Metagenome Family F074314

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F074314
Family Type	Metagenome
Number of Sequences	119
Average Sequence Length	41 residues
Representative Sequence	VIEQDEVHGDGGGHEMMMIKLNLEKKKEKNKNQEDQGKGI
Number of Associated Samples	62
Number of Associated Scaffolds	119

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	60.00 %
% of genes near scaffold ends (potentially truncated)	17.65 %
% of genes from short scaffolds (< 2000 bps)	96.64 %
Associated GOLD sequencing projects	62
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (94.958 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (92.437 % of family members)
Environment Ontology (ENVO)	Unclassified (93.277 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (93.277 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF14223	Retrotran_gag_2	0.84
PF00078	RVT_1	0.84

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
All Organisms	root	All Organisms	5.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
cellular organisms	root	All Organisms → cellular organisms	5.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	4.20 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	4.20 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	4.20 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	4.20 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4.20 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	3.36 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	3.36 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	3.36 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	3.36 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	3.36 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	3.36 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	3.36 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	3.36 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	3.36 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	3.36 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	1.68 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.84 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1.68 %
Pooideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae	0.84 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.68 %
Triticodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae	0.84 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.68 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.84 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	1.68 %
Triticinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	0.84 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	1.68 %
Triticinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	0.84 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.96 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1.68 %
Triticinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	0.84 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.84 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005840\|Ga0068870_10702764	Not Available	698	Open in IMG/M
3300009148\|Ga0105243_12011567	Not Available	612	Open in IMG/M
3300009176\|Ga0105242_11321826	Not Available	745	Open in IMG/M
3300013296\|Ga0157374_12375618	Not Available	557	Open in IMG/M
3300013297\|Ga0157378_11145925	Not Available	816	Open in IMG/M
3300013297\|Ga0157378_12453886	Not Available	573	Open in IMG/M
3300014969\|Ga0157376_11794671	Not Available	649	Open in IMG/M
3300015268\|Ga0182154_1027789	Not Available	660	Open in IMG/M
3300015268\|Ga0182154_1060844	Not Available	532	Open in IMG/M
3300015274\|Ga0182188_1020742	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	670	Open in IMG/M
3300015274\|Ga0182188_1025910	Not Available	632	Open in IMG/M
3300015274\|Ga0182188_1028344	Not Available	618	Open in IMG/M
3300015275\|Ga0182172_1050362	Not Available	570	Open in IMG/M
3300015275\|Ga0182172_1069246	Not Available	519	Open in IMG/M
3300015276\|Ga0182170_1007252	Not Available	964	Open in IMG/M
3300015276\|Ga0182170_1022132	Not Available	717	Open in IMG/M
3300015277\|Ga0182128_1076944	Not Available	508	Open in IMG/M
3300015279\|Ga0182174_1015277	Not Available	818	Open in IMG/M
3300015281\|Ga0182160_1059792	Not Available	556	Open in IMG/M
3300015281\|Ga0182160_1078204	Not Available	513	Open in IMG/M
3300015282\|Ga0182124_1013897	Not Available	822	Open in IMG/M
3300015283\|Ga0182156_1027162	Not Available	707	Open in IMG/M
3300015287\|Ga0182171_1039459	Not Available	637	Open in IMG/M
3300015287\|Ga0182171_1072175	Not Available	535	Open in IMG/M
3300015289\|Ga0182138_1019575	Not Available	773	Open in IMG/M
3300015289\|Ga0182138_1048461	Not Available	602	Open in IMG/M
3300015289\|Ga0182138_1066026	Not Available	551	Open in IMG/M
3300015291\|Ga0182125_1075287	Not Available	539	Open in IMG/M
3300015292\|Ga0182141_1063439	Not Available	567	Open in IMG/M
3300015292\|Ga0182141_1066610	Not Available	559	Open in IMG/M
3300015294\|Ga0182126_1022045	Not Available	770	Open in IMG/M
3300015294\|Ga0182126_1056940	Not Available	589	Open in IMG/M
3300015294\|Ga0182126_1072573	Not Available	547	Open in IMG/M
3300015295\|Ga0182175_1032179	Not Available	699	Open in IMG/M
3300015295\|Ga0182175_1089329	Not Available	518	Open in IMG/M
3300015296\|Ga0182157_1064537	Not Available	581	Open in IMG/M
3300015296\|Ga0182157_1069566	Not Available	568	Open in IMG/M
3300015298\|Ga0182106_1023047	Not Available	782	Open in IMG/M
3300015298\|Ga0182106_1047934	Not Available	635	Open in IMG/M
3300015299\|Ga0182107_1026856	Not Available	753	Open in IMG/M
3300015300\|Ga0182108_1043754	Not Available	660	Open in IMG/M
3300015300\|Ga0182108_1055692	Not Available	615	Open in IMG/M
3300015300\|Ga0182108_1104093	Not Available	506	Open in IMG/M
3300015300\|Ga0182108_1107370	Not Available	501	Open in IMG/M
3300015302\|Ga0182143_1053654	Not Available	616	Open in IMG/M
3300015302\|Ga0182143_1093874	Not Available	520	Open in IMG/M
3300015303\|Ga0182123_1081761	Not Available	532	Open in IMG/M
3300015304\|Ga0182112_1052539	Not Available	621	Open in IMG/M
3300015304\|Ga0182112_1103790	Not Available	505	Open in IMG/M
3300015305\|Ga0182158_1036183	Not Available	688	Open in IMG/M
3300015305\|Ga0182158_1077703	Not Available	551	Open in IMG/M
3300015308\|Ga0182142_1026081	Not Available	783	Open in IMG/M
3300015308\|Ga0182142_1082661	Not Available	558	Open in IMG/M
3300015308\|Ga0182142_1082783	Not Available	558	Open in IMG/M
3300015308\|Ga0182142_1083524	Not Available	556	Open in IMG/M
3300015321\|Ga0182127_1007379	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1153	Open in IMG/M
3300015321\|Ga0182127_1009332	Not Available	1080	Open in IMG/M
3300015321\|Ga0182127_1015437	Not Available	939	Open in IMG/M
3300015321\|Ga0182127_1103616	Not Available	534	Open in IMG/M
3300015323\|Ga0182129_1101534	Not Available	524	Open in IMG/M
3300015341\|Ga0182187_1138648	Not Available	576	Open in IMG/M
3300015342\|Ga0182109_1122793	Not Available	631	Open in IMG/M
3300015343\|Ga0182155_1131614	Not Available	614	Open in IMG/M
3300015343\|Ga0182155_1223271	Not Available	503	Open in IMG/M
3300015344\|Ga0182189_1078539	Not Available	747	Open in IMG/M
3300015344\|Ga0182189_1138808	Not Available	609	Open in IMG/M
3300015345\|Ga0182111_1041042	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	974	Open in IMG/M
3300015345\|Ga0182111_1135674	Not Available	632	Open in IMG/M
3300015345\|Ga0182111_1162366	Not Available	590	Open in IMG/M
3300015345\|Ga0182111_1169854	Not Available	580	Open in IMG/M
3300015346\|Ga0182139_1104421	Not Available	697	Open in IMG/M
3300015346\|Ga0182139_1139599	Not Available	626	Open in IMG/M
3300015347\|Ga0182177_1124418	Not Available	656	Open in IMG/M
3300015347\|Ga0182177_1198045	Not Available	550	Open in IMG/M
3300015351\|Ga0182161_1213622	Not Available	551	Open in IMG/M
3300015351\|Ga0182161_1230320	Not Available	534	Open in IMG/M
3300015351\|Ga0182161_1259575	Not Available	508	Open in IMG/M
3300015355\|Ga0182159_1349437	Not Available	503	Open in IMG/M
3300015361\|Ga0182145_1074719	Not Available	693	Open in IMG/M
3300015361\|Ga0182145_1180914	Not Available	515	Open in IMG/M
3300015361\|Ga0182145_1182053	Not Available	514	Open in IMG/M
3300017404\|Ga0182203_1081540	Not Available	631	Open in IMG/M
3300017404\|Ga0182203_1090795	Not Available	611	Open in IMG/M
3300017404\|Ga0182203_1125959	Not Available	549	Open in IMG/M
3300017404\|Ga0182203_1130676	Not Available	542	Open in IMG/M
3300017410\|Ga0182207_1054645	Not Available	742	Open in IMG/M
3300017411\|Ga0182208_1026614	Not Available	811	Open in IMG/M
3300017411\|Ga0182208_1106842	Not Available	535	Open in IMG/M
3300017413\|Ga0182222_1099523	Not Available	513	Open in IMG/M
3300017424\|Ga0182219_1054953	Not Available	672	Open in IMG/M
3300017424\|Ga0182219_1139841	Not Available	503	Open in IMG/M
3300017425\|Ga0182224_1105330	Not Available	583	Open in IMG/M
3300017425\|Ga0182224_1105793	Not Available	582	Open in IMG/M
3300017427\|Ga0182190_1037584	Not Available	828	Open in IMG/M
3300017427\|Ga0182190_1102199	Not Available	593	Open in IMG/M
3300017430\|Ga0182192_1019475	Not Available	1051	Open in IMG/M
3300017430\|Ga0182192_1034947	Not Available	867	Open in IMG/M
3300017430\|Ga0182192_1153301	Not Available	525	Open in IMG/M
3300017430\|Ga0182192_1157800	Not Available	519	Open in IMG/M
3300017433\|Ga0182206_1061851	Not Available	680	Open in IMG/M
3300017433\|Ga0182206_1062992	Not Available	676	Open in IMG/M
3300017436\|Ga0182209_1004624	Not Available	1463	Open in IMG/M
3300017438\|Ga0182191_1032131	Not Available	888	Open in IMG/M
3300017438\|Ga0182191_1044914	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	800	Open in IMG/M
3300017438\|Ga0182191_1099995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	617	Open in IMG/M
3300017438\|Ga0182191_1112194	Not Available	594	Open in IMG/M
3300017438\|Ga0182191_1126820	Not Available	570	Open in IMG/M
3300017442\|Ga0182221_1035618	Not Available	811	Open in IMG/M
3300017443\|Ga0182193_1071687	Not Available	710	Open in IMG/M
3300017680\|Ga0182233_1065847	Not Available	647	Open in IMG/M
3300017683\|Ga0182218_1045244	Not Available	730	Open in IMG/M
3300017684\|Ga0182225_1021095	Not Available	917	Open in IMG/M
3300017685\|Ga0182227_1048829	Not Available	750	Open in IMG/M
3300021060\|Ga0182232_1081456	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	526	Open in IMG/M
3300026023\|Ga0207677_11547697	Not Available	613	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	93.28%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.04%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.68%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	93.28%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.04%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.68%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	93.28%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.68%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	92.44%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.36%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.68%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.84%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068870_107027642	3300005840	Miscanthus Rhizosphere	VSEQGEVHGDEDGQVLMMIKPNLEKKKEKNKNREDQGKGIR*
Ga0105243_120115671	3300009148	Miscanthus Rhizosphere	VIEQDEVHGDGDGHVLMMIKLNLEKKKEKNKNRDDQGKGIR*
Ga0105242_113218261	3300009176	Miscanthus Rhizosphere	MEYGDEVHGDGDGHVLKMIKLNLEKMKEKNKNRDDQGKGI*
Ga0157374_123756181	3300013296	Miscanthus Rhizosphere	VIGQDEVHGDEDGHVLMMIKLNLEKNKEKNKNQENQGKGI*
Ga0157378_111459252	3300013297	Miscanthus Rhizosphere	VIEQNEVHGDGGGHEMMMIKLNLEKKKEKNKNQEDQGKGIR*
Ga0157378_124538861	3300013297	Miscanthus Rhizosphere	VIEQDEVHGDGGGHEMMMIKLNLEKKKEKNKNQEDQGKGI*
Ga0157376_117946711	3300014969	Miscanthus Rhizosphere	VIEQDEVHGDEGGHVLMMIKLNLNKKKEKNKNRDDQGKGIR*
Ga0182154_10277891	3300015268	Miscanthus Phyllosphere	VEHGHEVHGDGDGHMLKMIKLNLKKKKEKDKSQDDQERGIK*
Ga0182154_10608441	3300015268	Miscanthus Phyllosphere	VIEQNEVHGDGGGHEMMMIKLNLEKKKEKNKNQEDQDKGII*
Ga0182188_10207421	3300015274	Miscanthus Phyllosphere	VIEQDEVHGDEDGHVLMMIKLNLEKKKEKNKNRDQGKGIR
Ga0182188_10259101	3300015274	Miscanthus Phyllosphere	VEHGDEVHGDGDGHMLKMIKLNLEKKKEKNKNQDDQGRGIK*
Ga0182188_10283441	3300015274	Miscanthus Phyllosphere	VIEHGEVHGDEDGHVLMMIKLNLEKKKEKNKNRDDQGKGI*
Ga0182172_10503622	3300015275	Miscanthus Phyllosphere	VIEQDEVHGDEGGHVLMMIKLNLENKKEKNKNQEDQGKGI*
Ga0182172_10692461	3300015275	Miscanthus Phyllosphere	VIEQDEVHGVEGEYEMMMIKLNMEKKKEKNKNQGDQGKCIR*
Ga0182170_10072521	3300015276	Miscanthus Phyllosphere	VEHGDEVHRDGDGHMLKMIKLNLEKKKEKNKNRDDQGKGI*
Ga0182170_10221321	3300015276	Miscanthus Phyllosphere	VFEQDEVHGDEAGHEMKMIKLNVEKKKEKNKNQEDQGKGI*
Ga0182128_10769441	3300015277	Miscanthus Phyllosphere	VIEQDEVHGVKDGHEMMMIKLNLEKKKEKNKNREDQGKGIR*
Ga0182174_10152771	3300015279	Miscanthus Phyllosphere	VIEQDEVHGDEDGHVLMMIKLNLEKKKEKNKNREDQGKGI*
Ga0182160_10597921	3300015281	Miscanthus Phyllosphere	QDEVHGDEGGHVLMIIKVNLEKKKEKNKNQKDQGKGIR*
Ga0182160_10782041	3300015281	Miscanthus Phyllosphere	PIQVVEQDEVHGVKDGHEMMVIKIKLGKEERKKQKTK*
Ga0182124_10138971	3300015282	Miscanthus Phyllosphere	VIQVIEQDEVHGDEGGHEMKMIKLNLEKKKEKNKIQDDQGKGIR*
Ga0182156_10271621	3300015283	Miscanthus Phyllosphere	VIEQNEVHGDGGGHEMMMIKLNMEKKKEKNKNQEDQGKGIR*
Ga0182171_10394591	3300015287	Miscanthus Phyllosphere	VEHGDEVHGDGDGHILKMIKLNLEKKKEKNKNQEDQDKGII*
Ga0182171_10425271	3300015287	Miscanthus Phyllosphere	VSIRKGGPIQVIEQNEVHGDEGGHVLMMIKLSLENKKEKNINQEDQGKGIR*
Ga0182171_10721751	3300015287	Miscanthus Phyllosphere	VEHGHEVHGDGDGHMLKMIKFNLEKKKEKKQNQDNQGKGIR*
Ga0182138_10195751	3300015289	Miscanthus Phyllosphere	VIEQDEVHGVKDGHEMMMIKLNLEKKKEKNKNREDQGKGI*
Ga0182138_10484611	3300015289	Miscanthus Phyllosphere	VIEQDEVHGVEGGYEMMMIKLNLEKKKEKNKNRDDQGKGI*
Ga0182138_10660261	3300015289	Miscanthus Phyllosphere	VEHGDEVHGDGDGHMLKMINLNSENKKEKNKNRDDQGKGI*
Ga0182125_10752872	3300015291	Miscanthus Phyllosphere	VEHGNEVQGDEDGHVLMMIKPNLEKKKEKNKNQEDQGKDI*
Ga0182141_10634391	3300015292	Miscanthus Phyllosphere	VIEQDEVHGVEDGHEMMVIKLNLEKKKEKNKNQDDQGNGI*
Ga0182141_10666101	3300015292	Miscanthus Phyllosphere	VIEQDEVHGDEGGHVLMMIKLNMEKKKEKNKNQEVQGKGI*
Ga0182126_10220451	3300015294	Miscanthus Phyllosphere	VEHGDEVHRDGDGHLLKMIKLNMEKKKEKNKNRDDQGKGI*
Ga0182126_10569401	3300015294	Miscanthus Phyllosphere	MEQDEVHGVEDGHEMMMIMLNLEKKKEKQKNQEDQGKGI*
Ga0182126_10725731	3300015294	Miscanthus Phyllosphere	EVHGDGDGHVLKMIKLQLEKEKEKNKSKVHQGKGIK*
Ga0182175_10321792	3300015295	Miscanthus Phyllosphere	VEHGVVVHRDGDGHMLKMIKLNLEKKKEKNKNRDDQGK
Ga0182175_10893291	3300015295	Miscanthus Phyllosphere	VGAIQVFEQDGIHGDKGGHEIMMIKLNLEKKKEKQKPR*
Ga0182157_10645371	3300015296	Miscanthus Phyllosphere	DEVRGDEGIHEMMMIKLNLEMKKEKNKIQEDQGKGI*
Ga0182157_10695661	3300015296	Miscanthus Phyllosphere	VIEQDEVHGDEDGHMLMMIKLNLEKKKEKNKNRDDQGKGI*
Ga0182106_10230471	3300015298	Miscanthus Phyllosphere	WCNPSVEHSDEVHGDGDGHMLKMIKLNLKKKKEKNKNREDQGKGI*
Ga0182106_10479341	3300015298	Miscanthus Phyllosphere	VIEQNEVHGDGGGQEMMMIKLNLEKKKEKNKNQEDQGKGIR*
Ga0182107_10268562	3300015299	Miscanthus Phyllosphere	VFEQDEVHGDEGGHEMMMIKLNLEKKKEKNKNRENQGKGI*
Ga0182108_10437541	3300015300	Miscanthus Phyllosphere	VLEQDEVHGDEGGHEMMMIKLNLEKKKEKNKNRDDQDKGIK*
Ga0182108_10556921	3300015300	Miscanthus Phyllosphere	VGAIQVFEQDGIHGDKDGHEIMMIKLNLKKKKEKNKNRDNQGKGI*
Ga0182108_11040931	3300015300	Miscanthus Phyllosphere	VIEQDEVHGDGGGHEMKMIKLNLEKKKEKNKNREDQGKDI*
Ga0182108_11073701	3300015300	Miscanthus Phyllosphere	VIEQNEVHGDGGGHEMMMIKLNMEKKKEKNKNQEDQGKG
Ga0182143_10536541	3300015302	Miscanthus Phyllosphere	VIEQGEVHGDEGGHEMVMIKLNLEKKKEKNKNREDQGKGI*
Ga0182143_10938741	3300015302	Miscanthus Phyllosphere	VIEQDEVHGDEGGHEMKMIKLKLEKKKEKNKIQDDQGKGIR*
Ga0182123_10817611	3300015303	Miscanthus Phyllosphere	VIEQDEVHGDGDGHVLMMIKLNLEKKKEKQNRDDMGKGI*
Ga0182112_10525391	3300015304	Miscanthus Phyllosphere	VIEQNEVHGDGGGHEMMMIKLNMEKKKEKNKNQEDQGKGTR*
Ga0182112_11037901	3300015304	Miscanthus Phyllosphere	VIEQDEVHGDEDGHVLMIIKLNLEKKKEKNKNQEDQGKGIR*
Ga0182158_10361831	3300015305	Miscanthus Phyllosphere	VIEQDEVHGVRDGHEIMMIKLNLEKKKEKNKNREDQGKGIR*
Ga0182158_10777031	3300015305	Miscanthus Phyllosphere	VIEQGEVHGDEGGHEMVMIKLNLEKKKEKNKNRDDQGKGI*
Ga0182142_10260811	3300015308	Miscanthus Phyllosphere	VIEQDEVHSDGGGHEIMMIKLNLKKKKEKNKNREDQGKGI*
Ga0182142_10826611	3300015308	Miscanthus Phyllosphere	VIEQDEVHGDGGGHEMKMIKLNLEKKKEKNKNQENQGKDIR*
Ga0182142_10827831	3300015308	Miscanthus Phyllosphere	CNPSVEQGHEVHGDGDGHMLKMIKLNMEKKKEKNKNRDDQGKGI*
Ga0182142_10835241	3300015308	Miscanthus Phyllosphere	VFEQDEVDGDEGGHKMMMIKLNLEKKKEKNKNKEDQGKSIW*
Ga0182127_10073793	3300015321	Miscanthus Phyllosphere	VIEQNEVLGDGGGHEMMMIKLNLEKKKEKNKNQEDQGKGIR*
Ga0182127_10093323	3300015321	Miscanthus Phyllosphere	VEHGVVVHRDGDGHMLKMIKLNLEKKKEKNKNRDDQGKDI*
Ga0182127_10154371	3300015321	Miscanthus Phyllosphere	VIKQDEVHGDGGAHEMKMIKLNLEKKKEKNKNREDQGKGIR*
Ga0182127_11036161	3300015321	Miscanthus Phyllosphere	VIEQNEVHGDGGGHEMKMIKLNLEKKKEKNKNREDQCKGLG*
Ga0182129_11015341	3300015323	Miscanthus Phyllosphere	VIEQDEVHGDEDGHVLMMIKLNLEKKKEKNKNREDQGKGIR*
Ga0182187_11386481	3300015341	Miscanthus Phyllosphere	VIEQDEVHGDEGGHALMIIKLNMEKKKEKNKNQKDQGKGIR*
Ga0182109_11227931	3300015342	Miscanthus Phyllosphere	HGDEVHGDGDGHVLKMIKLQPEKKKEKNKNKVDQGKCIK*
Ga0182155_11316141	3300015343	Miscanthus Phyllosphere	VIEQDEVHGVEGGHEMMMIKLNLEKKKEKNKNRDDQGKGIR*
Ga0182155_12232712	3300015343	Miscanthus Phyllosphere	VFEQDKVYGDGGGHELKMIKLNLEKKKEKNKNREN*
Ga0182189_10785391	3300015344	Miscanthus Phyllosphere	VEHGDEVHGDRDGYMLKMIKLNLENKKEKNKNRDDQVKG
Ga0182189_11388081	3300015344	Miscanthus Phyllosphere	VGAIQVFEQDGIHGDKGGHEIMMIKLNLKMKKEKNKNRDDQDKGI*
Ga0182111_10410422	3300015345	Miscanthus Phyllosphere	VFEQDEVHGDGGGHEMKMIKLNMEKKKEKNKNREDQGKGI*
Ga0182111_11356741	3300015345	Miscanthus Phyllosphere	VIEQDEVHGVKDGHEMMMIKLNLEKKKEKNKNQDNQGKGI*
Ga0182111_11623661	3300015345	Miscanthus Phyllosphere	MEQDEVHGDEGGHEMKMIKLNLEKKKEKNKIQDDQGKGI
Ga0182111_11690841	3300015345	Miscanthus Phyllosphere	LFEQDEVHEVEDGHVLMMIKLNLEKKKEKNKKEDQGKGIEVFVLHS
Ga0182111_11698541	3300015345	Miscanthus Phyllosphere	MQDEVHDDEGGHEMMMIKLNLEKKKEKNKNRDDQGKGI*
Ga0182139_11044212	3300015346	Miscanthus Phyllosphere	EQDEVHGDEGGHEMMMIKLNLEKKKEKNKNQDDQGKGI*
Ga0182139_11395991	3300015346	Miscanthus Phyllosphere	IQVIEQDEVHEDEDGHVLMTIKLNFEKRKKNKNREDQDKGIR*
Ga0182177_11244181	3300015347	Miscanthus Phyllosphere	VGAIQVFEQDGIHGDKDGHEIMMIKLNLKKKKEKNKNRDNQGK
Ga0182177_11980451	3300015347	Miscanthus Phyllosphere	VIEQDEVHGVEDGHEMMMIKLNLEKKKEKNKNQKDQGKGIR*
Ga0182161_12136221	3300015351	Miscanthus Phyllosphere	VIEHDEVHRVKDGHEMMMIKLNLKKKKEKNKNREDQGKGIR*
Ga0182161_12303201	3300015351	Miscanthus Phyllosphere	VIEQGEVHGVEDGHEMMMIKLNLEKKKEKNKNQEDQD
Ga0182161_12595751	3300015351	Miscanthus Phyllosphere	VEQGEEVRGDGDGHSLKMIKLNLEKKKEKNKNGDDQGKGI*
Ga0182159_13494372	3300015355	Miscanthus Phyllosphere	MEHSDEVHGDGDGHMSKMIKLNLEKKKEKNKNQDDQGKCM*
Ga0182145_10747191	3300015361	Miscanthus Phyllosphere	VIEQGEVHGVEDGHEMMMIKLNLEKKKEKNKNQEDQDKGIK*
Ga0182145_11809141	3300015361	Miscanthus Phyllosphere	VIEQGDEVHGDGDGHELKMIKLNLEKKKEKNKNRDDQSKCIE*
Ga0182145_11820531	3300015361	Miscanthus Phyllosphere	VSEQGEVHGDEDGHVLMMIKLNLEKKKEKNKNQKDQGKGIR*
Ga0182203_10815401	3300017404	Miscanthus Phyllosphere	VEHVDEVHRDGDGHLLKMIKLNMEKKKEKNKNRDDQGKGI
Ga0182203_10907952	3300017404	Miscanthus Phyllosphere	VIEHGEVHGDEDGHVLMMIKLNLEKKKEKNKNQEDQGKGIR
Ga0182203_11259591	3300017404	Miscanthus Phyllosphere	VIEQDEVHGVEGEYEMMMIKLNMEKKKEKNKNRDDQGKCI
Ga0182203_11306761	3300017404	Miscanthus Phyllosphere	VLEQDEVHGDEGGHEMMMIKLNLEKKKEKNKNQDDQGKGI
Ga0182207_10546452	3300017410	Miscanthus Phyllosphere	MEHDDEVHGDEDGHVLMMIKLNLENKKEKNKNQEDQGKGI
Ga0182208_10266141	3300017411	Miscanthus Phyllosphere	VIEQGEVHGVEDGHEMTMIKLNLEKKKEKNKNQEDQGKGIR
Ga0182208_11068421	3300017411	Miscanthus Phyllosphere	VIEQNEVHGDGGGHEMMMIKLNMEKKKEKNKNQEDQGKGIR
Ga0182222_10995231	3300017413	Miscanthus Phyllosphere	VFEQDEIHVDEGGYEMMMIKLNLIKKKEKNKNRDDQGK
Ga0182219_10549531	3300017424	Miscanthus Phyllosphere	VEHGDEVHGDGDGHMLKMIKLNLEKKKEKNKNRDD
Ga0182219_11398412	3300017424	Miscanthus Phyllosphere	MDIGDEVHGNIDGHVLMMIKLNLEKKKEKNKNRDDQDKDI
Ga0182224_11053302	3300017425	Miscanthus Phyllosphere	VIEQDEVHGDGGGHEMKMIKLNLEKKKEKNKNREDQGKGI
Ga0182224_11057932	3300017425	Miscanthus Phyllosphere	VIEQDEVRGDEGIHEMMMIKLNLEMKKEKNKIQEDQGKGI
Ga0182224_11081991	3300017425	Miscanthus Phyllosphere	VXIRKGGPIQVIEQDEVHGDEDGHLLMMIKLNLEKKKEKNKN
Ga0182190_10375841	3300017427	Miscanthus Phyllosphere	VMEKDEVHGVEDGHEMMVIKLNLEKKKEKNKNREDQGKGIR
Ga0182190_11021992	3300017427	Miscanthus Phyllosphere	VEHGDEVHRDGDGHMLKMIKLNLEKKKEKNKNRDDQGK
Ga0182192_10194751	3300017430	Miscanthus Phyllosphere	VIEQDEVHGVEGEYEMMMIKLNMEKKKEKNKNRDDQDKVIR
Ga0182192_10349473	3300017430	Miscanthus Phyllosphere	VIEHDEVHRDEDGHVLMMIKLNLEKKKEKNKNREDQGKGIR
Ga0182192_11533011	3300017430	Miscanthus Phyllosphere	VVEQDEVHGDEDGHIMMVIKLQLKKNKEKNKNQGDQGKGIK
Ga0182192_11578002	3300017430	Miscanthus Phyllosphere	VIEQDEVHGDGDGHMLMKIKLNLEKKKEKNKNLEDQGKGIR
Ga0182206_10618511	3300017433	Miscanthus Phyllosphere	GPFQVIEQDEVHEVEGGHEMMMIKLKLKRRKTKTKNQGDQGKGTK
Ga0182206_10629921	3300017433	Miscanthus Phyllosphere	DEVHGVEGGHEMMMIKLNLEKKEEKNKNRDDQGKGI
Ga0182209_10046242	3300017436	Miscanthus Phyllosphere	VVEQDEVHGDEDVHVMMVIKLQLKKNKEKNKNQGDQGKGIK
Ga0182191_10321311	3300017438	Miscanthus Phyllosphere	EQDGIHGDKGGHEIMMIKLNLKMKKEKNKNRDDQDKGI
Ga0182191_10449142	3300017438	Miscanthus Phyllosphere	VFEQDEVHGDGCGHEMNMIKLNLEKKKEKNKNREDQGKGI
Ga0182191_10999951	3300017438	Miscanthus Phyllosphere	VIKQDELHGDGGGHEMKMIKRNLQKKKEKKYREDQGKGI
Ga0182191_11121941	3300017438	Miscanthus Phyllosphere	VIEQNEVHGDGGGHEMMMIKLNLEKKKEKNKNQEDQGKGIT
Ga0182191_11268201	3300017438	Miscanthus Phyllosphere	MIEQNEVHGVGGGHEMKMIKLNLEKKKEKNKNREDQGKGIR
Ga0182221_10356181	3300017442	Miscanthus Phyllosphere	VIEQAEVHGVKDGHEMMTMKLNLEKKKEKNKNQEDQGKGIR
Ga0182193_10716871	3300017443	Miscanthus Phyllosphere	VIEQDEVHGVEGEYEMMMIKLNMEKKEKNKNRDDQDKGIR
Ga0182233_10658471	3300017680	Miscanthus Phyllosphere	VIEQDEVHGDEGGHVLMMIKLNLEKKKEKNKNRDDQGKGI
Ga0182229_11035362	3300017682	Miscanthus Phyllosphere	VSIRKGGPIQVIEQDEVHGDEDGHVLMMIKLNLEKKKEKNKNREDQGKHIR
Ga0182218_10452441	3300017683	Miscanthus Phyllosphere	VIEQDEVHGDEDGHVLMMIKLNLEKKKEKNKNREDQGKHIR
Ga0182225_10210951	3300017684	Miscanthus Phyllosphere	VIEQDEVHGVEGGYEMMMIKLNLEKKKEKNKNRDDQGKGI
Ga0182227_10488291	3300017685	Miscanthus Phyllosphere	VIEQDEVHGDGDGYEMVMIKRNLEKKKEKNKNRDDQGKGI
Ga0182232_10814561	3300021060	Phyllosphere	VIEQDEVHGDEDGHLLMMIKLNLKKKKEKNKNRDNQGKGI
Ga0207677_115476971	3300026023	Miscanthus Rhizosphere	VFEQDEVHGDEGGHEMMMIKLNLEKKKEKNKNQDDQGKGIX

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F074314

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences