 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F074378 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSEKEAGQVLTSENAAEFYANRLGLADRADDVAVEETPEPS |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 96.91 % |
| % of genes near scaffold ends (potentially truncated) | 81.51 % |
| % of genes from short scaffolds (< 2000 bps) | 67.23 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (75.630 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (29.412 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.672 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (86.555 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.74% β-sheet: 0.00% Coil/Unstructured: 78.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF16510 | P22_portal | 25.21 |
| PF04466 | Terminase_3 | 1.68 |
| PF00149 | Metallophos | 0.84 |
| PF00166 | Cpn10 | 0.84 |
| PF02195 | ParBc | 0.84 |
| PF11651 | P22_CoatProtein | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 1.68 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 75.63 % |
| All Organisms | root | All Organisms | 24.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 29.41% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 10.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 7.56% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.36% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.52% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.68% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.84% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.84% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.84% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.84% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.84% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.84% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.84% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.84% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000162 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300001844 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002199 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013 | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004687 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004691 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (version 2) | Environmental | Open in IMG/M |
| 3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300020723 | Freshwater microbial communities from Trout Bog Lake, WI - 23JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021115 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021121 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021132 | Freshwater microbial communities from Trout Bog Lake, WI - 25AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025416 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025428 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028176 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_40m | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009H_0039693 | 3300000162 | Freshwater | MSESKATVLTSENSEAFYANRLGLADEAPVEAVVEETPTEPTEEAEE |
