALQQLNRLGTGLERGDAYRDGQAKIKVNP* |
| B570J40625_1012915491 | 3300002835 | Freshwater | GEADMIGQYEKKYQEAMGQLNRLGTGLERGDAYRDGQAKIKVSP* |
| Ga0007877_10260991 | 3300003814 | Freshwater | IKYYEDKYQEAMAEMKRLGDGLERGDAYRDGQTKILVKT* |
| Ga0007829_101309131 | 3300004095 | Freshwater | MKGEQDMVAYYEKMYEEALAQLNRLGTGLERGDAYRNGQARIMVKQ* |
| Ga0007829_101420511 | 3300004095 | Freshwater | YEDKYAEALDLAKRLGDGLERGDAYRDGQTKLDVSGRRS* |
| Ga0065168_10679302 | 3300004684 | Freshwater | QDIIKYYEDKYQEAMAEMKRLGDGLERGDAYRDGQTKILVKT* |
| Ga0065177_10249133 | 3300004685 | Freshwater | DMVAYYEKMYEEALAQLNRLGTGLERGDAYRNGQARIMVKQ* |
| Ga0065174_10204953 | 3300004687 | Freshwater | LVQYYEQKYQEALAQLNRLGTGLERGDAYRDGQAKIQVNP* |
| Ga0065169_10115092 | 3300004688 | Freshwater | MLFQRQEPDVIKNYEEKYQEAIQQLSRLGTGLERGDAYRNGQARMKVNP* |
| Ga0078894_103387891 | 3300005662 | Freshwater Lake | AYIFLKGEADLMAVYKTKYDEAVAQLNRLGTGLERGDAYRDGQAKIRVNP* |
| Ga0078894_114143042 | 3300005662 | Freshwater Lake | YYEDKYTEALMQLNRLGTGLERGDAYRDGQARIPVNP* |
| Ga0007876_10174314 | 3300006071 | Freshwater | MKGEADMVKYYEDKYTEALAQLNRLGTGLERGDAYRNGQARIMVKQ* |
| Ga0007881_11608621 | 3300006072 | Freshwater | VAYYEKMYEEALAQLNRLGTGLERGDSYRDGQARIKVNP* |
| Ga0007806_11073892 | 3300006100 | Freshwater | QDIIKYYEDKFQEALGEMKRLGDGLERGDAYRDGQTKLKVNT* |
| Ga0007810_10375041 | 3300006101 | Freshwater | KYYEDKFQEALNEMKRLGDGLERGDAYRDGQTKLKVNT* |
| Ga0007857_11024851 | 3300006112 | Freshwater | FQRQEPDVIKNYEEKYQEAIQQLSRLGTGLERGDAYRNGQARMKVNP* |
| Ga0007857_11024901 | 3300006112 | Freshwater | FQRQEPDVIKNYEEKYQEAIQQLSRLGTGLERGDAYRNGQAKIKVNP* |
| Ga0007859_10057584 | 3300006118 | Freshwater | EEKYQEAIQQLNRLGTGLERGDAYRNGQAKIKVNP* |
| Ga0105053_102068491 | 3300007522 | Freshwater | YYEKKFQDAVAQLNRLGTGLERGDAYRDGQAKIKVSP* |
| Ga0105052_104328912 | 3300007523 | Freshwater | EADLLQLYDAKYKEALTLAIRLGTGLERGDSYRDGQAKIKVTT* |
| Ga0105051_108241962 | 3300007722 | Freshwater | MKSEADIMGFIQGKYQEALGLAKRLGDGLERGDAYRDGQTKLRVT* |
| Ga0108970_114711082 | 3300008055 | Estuary | AAYETKFKEALMQLKRLGDGLERGDAYRDGQVKYKVS* |
| Ga0114355_12046552 | 3300008120 | Freshwater, Plankton | TAQYEKKYQEAMGQLNRLGTGLERGDAYRDGQAKIKVMP* |
| Ga0114876_11569521 | 3300008448 | Freshwater Lake | NYEDKYQEAVQQLKRLGDGLERGDAYRDGQTKLRVNS* |
| Ga0114973_107282051 | 3300009068 | Freshwater Lake | QKRYDEALAMAKRLGDGLERGDAYRDGQYKQKVI* |
| Ga0114980_103774401 | 3300009152 | Freshwater Lake | DLVKYYEDKYTEALAQLNRLGSGLERGDAYRDGQYRIGQVKP* |
| Ga0114963_100210456 | 3300009154 | Freshwater Lake | LFMKGEQDLIGYYETKYQEAMQQLNRLGTGLERGDAYRDGQAKIKVNP* |
| Ga0114963_106676151 | 3300009154 | Freshwater Lake | QKFTEAVALAKRLGDGLERGDAYRDGQTKLNVSGPNS* |
| Ga0114977_101935904 | 3300009158 | Freshwater Lake | MKGEQDMMAYYEKKFQDALMQLKRLGDGLERGDAYRDGQAKYKVS* |
| Ga0114977_104346643 | 3300009158 | Freshwater Lake | FMKGETDLVKYYEDKYNEALAQLNRLGSGLERGDAYRDGQYRIGQVKP* |
| Ga0114981_101837801 | 3300009160 | Freshwater Lake | IGYYEQKFTEAVALAKRLGDGLERGDAYRDGQTKLNVSGPNS* |
| Ga0114975_102425711 | 3300009164 | Freshwater Lake | TLYNSKYNEALAQLNRLGTGLERGDAYRDGQARIKVNP* |
| Ga0114975_104920291 | 3300009164 | Freshwater Lake | TYYEKMFQDAMGQLNRLGTGLERGDAYRDGQAKIKVNP* |
| Ga0105102_109024693 | 3300009165 | Freshwater Sediment | YEKQFQEALAQLNRLGTGLERGDAYRDGQAKIKVNP* |
| Ga0105104_109624752 | 3300009168 | Freshwater Sediment | MVTYYEKQFQDAMAQLNRLGTGLERGDAYRDGQAKIKVIP* |
| Ga0105097_105398731 | 3300009169 | Freshwater Sediment | YEGKYKEAVGQLNRLGTGLERGDAYRDGQARIKVNP* |
| Ga0114959_1000547715 | 3300009182 | Freshwater Lake | QDLIGYYETKYQEAMQQLNRLGTGLERGDAYRDGQAKIKVNP* |
| Ga0114959_105114211 | 3300009182 | Freshwater Lake | MKGETDIIALYDTKYKEALALAKRLGDGLERGDAYRDGQAKIQVT* |
| Ga0114958_103966873 | 3300009684 | Freshwater Lake | KGEADMVAQYEKKYQDALAQLIRLGSAMEHGDAYRKGEAVR* |
| Ga0114964_104482302 | 3300010157 | Freshwater Lake | MKGEADMVAQYEKKYQDALAQLIRLGSAMEHGDAYRKGEAVR* |
| Ga0114967_1001108110 | 3300010160 | Freshwater Lake | EDKYTEALMQLNRLGTGLERGDAYRDGQAKIKVNP* |
| Ga0136644_101041915 | 3300010334 | Freshwater Lake | EQDMVTYYEKMYQDAVGQLNRLGTGLERGDAYRDGQAKIKVNP* |
| Ga0129333_110657241 | 3300010354 | Freshwater To Marine Saline Gradient | MKGEQDVMAFYGQKYAEALQQLTRLGDGLERGDAYREGQPRIKVTT* |
| Ga0157210_10004121 | 3300012665 | Freshwater | GEADLMAAYEKKYQDAIAQLNRLGTGLERGDAYRDGQAKIKVNP* |
| Ga0157565_10578791 | 3300012689 | Freshwater | DLISYYEQKYNEALSQLNRLGTGLERGDSYRDGQARIKQVNP* |
| Ga0164292_107732702 | 3300013005 | Freshwater | GYYQQKYEEGIKQLKRLGDGLERGDAYRDGQFKMKVTS* |
| Ga0164297_100354164 | 3300013094 | Freshwater | IKYYEDKFQEAMAQIKRLGDGLDRGDAYRDGQTILKVKS* |
| Ga0164297_101019741 | 3300013094 | Freshwater | IFMKGETDMVKYYEDKYTEALAQLNRLGTGLERGDAYRNGQARIMVKQ* |
| Ga0164297_103947002 | 3300013094 | Freshwater | YEDKYQEALAEMKRLGDGLERGDAYRDGQTKILVKT* |
| Ga0170791_129087573 | 3300013295 | Freshwater | DVYTAYQKRYDEALAMAKRLGDGLERGDAYRDGQYKQKVI* |
| Ga0177922_100080892 | 3300013372 | Freshwater | VMGFYELKYKEALALAKRLGDGLERGDAYRDGQTKIKVTT* |
| Ga0134316_10259762 | 3300014960 | Surface Water | YTYMKGEADMLAAYQAKYNEALQQLNRLGTGLERGDAYRDGQAKIRVNP* |
| Ga0181338_10164043 | 3300015050 | Freshwater Lake | DIMAFYNAKYQEALGLAKRLGDGLERGDAYRDGQTKIRVTT* |
| Ga0181344_10050869 | 3300017754 | Freshwater Lake | AYETKFKEALMQLKRLGDGLERGDAYRDGQAKYKVS |
| Ga0181344_10058136 | 3300017754 | Freshwater Lake | YYEDKYTEALMQLNRLGTGLERGDAYRDGQARIPVNP |
| Ga0181344_10188425 | 3300017754 | Freshwater Lake | KGEQDMVAYYEKKFQDALMQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0181344_10879853 | 3300017754 | Freshwater Lake | AMREAILFQKGEQDLVTYYEKQFQEALQQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0181356_11274704 | 3300017761 | Freshwater Lake | LYNGKYQEAIALAKRLGDGLERGDAYRDGQTKLRITT |
| Ga0181343_11001561 | 3300017766 | Freshwater Lake | GAMLEAYVFLKGEQDLMLVYKAKYDEAMGQLNRLGTGLERGDAYRDGQAKIKVMP |
| Ga0181343_11551272 | 3300017766 | Freshwater Lake | DLIAVYEKKYQDALGQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0181357_12933952 | 3300017777 | Freshwater Lake | GEQDMVTYYEKQFQNAMEQLNRLGTGLERGDAYRDGQARIPVNP |
| Ga0181355_12351023 | 3300017785 | Freshwater Lake | YEKKYQDALMQLNRLGTGLERGDAYRDGQAKIRVNP |
| Ga0194134_103591212 | 3300020179 | Freshwater Lake | LLALYDGKYKEAMMQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0194120_104834741 | 3300020198 | Freshwater Lake | YDGKYKEAMMQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0211731_103289112 | 3300020205 | Freshwater | SVYNTKYNDSLMQLNRLGTGLERGDAYRDGQAKIAVNP |
| Ga0208235_10189173 | 3300020530 | Freshwater | FQKGEQDMVAYYEKQFQDALQQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0214239_1020181 | 3300020688 | Freshwater | MVAYYEKMYQEALAQLNRLGTGLERGDAYRDGQARIKVNP |
| Ga0214239_1255731 | 3300020688 | Freshwater | YYQKMYEEALAQLNRLGTGLERGDAYRNGQARIMVKQ |
| Ga0214200_10233781 | 3300020725 | Freshwater | QEPDVIKNYEEKYQEAIQQLNRLGTGLERGDAYRNGQARMKVNP |
| Ga0212024_10664032 | 3300022065 | Aqueous | KGEQDVMAFYDAKYKEALGLAKRLGDGMERGDAYRDGQVKIKVT |
| Ga0228702_11411561 | 3300022748 | Freshwater | EVDLIQNVETKYQEAMMQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0255165_10117661 | 3300024357 | Freshwater | YVFLKGETDLMAVYKAKYDEAMSQLNRLGTGLERGDAYRDGQAKIKVMP |
| Ga0208382_10041211 | 3300025369 | Freshwater | GEQDMVTYYEKMYQEAIQQIIRLGAGLERGDAYRDGQFRIGQVKP |
| Ga0208250_10509951 | 3300025383 | Freshwater | IIKYYEDKYQEAIAEMKRLGDGLERGDAYRDGQTKLMVKT |
| Ga0208251_10247251 | 3300025398 | Freshwater | YYEKMYQEAIQQIIRLGAGLERGDAYRDGQFRIGQVKP |
| Ga0208251_10263173 | 3300025398 | Freshwater | KYYEDKFQEALNEMKRLGDGLERGDAYRDGQTKLKVNT |
| Ga0208251_10549911 | 3300025398 | Freshwater | YEDKYTEALAQLNRLGTGLERGDAYRNGQARIMVKQ |
| Ga0208378_10047781 | 3300025407 | Freshwater | IKYYEDKYQEAIAEMKRLGDGLERGDAYRDGQTKLMVKT |
| Ga0208253_10755682 | 3300025418 | Freshwater | MLFQRQEPDVIKNYEEKYQEAIQQLSRLGTGLERGDAYRNGQARMKVNP |
| Ga0208253_10756632 | 3300025418 | Freshwater | MLFQRQEPDVIKNYEEKYQEAIQQLSRLGTGLERGDAYRNGQAKIKVNP |
| Ga0208424_10393061 | 3300025445 | Aqueous | LISYYEQKFQEALMQLNRLGTGLERGDAYRDGQARIGQVNP |
| Ga0208106_10291933 | 3300025449 | Freshwater | LVQYYEQKYQEALAQLNRLGTGLERGDAYRDGQAKIQVNP |
| Ga0208741_100147331 | 3300025723 | Freshwater | YEDKYAEALDLAKRLGDGLERGDAYRDGQTKLDVSGRRS |
| Ga0208872_11479841 | 3300025838 | Freshwater | YYEKMYTEAMSQLNRLGTGLERGDAYRDGQAKIKVSQ |
| Ga0209356_11244673 | 3300027644 | Freshwater Lake | ITYYEKMYQDALGQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0209704_11415102 | 3300027693 | Freshwater Sediment | LLYGALREAYLFQKGEQDLITNVEAKYNEALQQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0209355_12335143 | 3300027744 | Freshwater Lake | KGEQDMMALYNGKYQEAIALAKRLGDGLERGDAYRDGQTKLRITT |
| Ga0209189_10723385 | 3300027747 | Freshwater Lake | EQDMVTYYEKMYQDAVGQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0209829_100939035 | 3300027777 | Freshwater Lake | IALYDGKYKEALALAKRLGDGLERGDAYRDGQAKIQVT |
| Ga0209354_101341413 | 3300027808 | Freshwater Lake | AFYNAKYQEALGLAKRLGDGLERGDAYRDGQTKIRVTT |
| Ga0209777_106966933 | 3300027896 | Freshwater Lake Sediment | QKMYEEALAQLNRLGTGLERGDAYRDGQARIKVNP |
| Ga0209777_107629413 | 3300027896 | Freshwater Lake Sediment | EDKYQEAISEMKRLGDGLERGDAYRDGQTKLMVKS |
| Ga0209777_109999661 | 3300027896 | Freshwater Lake Sediment | MYNTKYQEAMQQLNRLGTGLERQDAYRSGQARIKVNP |
| Ga0247723_10905291 | 3300028025 | Deep Subsurface Sediment | DIMAFYEKKFQDALAQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0304729_12673371 | 3300028392 | Freshwater Lake | DMVALYNGKYMEALALAKRLGDGLERGDAYRDGQTKIKVTT |
| Ga0304728_12599642 | 3300028393 | Freshwater Lake | YMKGETDLLVAYKAKYDEAMQQLNRLGTGLERNDAYRVGQASIKVNP |
| Ga0239579_10400111 | 3300029442 | Freshwater Lake | YEKMYTEAMSQLNRLGTGLERNDAYRAGQASIKVNP |
| Ga0307376_109578172 | 3300031578 | Soil | SLREAVIFQKGEQDMVAYYEKMYQEALQQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0315291_110731083 | 3300031707 | Sediment | YEQKYTEAIGQLTRLVSGLERGDAYRDGQTKIPAKGL |
| Ga0316219_12052923 | 3300031759 | Freshwater | YDAKYKEALQMAKRMGDGLERGDAYRDTQAKIKVT |
| Ga0315909_109105732 | 3300031857 | Freshwater | EQDMMSYYEKKYQDALMQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0316220_10997111 | 3300031884 | Freshwater | SYYEQKYNEALSQLNRLGTGLERGDSYRDGQARIKQVNP |
| Ga0315295_109032003 | 3300032156 | Sediment | MKGEQDMMVLYEGKYKEALSLAKRLGDGLERGDSYRDGQVKIKVT |
| Ga0316225_11084511 | 3300032675 | Freshwater | EADLVKYYEDKYQEAVAQLKRLGDGLERGDAYRDGQTKIMVKT |
| Ga0316227_10654724 | 3300032677 | Freshwater | MYYEDKYTEALSQLNRLGTGLERGDAYRDGQARIKVSP |
| Ga0316227_13139921 | 3300032677 | Freshwater | EADMVKYYEEKYQEAMQQLNRLGTGLERGDAYRNGQARIMVKQ |
| Ga0316231_12130631 | 3300032722 | Freshwater | YEDKFQEALGEIKRLGDGLERGDAYRDGQTKLKVNT |
| Ga0334996_0037579_38_160 | 3300033994 | Freshwater | MMAVYEGKYKEAVGQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0334996_0203881_912_1034 | 3300033994 | Freshwater | MIGQYEKKYQEALGQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0335031_0124174_2_145 | 3300034104 | Freshwater | FLKGEVDLIAQYDKKYQEALGQLNRLGTGLERGDAYRDGQAKIKVNP |
| Ga0335066_0512693_47_187 | 3300034112 | Freshwater | MKGEADMMAAYEKKYQDALGQLNRLGTGLERGDAYRDGQAKIKVVQ |
| Ga0335049_0878350_2_112 | 3300034272 | Freshwater | YYEKKFQDALMQLKRLGDGLERGDAYRDGQAKYKVS |
| ⦗Top⦘ |