| RCM35_10007731 | 3300001844 | Marine Plankton | MSENQAGQVLTNENAAEFYAQKLGLAQAEPSPVAVEENTSTEP* |
| JGI24219J26650_10070192 | 3300002098 | Lentic | MSEKEASNVLTSENSGEFYANKLGLADETHTESIVPVEPQTSEPDAKEEP |
| JGI24219J26650_10354723 | 3300002098 | Lentic | MSEKEASQVLTSENMAEFYANRLGLADQTDDVAVEETPEP |
| metazooDRAFT_12535632 | 3300002199 | Lake | MSENQASQILTSENAAEFYAQKLGLAQANEEPAAVEAQALAEP |
| JGI26470J50227_10256432 | 3300003375 | Freshwater | MSEKEASQVLTSENSAEFYSNRLGLADTTPVEAVPTEPTEV |
| Ga0007850_10015541 | 3300003783 | Freshwater | MSEKEAGSVVTSANAEEFYANRLGLAEEAPVEAVVEETAEPAEEANDQSE |
| Ga0007811_10022671 | 3300003787 | Freshwater | MSDKEASQVLTSENSGEFYAQKLGLAKEEAVEAAEPTEPQQS |
| Ga0007863_10029022 | 3300003820 | Freshwater | MSEREAGQVLTSENSEAFYANKLGLAAEAPAEAEVEQKVQEETPSEPVEE |
| Ga0007863_10197971 | 3300003820 | Freshwater | MSENQAGQVLTSENAAEFYAQKLGLAQANSEPVAVVEETPTE |
| Ga0031655_102061081 | 3300003852 | Freshwater Lake Sediment | MSEXEAGQVLTSENSGXFYANRLGLAEEAPVEAVVEETPTEPXE |
| Ga0031655_102365413 | 3300003852 | Freshwater Lake Sediment | MSEKEAGQVLTSENAAEFYANRLGLADRADDVAVEETPEPXPEA |
| Ga0066177_101276281 | 3300004096 | Freshwater Lake | MSEKEAGSVVTSANAEEFYANRLGLAEEAPVEAVEEKSAEPTEEANDQSE |
| Ga0065861_10283982 | 3300004448 | Marine | MSEKEASSVLTSENSAEFYANKLNLADRDDDVAVEEAPEPS |
| Ga0065168_10420382 | 3300004684 | Freshwater | MSEKEASQVLTSENSAEFYSNRLGLADTTPVEAVHTEPTEVQEQNEPVAEE |
| Ga0065174_10098131 | 3300004687 | Freshwater | MSEQQVANVLTSENSEAFYAQKLGLAEQAPVEAVVEETPT |
| Ga0065176_10313491 | 3300004691 | Freshwater | MSEKEASQVLTSENSGDFYAQKLGLANETPVEAAEPTEPPKSEPE |
| Ga0065167_10598912 | 3300004693 | Freshwater | MSDKEASQVLTSDNSAEFYATRLGLADKPEVEAVQTEPTEEVERSEPVIEE |
| Ga0007809_101071841 | 3300004807 | Freshwater | MSEQEKQVANVLTSENSEAFYANRLGLAEEAPVEAVVEETAEPTEEAIDQ |
| Ga0049081_100225651 | 3300005581 | Freshwater Lentic | MSEKEASQVLTSENSAEFYANRLGLADQPEVEAVQTE |
| Ga0007862_10164072 | 3300006108 | Freshwater | MSEREAGQVLTSENSEAFYANRLGLAEEAPVEAVVEETAEPTEEAIDQ |
| Ga0007857_10091932 | 3300006112 | Freshwater | MSENQAGQVLTSENAAEFYAQKLGLAQTESEPVAVVEETPTEP |
| Ga0007857_10571111 | 3300006112 | Freshwater | MSEREAGQVLTSENSEAFYANRLGLAEEAPVEAVVEETPTEPVEEAND |
| Ga0007824_10582341 | 3300006121 | Freshwater | MSEREAGQVLTSENSEAFYANRLGLAEEAPVEAVVEETPTEPTEEA |
| Ga0007805_10174142 | 3300006127 | Freshwater | MSENQAGQVLTSENAAEFYAQKLGLAQANSEPVAVVEETPTEPV |
| Ga0114340_10071419 | 3300008107 | Freshwater, Plankton | MSEKEASQVLTSENAAEFYANRLGLAESPAETEAVEETEPVAEDDQSEPK |
| Ga0114340_10476832 | 3300008107 | Freshwater, Plankton | MSEKEAGQVLTSENAAEFYANRLGLAESPAETEAVEETEPVAEDDQSEPK |
| Ga0114364_10546042 | 3300008267 | Freshwater, Plankton | MSDKEAGQVLTSENAAEFYANRLGLAESPAETEAVEETEPVAEDDQS |
| Ga0114962_100365201 | 3300009151 | Freshwater Lake | MSEKEAGHVLTSENSAEFYANRLGLAASDTDEAGVENTPSEPSED |
| Ga0114962_102706383 | 3300009151 | Freshwater Lake | MSEKEASQVLTSDNAAEFYANRLGLAESSEPVEAEKSEPTEVVEQSEPE |
| Ga0114963_104473461 | 3300009154 | Freshwater Lake | MSEKEAGHVLTSENSQEFYANRLGLADQPQVEAVQTEPTEEA |
| Ga0114979_103453422 | 3300009180 | Freshwater Lake | MSEKEAGQVLTSENAAEFYANRLGLAESPADTEAVEETPE |
| Ga0114959_105111052 | 3300009182 | Freshwater Lake | MSDKEAGQVLTSENAAEFYANRLGLADRADDVAVEETPEPVAEAEQSEPKEAEK |
| Ga0114974_102902141 | 3300009183 | Freshwater Lake | MSEKEAGNVITSDNSAEFYANRLGLADQPEVEAVQAEPTEVV |
| Ga0114974_105569812 | 3300009183 | Freshwater Lake | MSEKEAGSVLTSENSADFYANRLGLADREAPEAVVEQTPTEPVVEAEQSKPE |
| Ga0114971_101256732 | 3300009185 | Freshwater Lake | MSEKEASQVLTSDNAAEFYANRLGLAESPADVEAEKSERTKAVEQSEPETAEAE |
| Ga0114958_100896843 | 3300009684 | Freshwater Lake | MSEKEAGHVLTSENSQEFYANRLGLADQPQVEAVQTEPTE |
| Ga0114964_101513191 | 3300010157 | Freshwater Lake | MSEKEAGNVLTSENSAEFYANKLNLADRDEDVAVETEPLTETEQSESAAEQ |
| Ga0114964_103759321 | 3300010157 | Freshwater Lake | MSDKEASQVLTSENSAEFYANKLGLADQPEPEAVETEPE |
| Ga0133913_108442173 | 3300010885 | Freshwater Lake | MSEKEAGQVLTSENSQEFYANRLGLADQPEVEAVQAEPT |
| Ga0133913_125166363 | 3300010885 | Freshwater Lake | MSEKEASQVLTSENAAEFYANRLGLAESPADTEAVEETPEP |
| Ga0136642_11077552 | 3300013285 | Freshwater | MSDKEAGQVLTSDNSAEFYANRLGLADQPEVEAVQTEPTQEAERSEPVIEEK |
| Ga0177922_112920072 | 3300013372 | Freshwater | MSDKEAGQVLTSENSQEFYANRLGLADQPDAEAVQTEPAEEAERSEPVIEG |
| Ga0182021_121656812 | 3300014502 | Fen | MSEVKEAGSVLTSENSAEFYANKLGLADPAPTEAAEEA |
| Ga0181338_10362081 | 3300015050 | Freshwater Lake | MSDKEASQVLTSENAAEFYANRLGLAESPEGTEAVEETPEPESE |
| Ga0181363_10228642 | 3300017707 | Freshwater Lake | MSEKEASQVLTSENAAEFYANRLGLAESNSEPVAVEEAEPVAEEEQ |
| Ga0181352_10085243 | 3300017747 | Freshwater Lake | MSDVKEASNVLTSENSAEFYANKLGLADDAPTEAVVDESPAEPVQE |
| Ga0181344_11352821 | 3300017754 | Freshwater Lake | MSEKEAGQVLTSENAAEFYANRLGLAESPAESVAE |
| Ga0181344_12414332 | 3300017754 | Freshwater Lake | MSEKEAGSVVTSANAEEFYANRLGLAEEAPIEAVAETPKEEVT |
| Ga0181343_10966541 | 3300017766 | Freshwater Lake | MSEKNAGQVLTSENAAEFYANRLGFAESPAESVAEESSEP |
| Ga0181343_11102993 | 3300017766 | Freshwater Lake | MSDKEAGQVLTSENAAEFYANRLGLAESNSEPEAVEEA |
| Ga0214207_10041521 | 3300020716 | Freshwater | MSEQEKQVANVLTSENSEAFYANRLGLAEEAPVEAVVEETAEP |
| Ga0214207_10159891 | 3300020716 | Freshwater | MSESKATVLTSENSEAFYANRLGLADEAPVEAVVDENPTEPTEEAE |
| Ga0214207_10237993 | 3300020716 | Freshwater | MSEREAGQVLTSENSEAFYANRLGLAEEAPVEAVVEETAEP |
| Ga0214249_10250492 | 3300020723 | Freshwater | MSEQEKQVANVLTSENSEAFYANKLGLAEEAPVEAVVEETPTEP |
| Ga0214246_10051321 | 3300020727 | Freshwater | MSESKATVLTSENSEAFYANRLGLADEAPVEAVVDENPTEP |
| Ga0214172_10600692 | 3300020733 | Freshwater | MSEKEASSVLTSENSAEFYANKLGLADRNDDVAVED |
| Ga0214219_10084771 | 3300020735 | Freshwater | MSEQEKQVANVLTSENSEAFYANRLGLAEEAPVEAVVEETPTEPTEEA |
| Ga0214219_10145661 | 3300020735 | Freshwater | MAEKEAESVVTSNNAAEFYANKLGLADENEPPMAE |
| Ga0214219_10227123 | 3300020735 | Freshwater | MADVKEAESVVTSNNAAEFYANKLGLADENEPPMAE |
| Ga0214174_1062663 | 3300021115 | Freshwater | MSEKEASSVLTSENAAEFYANRLGLADQTDDVAVEAEPSTEVV |
| Ga0214173_1148651 | 3300021121 | Freshwater | MSEKEAGQVLTSENSGEFYANRLGLAEEAPVEAVVEETPTEPTEEANDQ |
| Ga0214206_10013751 | 3300021131 | Freshwater | MSEKEAGLVLTSENSGDFYANKLGLAEETPTEAIVPVEP |
| Ga0214206_10060961 | 3300021131 | Freshwater | MSEKEASLVLTSENSGDFYANKLGLAEETPTEAIVPVEP |
| Ga0214206_10102331 | 3300021131 | Freshwater | MSEREAGQVLTSENSEAFYANKLGLAEEAPVEAVVEETPTE |
| Ga0214206_10181842 | 3300021131 | Freshwater | MSEQEKQVANVLTSENSEAFYANKLGLAEEAPVEAVVEETPTE |
| Ga0214196_10552591 | 3300021132 | Freshwater | MSEKEASQVLTSENSAEFYSNRLGLADTTTVEAVPTEPTEVQ |
| Ga0214175_10118641 | 3300021133 | Freshwater | MSEKEASSVLTSENAAEFYANRLGLADQTDDVAVEAEPST |
| Ga0214167_10673061 | 3300021136 | Freshwater | MSEKEAGQVLTSENAAEFYANRLGLADRADDVAVEETPEPS |
| Ga0214165_11099472 | 3300021137 | Freshwater | MSEKEASSVLTSENSAEFYANKLGLADRNDDVAVEDTPEP |
| Ga0214164_10878232 | 3300021138 | Freshwater | MSEKEASQVLTSENSAEFYSNRLGLADTTTVEAVP |
| Ga0194059_10259022 | 3300021600 | Anoxic Zone Freshwater | MSDKEAGQVLTSENAAEFYANRLGLAESPADTEAVED |
| Ga0181351_10668271 | 3300022407 | Freshwater Lake | MSEKEASQVLTSENAAEFYANRLGLAESESEPVAVEEAEPEAEDE |
| Ga0212088_104962623 | 3300022555 | Freshwater Lake Hypolimnion | MSEKEASQVLTSENSAEFYSNRLGLADTTPVEAVPT |
| Ga0236341_10428662 | 3300022591 | Freshwater | MSDKEAGQVLTSENSADFYANKLGLATESEPLQTEVVEVKS |
| Ga0208504_10285812 | 3300025358 | Freshwater | MSEREAGQVLTSENSEAFYANRLGLAEEAPVEAVVEETPTEPTE |
| Ga0208382_10290981 | 3300025369 | Freshwater | MSEREAGQVLTSENSEAFYANRLGLAEEAPVEAVVEETPTE |
| Ga0208738_10096653 | 3300025379 | Freshwater | MSEKEAGQVLTSENAAEFYANRLGLADQTDDVAVDAEPSTEVV |
| Ga0207959_10420532 | 3300025387 | Freshwater | MSEKEAGQVLTSENAAEFYANRLGLANQTDDVAVETTPE |
| Ga0208257_10415021 | 3300025389 | Freshwater | MSEQEKQVANVLTSENSEAFYANKLGLAEEAPVEAV |
| Ga0208380_10110141 | 3300025392 | Freshwater | MSEKEASSVLTSENSGEFYAQKLGLAKEPETVAVEETPEPVAE |
| Ga0208874_10234311 | 3300025396 | Freshwater | MSEREAGQVLTSENSEAFYANKLGLAEEAPVEAVVEETPTEPVEEANDQSEPQPE |
| Ga0208251_10028141 | 3300025398 | Freshwater | MSEQEKQVANVLTSENSEAFYANRLGLAEEAPVEAVVEETP |
| Ga0208387_10375561 | 3300025400 | Freshwater | MSEKEAGHVLTSENAAEFYANRLGLANQTDDVAVETTPEPSPEVA |
| Ga0208877_10201322 | 3300025416 | Freshwater | MSSEREASSVLTSENSGEFYANKLGLATEAPTEAVETEPV |
| Ga0207958_10316851 | 3300025421 | Freshwater | MSEKEASSVLTSENSGEFYAQKLGLAKEPETVAVEETP |
| Ga0207958_10571181 | 3300025421 | Freshwater | MSEKEAGQVLTSENAAEFYANRLGLANQTDDVAVE |
| Ga0208746_10678941 | 3300025423 | Freshwater | MSEKEAGHVLTSENAAEFYANRLGLANQTDDVAVETT |
| Ga0208506_10323302 | 3300025428 | Freshwater | MSEKEASQVLTSENSGDFYAQKLGLANETPVEAAEPTEP |
| Ga0208103_10284321 | 3300025436 | Freshwater | MSEKEAGHVLTSENSAEFYANRLGLAASDTDEATVE |
| Ga0208379_10971022 | 3300025598 | Freshwater | MSEKEASSVLTSENSAEFYANKLGLADRNDDVAVEDSPEPSEVE |
| Ga0208741_100398861 | 3300025723 | Freshwater | MSEKEAGSVVTSANAEEFYANRLGLAEEAPVEAVVE |
| Ga0208104_10123291 | 3300025773 | Freshwater | MSDKEASQVLTSENSAEFYANKLGLADQPEPEAVE |
| Ga0208386_10147791 | 3300025781 | Freshwater | MSENQAGQVLTSENAAEFYAQKLGLAQANSEPVAVVEETPTEP |
| Ga0208258_10000631 | 3300025783 | Freshwater | MSEKEAGQVLTSENAAEFYANRLGLADQTDDVAVDAEPSTEVVENEPEVQ |
| Ga0209499_11413371 | 3300027712 | Freshwater Lake | MSEKEAGHVLTSENSQEFYANRLGLADQPQVEAVQTEPTEEAERSEPVED |
| Ga0209499_12630972 | 3300027712 | Freshwater Lake | MSDKEAGQVLTSENSAEFYANRLGLAASDTDEAGVENTPSEP |
| Ga0209189_11238002 | 3300027747 | Freshwater Lake | MSEKEAGHVLTSENSQEFYANRLGLADKPEVEAVQTEPTEEAERS |
| Ga0209084_11656273 | 3300027749 | Freshwater Lake | MSEKEASQVLTSDNAAEFYANRLGLAESPEPVEAE |
| Ga0209084_13629261 | 3300027749 | Freshwater Lake | MSEKEAGHILTSENSADFYANRLGLAASDTDEAGVENTPSE |
| Ga0209084_13716172 | 3300027749 | Freshwater Lake | MSEKEAGHVLTSENSAEFYANRLGLAASDADEAGVENTPSEPSEDTK |
| Ga0209354_103317832 | 3300027808 | Freshwater Lake | MSEKEAGSVVTSANAEEFYANKLGLAEEAPVEAVVEEKTAEPTEEATDQSE |
| Ga0209777_104307641 | 3300027896 | Freshwater Lake Sediment | MSEKEAGSVVTSANAEEFYANRLGLAEEAPVEAVVEETPTEPAE |
| Ga0209777_105030171 | 3300027896 | Freshwater Lake Sediment | MSEKEASSVLTSENSAEFYANKLGLADRNDDVAVEET |
| Ga0209777_106150613 | 3300027896 | Freshwater Lake Sediment | MSEKEAGQVLTSENSGEFYANRLGLAEEAPVEAVVEETPTEPT |
| Ga0209048_106134421 | 3300027902 | Freshwater Lake Sediment | MSEKEAGSVLTSENAAEFYANRLGLADEASETVAAKAEPDDADAQSEPIEAD |
| Ga0209401_12338062 | 3300027971 | Freshwater Lake | MSEKEAGNVLTSENSAEFYANKLNLADQNDDVAVDAEPSKESD |
| Ga0209299_11556442 | 3300027974 | Freshwater Lake | MSEKEAGQILTSENAAEFYANRLGLAESPADTEAVEETPEPVNEETQ |
| Ga0209299_11629772 | 3300027974 | Freshwater Lake | MSDKEAGQVLTSENAAEFYANRLGLAESPADTEAVE |
| Ga0268284_10892363 | 3300028176 | Saline Water | MSEKEAGSVLTSENAEQFYANRLGLADDVQDVAVVEETPAEPVETEEQ |
| Ga0304729_100036858 | 3300028392 | Freshwater Lake | MSEKEAGHILTSENSADFYANRLGLAASDTDEAGVENTPSEPPE |
| Ga0304728_12503742 | 3300028393 | Freshwater Lake | MSEKEASSVLTSENSAEFYANKLNLADRDDDVAVE |
| Ga0315293_103220013 | 3300031746 | Sediment | MSMSEATVLTSENSAEFYANKLGLADQPEVEAVATEPTEPT |
| Ga0315909_107759901 | 3300031857 | Freshwater | MSEKEAGSVITSANAEEFYANRLGLAEEAPIEAEV |
| Ga0315904_110170731 | 3300031951 | Freshwater | MSEKEAGQVLTSENAAEFYANRLGLAESPAETEAVEETEPVAEDD |
| Ga0315902_105806941 | 3300032093 | Freshwater | MSEKEAGQVLTSENAAEFYANRLGLAESPAETEAVEETEPVAEDDQSE |
| Ga0315903_111112711 | 3300032116 | Freshwater | MSEKEASQVLTSENSAEFYANRLGLADQPEVEAVQTEPTEE |
| Ga0316226_10116821 | 3300032562 | Freshwater | MSSEREASNVLTSENSGEFYANKLGLATEAPVEAVETEPT |
| Ga0335048_0617533_1_138 | 3300034356 | Freshwater | MSEKEAGSVVTSANAEEFYANRLGLAEEAPVEAVVEEKIAEPTEEA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |