| Basic Information | |
|---|---|
| Family ID | F074184 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MPLTLVVLLAGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 39.17 % |
| % of genes near scaffold ends (potentially truncated) | 25.00 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (34.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.00% β-sheet: 0.00% Coil/Unstructured: 44.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02737 | 3HCDH_N | 42.50 |
| PF02803 | Thiolase_C | 38.33 |
| PF00072 | Response_reg | 6.67 |
| PF04715 | Anth_synt_I_N | 2.50 |
| PF13487 | HD_5 | 1.67 |
| PF01923 | Cob_adeno_trans | 1.67 |
| PF00117 | GATase | 1.67 |
| PF00425 | Chorismate_bind | 0.83 |
| PF02885 | Glycos_trans_3N | 0.83 |
| PF00291 | PALP | 0.83 |
| PF12900 | Pyridox_ox_2 | 0.83 |
| PF00108 | Thiolase_N | 0.83 |
| PF13242 | Hydrolase_like | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 42.50 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 42.50 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 42.50 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 42.50 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 42.50 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 42.50 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 42.50 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 39.17 |
| COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 5.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.50 % |
| Unclassified | root | N/A | 2.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000887|AL16A1W_10028299 | Not Available | 579 | Open in IMG/M |
| 3300001361|A30PFW6_1064965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1626 | Open in IMG/M |
| 3300001535|A3PFW1_10164251 | All Organisms → cellular organisms → Bacteria | 7063 | Open in IMG/M |
| 3300001536|A1565W1_10204475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1190 | Open in IMG/M |
| 3300001536|A1565W1_10267265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1270 | Open in IMG/M |
| 3300001536|A1565W1_10408931 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300001537|A2065W1_10005910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300004463|Ga0063356_100922246 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300005172|Ga0066683_10261449 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300005176|Ga0066679_10942336 | Not Available | 541 | Open in IMG/M |
| 3300005336|Ga0070680_102018500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300005445|Ga0070708_100014696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6450 | Open in IMG/M |
| 3300005468|Ga0070707_100049693 | All Organisms → cellular organisms → Bacteria | 4020 | Open in IMG/M |
| 3300005518|Ga0070699_100007433 | All Organisms → cellular organisms → Bacteria | 9537 | Open in IMG/M |
| 3300005552|Ga0066701_10652467 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005558|Ga0066698_10464133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 862 | Open in IMG/M |
| 3300005559|Ga0066700_10945485 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005586|Ga0066691_10349001 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300006173|Ga0070716_101690560 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009090|Ga0099827_10002059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 10921 | Open in IMG/M |
| 3300009137|Ga0066709_101532290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 959 | Open in IMG/M |
| 3300009148|Ga0105243_13115077 | Not Available | 502 | Open in IMG/M |
| 3300010039|Ga0126309_10503039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300010301|Ga0134070_10302342 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300011003|Ga0138514_100026481 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300011270|Ga0137391_10267857 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300011996|Ga0120156_1000522 | All Organisms → cellular organisms → Bacteria | 14453 | Open in IMG/M |
| 3300011998|Ga0120114_1054525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300012198|Ga0137364_10304687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1183 | Open in IMG/M |
| 3300012200|Ga0137382_10943726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Sporolactobacillaceae | 621 | Open in IMG/M |
| 3300012201|Ga0137365_10001675 | All Organisms → cellular organisms → Bacteria | 17373 | Open in IMG/M |
| 3300012208|Ga0137376_10292761 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300012209|Ga0137379_11309662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300012210|Ga0137378_10045523 | All Organisms → cellular organisms → Bacteria | 3936 | Open in IMG/M |
| 3300012211|Ga0137377_10368596 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300012211|Ga0137377_11135535 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012211|Ga0137377_11468931 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012285|Ga0137370_10471950 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300012349|Ga0137387_11101352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 566 | Open in IMG/M |
| 3300012351|Ga0137386_10327007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1103 | Open in IMG/M |
| 3300012351|Ga0137386_11148664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300012357|Ga0137384_10754919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 788 | Open in IMG/M |
| 3300012363|Ga0137390_10059621 | All Organisms → cellular organisms → Bacteria | 3718 | Open in IMG/M |
| 3300012922|Ga0137394_11090390 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012922|Ga0137394_11358832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Sporolactobacillaceae | 572 | Open in IMG/M |
| 3300012929|Ga0137404_10107372 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300012929|Ga0137404_10959035 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012930|Ga0137407_10826353 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300012930|Ga0137407_11766800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300012951|Ga0164300_10012956 | All Organisms → cellular organisms → Bacteria | 2688 | Open in IMG/M |
| 3300012958|Ga0164299_10146622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1300 | Open in IMG/M |
| 3300012958|Ga0164299_10528213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 791 | Open in IMG/M |
| 3300012960|Ga0164301_10872426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
| 3300012961|Ga0164302_10125922 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300012972|Ga0134077_10180766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 852 | Open in IMG/M |
| 3300013501|Ga0120154_1012393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2336 | Open in IMG/M |
| 3300013764|Ga0120111_1074576 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300013765|Ga0120172_1051434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1063 | Open in IMG/M |
| 3300013770|Ga0120123_1102021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 655 | Open in IMG/M |
| 3300014326|Ga0157380_13020354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300015358|Ga0134089_10426406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 570 | Open in IMG/M |
| 3300018027|Ga0184605_10000276 | All Organisms → cellular organisms → Bacteria | 15191 | Open in IMG/M |
| 3300018027|Ga0184605_10025484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2406 | Open in IMG/M |
| 3300018027|Ga0184605_10127100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1138 | Open in IMG/M |
| 3300018027|Ga0184605_10201365 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300018054|Ga0184621_10024901 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300018061|Ga0184619_10058069 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300018061|Ga0184619_10278267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
| 3300018066|Ga0184617_1172199 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300018071|Ga0184618_10038464 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300018071|Ga0184618_10172791 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300018072|Ga0184635_10296204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300018433|Ga0066667_10437578 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300018482|Ga0066669_11825432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300019279|Ga0184642_1485045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1281 | Open in IMG/M |
| 3300019279|Ga0184642_1507107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300019868|Ga0193720_1018530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 984 | Open in IMG/M |
| 3300019875|Ga0193701_1084743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300019885|Ga0193747_1024624 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300019887|Ga0193729_1000340 | All Organisms → cellular organisms → Bacteria | 23922 | Open in IMG/M |
| 3300020006|Ga0193735_1046474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1299 | Open in IMG/M |
| 3300020022|Ga0193733_1169549 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021078|Ga0210381_10034748 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300021080|Ga0210382_10351706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300021344|Ga0193719_10006265 | All Organisms → cellular organisms → Bacteria | 4901 | Open in IMG/M |
| 3300021418|Ga0193695_1007546 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300025910|Ga0207684_10014826 | All Organisms → cellular organisms → Bacteria | 6708 | Open in IMG/M |
| 3300025922|Ga0207646_10042493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4083 | Open in IMG/M |
| 3300025939|Ga0207665_11493169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300026536|Ga0209058_1066355 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300027882|Ga0209590_10020506 | All Organisms → cellular organisms → Bacteria | 3327 | Open in IMG/M |
| 3300028381|Ga0268264_12240726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 554 | Open in IMG/M |
| 3300028705|Ga0307276_10000285 | All Organisms → cellular organisms → Bacteria | 6152 | Open in IMG/M |
| 3300028705|Ga0307276_10224405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300028711|Ga0307293_10302933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300028715|Ga0307313_10295032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300028722|Ga0307319_10046786 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300028722|Ga0307319_10108339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 892 | Open in IMG/M |
| 3300028755|Ga0307316_10229995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300028771|Ga0307320_10427566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300028784|Ga0307282_10018795 | All Organisms → cellular organisms → Bacteria | 2882 | Open in IMG/M |
| 3300028787|Ga0307323_10264158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300028791|Ga0307290_10140060 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300028791|Ga0307290_10177379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300028791|Ga0307290_10230565 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300028803|Ga0307281_10006806 | All Organisms → cellular organisms → Bacteria | 3131 | Open in IMG/M |
| 3300028807|Ga0307305_10377623 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300028819|Ga0307296_10202665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1077 | Open in IMG/M |
| 3300028828|Ga0307312_10601438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 727 | Open in IMG/M |
| 3300028828|Ga0307312_10748911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
| 3300028875|Ga0307289_10386511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300028878|Ga0307278_10000004 | All Organisms → cellular organisms → Bacteria | 145274 | Open in IMG/M |
| 3300028878|Ga0307278_10275908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
| 3300028878|Ga0307278_10302382 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300028884|Ga0307308_10073149 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300028885|Ga0307304_10084580 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300031092|Ga0308204_10186616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300031199|Ga0307495_10149707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300031200|Ga0307496_10007575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1324 | Open in IMG/M |
| 3300031421|Ga0308194_10022462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1398 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 34.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.00% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 10.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 9.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AL16A1W_100282991 | 3300000887 | Permafrost | MPLTLLVLLAGLAIAVLVYVISGGQVFFLPLILLLPLGLFVGRRRRP* |
| A30PFW6_10649652 | 3300001361 | Permafrost | MPLTLLVLLAGLAIAAFVYVLSGGHVFFLPLILLLPLGLFVGRRRRP* |
| A3PFW1_101642513 | 3300001535 | Permafrost | MPLTLVVLLAGFAVAVLVYVLSGGHVFFLPLILLLPFGLFIARRRRS* |
| A1565W1_102044752 | 3300001536 | Permafrost | MPLTLLVLLAGLAIAAFVYVLSGGHVFFLPLILLLPLGIFVGRRRRP* |
| A1565W1_102672653 | 3300001536 | Permafrost | LLLAGLAIAALVYVLSGGHVFFLPLILLLPLGLFIGRRRRP* |
| A1565W1_104089312 | 3300001536 | Permafrost | MPLTLVVLLAGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS* |
| A2065W1_100059101 | 3300001537 | Permafrost | LAGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0063356_1009222462 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VNDLPVPFTVVILLAGLAIAAVVYVVSGGHVFFLPLVLLFPLGFFFSRRR* |
| Ga0066683_102614492 | 3300005172 | Soil | VVTPAMPLTFVVLLVGLAVAVLVYVLSGGHVFFLPLILLLPLGVFVGRRRRP* |
| Ga0066679_109423361 | 3300005176 | Soil | VLVVLLAGLAIAALVYVLSGGHVFFLPLILLLPVGLLIGRRGRR* |
| Ga0070680_1020185001 | 3300005336 | Corn Rhizosphere | VRGDARAMPLTLVVLLAGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0070708_1000146963 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VVLLAGLAIAALVYVLSGGHVFFLPLILLLPVGLLIGRRRRR* |
| Ga0070707_1000496934 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VVLLAGLAIAALVYVLSGGYVFFLPLILLLPVGLLIGRRRRR* |
| Ga0070699_1000074334 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRTLVVLLGGLAVALLVYVLSSGHVIFLPLILLLPFGLLIGRRRRS* |
| Ga0066701_106524672 | 3300005552 | Soil | MPLTLVVLLAGFAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0066698_104641332 | 3300005558 | Soil | MPRTFVVLLGGLAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0066700_109454852 | 3300005559 | Soil | VLVVLLAGLAIAALVYVLSGGPVFFLPLILLLPVGLLIGRRGRR* |
| Ga0066691_103490012 | 3300005586 | Soil | MPLTLVVLLAGLAVAVLVYVLSGGHVFFLPLILLLPLGLVFGRRSRP* |
| Ga0070716_1016905602 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AADRGVELPLTLVVLLAGLAIAALVYVLSGGHVFFLPLILLLPVGLLIGRRRRR* |
| Ga0099827_100020596 | 3300009090 | Vadose Zone Soil | MPLTLVVLLAGVAVAVLVYVLSSGHVFFLPLILLLPFGLFIIRRRPRS* |
| Ga0066709_1015322901 | 3300009137 | Grasslands Soil | MPLTFVVLLVGLAVAVLVYVLSGGHVFFLPLILLLPLGVFVGRRRRP* |
| Ga0105243_131150772 | 3300009148 | Miscanthus Rhizosphere | MPLTLVVLLAGLAIAVLVYVVSGGHVFFLPLILLLPLGLFIGRRRR |
| Ga0126309_105030391 | 3300010039 | Serpentine Soil | MRITLVVLLAGIAIAALVYVLSGGHVVFLPLVFLFPLGLFFGRRRRY* |
| Ga0134070_103023422 | 3300010301 | Grasslands Soil | MPLTLVLLIAGLAIAVLVYVVSGGQVFFLPLILLLPLGLFIGRRRRS* |
| Ga0138514_1000264812 | 3300011003 | Soil | MPLTLVVLLCGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0137391_102678572 | 3300011270 | Vadose Zone Soil | MPLTLLILLGGLAVAVLVYVLSGGHVFFLPLILLLPLGLFVGRRGRP* |
| Ga0120156_10005226 | 3300011996 | Permafrost | MPLTLVVLLAGFAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRRS* |
| Ga0120114_10545251 | 3300011998 | Permafrost | MRLTLVLLLAGLAIAALVYVLSGGHVFFLPLILLLPLGLFIGRRRRP* |
| Ga0137364_103046872 | 3300012198 | Vadose Zone Soil | MPRTLLVLLSGLAVAVLVYVLSGGHVFFLPLILLLPFGLLIGR |
| Ga0137382_109437262 | 3300012200 | Vadose Zone Soil | MPVTLVVLLVGFAVAVLVYVISGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0137365_100016759 | 3300012201 | Vadose Zone Soil | MPVTLGVLLAGLAVAVLVYVLSGGHVFLLPLILLLPFGLLIGRRRRS* |
| Ga0137376_102927612 | 3300012208 | Vadose Zone Soil | MPRTLVVLLSGLAVAVLVYVLSGGHVFFLPLILLLPFGLLIGRRRRS* |
| Ga0137379_113096621 | 3300012209 | Vadose Zone Soil | LAVAVLVYVLSGGHVFFLPLILLLPFGLFVGRRRRP* |
| Ga0137378_100455234 | 3300012210 | Vadose Zone Soil | MPLPLVVVLAGLAVAVLVYVLSGGHVFFLPLILLLPFGLFVGRRRRP* |
| Ga0137377_103685964 | 3300012211 | Vadose Zone Soil | LLAGLAVAALVYVLSGGHVFFLPLTLLLPVGLLIGRRGRR* |
| Ga0137377_111355352 | 3300012211 | Vadose Zone Soil | VLVVLLAGLAVAALVYVLSGGHVLFLPLILLLPIGLLIGRRRRR* |
| Ga0137377_114689312 | 3300012211 | Vadose Zone Soil | MPLTLVVLLAGLAVAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0137370_104719502 | 3300012285 | Vadose Zone Soil | MPRTFVVLLGGLAVAVLVYVLSGGHVFFLPLILLLPFGLLIGRRRRS* |
| Ga0137387_111013522 | 3300012349 | Vadose Zone Soil | MPRTFVVLLGGLAVAVLVYVLSGGHVFLLPLILLLPFGLLIGRRRRS* |
| Ga0137386_103270072 | 3300012351 | Vadose Zone Soil | MPRTLVVLLGGLAVAVLVYVLSGGHVFFLPLILLLPFGLLIGRRRRP* |
| Ga0137386_111486642 | 3300012351 | Vadose Zone Soil | AMPLTLIVLLAGLAVAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0137384_107549192 | 3300012357 | Vadose Zone Soil | VVLAGLAVAVLVYVLSGGHVFFLPLILLLPFGLFVGRRRRP* |
| Ga0137390_100596212 | 3300012363 | Vadose Zone Soil | MPLTLLILLGGLAVAVLVYVLSGGHVFFLPLILLLPLGLFVGRRRRP* |
| Ga0137394_110903902 | 3300012922 | Vadose Zone Soil | MLLVLVAGLAIAVLVYVVSGGHVFFLPLILLLPLGLLIGRRRRS* |
| Ga0137394_113588322 | 3300012922 | Vadose Zone Soil | MRLTLFVLLAGLAIAVLVYVLSGGHVFFLPLILLLPLGLLIGRRRRP* |
| Ga0137404_101073722 | 3300012929 | Vadose Zone Soil | MPRSLVVLLSALAVAVLVYVLSGGHVFFLPLILLLPVGLLIGRRRRS* |
| Ga0137404_109590352 | 3300012929 | Vadose Zone Soil | MPLTLVVLLAGLAVAVLVYVLSGGHVFFLPLILLLPFGLLIGRRRRS* |
| Ga0137407_108263532 | 3300012930 | Vadose Zone Soil | VLLGGLAVAVLVYVLSGGHVFFLPLILLLPVGLLIGRRRRS* |
| Ga0137407_117668001 | 3300012930 | Vadose Zone Soil | MPLTLVVLLAGLAVAVLVYVLSGGHVFFLPLILLLPFGLLIG |
| Ga0164300_100129562 | 3300012951 | Soil | MPLTLVLLLSGLAIAVLVYVVSGGHVFFLPLILLLPLGLFIARRGRSERR* |
| Ga0164299_101466223 | 3300012958 | Soil | MPLTLVLLLSGLAIAVLVYVVSGGHVFFLPLILLLPLGLFIGRRGRSERR* |
| Ga0164299_105282132 | 3300012958 | Soil | IAVLVSVVSGGHVFFLPLLLLLPFGLFIGRRRRS* |
| Ga0164301_108724262 | 3300012960 | Soil | MPLTLVLLLSGLAIAVLVYVASGGHVFFLPLILLLPLGLFIGRRGRSERR* |
| Ga0164302_101259222 | 3300012961 | Soil | MPLTLVVLLAGLSIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0134077_101807662 | 3300012972 | Grasslands Soil | MPLTLVVLLAGFAVAVLVYVLSGGHVFLLPLILLLPFRLFIGRRRRS* |
| Ga0120154_10123933 | 3300013501 | Permafrost | MPLTLVVLLAGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRSERR* |
| Ga0120111_10745762 | 3300013764 | Permafrost | MPVTLVVLLVGFAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0120172_10514341 | 3300013765 | Permafrost | MPVTLVVLLVGFAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRR |
| Ga0120123_11020212 | 3300013770 | Permafrost | MPRTLLVLLAGLAIAVLVYVLSGGHVFFLPLILLLPLGLFAGRRRRS* |
| Ga0157380_130203542 | 3300014326 | Switchgrass Rhizosphere | MPLTLVVLLAGLAIAVLVYVVSGGHVFFLPLILLLPLGLFIGRRRRS* |
| Ga0134089_104264062 | 3300015358 | Grasslands Soil | MPVTLVVLLAGFAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS* |
| Ga0184605_1000027616 | 3300018027 | Groundwater Sediment | MPLALVVLLAGLAIAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0184605_100254842 | 3300018027 | Groundwater Sediment | MPLTLVVILAGLAIALLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0184605_101271002 | 3300018027 | Groundwater Sediment | MPRTLVVLLSGLAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0184605_102013652 | 3300018027 | Groundwater Sediment | LPLTLLILLAGLAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0184621_100249012 | 3300018054 | Groundwater Sediment | MPLMLVVLIAGLAIAVLVYVVSGGHVFFLPLILLLPLGLFIGRRRRS |
| Ga0184619_100580692 | 3300018061 | Groundwater Sediment | MPRTFVVLLGGLTVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0184619_102782672 | 3300018061 | Groundwater Sediment | MPLTLLVLVAGLAIAVLVYAVSGGHVFFLPLILLLPLGLFIGRRRRS |
| Ga0184617_11721992 | 3300018066 | Groundwater Sediment | MPLTLIVLLAGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0184618_100384642 | 3300018071 | Groundwater Sediment | MPRTLVVLLSGLAVAVLVYVLSGGHVFFLPLILLLPFGLLVGRRRRS |
| Ga0184618_101727912 | 3300018071 | Groundwater Sediment | MPLTLVVLVSGLAIAVLVYVVSGGHVFLLPLILLLPFGLFIGRRRRS |
| Ga0184635_102962042 | 3300018072 | Groundwater Sediment | ALVVLLAGLAIAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0066667_104375782 | 3300018433 | Grasslands Soil | MPRTLLVLLSGLAVAVLVYVLSGGHVFFLPLILLLPFGLLIGRRRRS |
| Ga0066669_118254322 | 3300018482 | Grasslands Soil | VLVVLLAGLAIAALVYVLSGGHVFFLPLILLLPVGLLIGRRGRR |
| Ga0184642_14850451 | 3300019279 | Groundwater Sediment | MSRTFVVLLGGLAVAVLVYVLSGGHVFFLPLILLLPF |
| Ga0184642_15071071 | 3300019279 | Groundwater Sediment | RDDARGDTTVMPLTLVVILAGLAIALLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0193720_10185301 | 3300019868 | Soil | MPLTLVVLLCGLAIAVLVYVVSGGHVFFLPLILLLPFGFFIGRRRRS |
| Ga0193701_10847431 | 3300019875 | Soil | VVLLCGLAIAVLVYVVSGGHVFFLPLILLLPFGFFIGRRRRS |
| Ga0193747_10246242 | 3300019885 | Soil | MPLTLVVLLCGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0193729_100034019 | 3300019887 | Soil | MPVTLLVLLAGIAIAVLVYVLSGGHVFFLPLILLLPLGVFVGRRRRP |
| Ga0193735_10464741 | 3300020006 | Soil | MPRTFVVLLGGLAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0193733_11695492 | 3300020022 | Soil | MPRTFVVLLGGLAIAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0210381_100347481 | 3300021078 | Groundwater Sediment | VVLLAGLAIAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0210382_103517061 | 3300021080 | Groundwater Sediment | VGDVAGGDIATMPRTFVVLLGGLTVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0193719_100062656 | 3300021344 | Soil | MSRTFVVLLGGLAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0193695_10075463 | 3300021418 | Soil | VLLGGLAVAVLVYVLSGGHVFFLPLILLLPVGLLIGRRRRS |
| Ga0207684_100148264 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VVLLAGLAIAALVYVLSGGHVFFLPLILLLPVGLLIGRRRRR |
| Ga0207646_100424934 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VVLLAGLAIAALVYVLSGGYVFFLPLILLLPVGLLIGRRRRR |
| Ga0207665_114931692 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GGCAADRGVELPLTLVVLLAGLAIAALVYVLSGGHVFFLPLILLLPVGLLIGRRRRR |
| Ga0209058_10663552 | 3300026536 | Soil | MPLTLVVLLAGFAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0209590_100205063 | 3300027882 | Vadose Zone Soil | MPLTLVVLLAGVAVAVLVYVLSSGHVFFLPLILLLPFGLFIIRRRPRS |
| Ga0268264_122407262 | 3300028381 | Switchgrass Rhizosphere | MPLTLVVLLAGLAIAVLVYVVSGGHVFFLPLILLLPLGLFIGRRRRS |
| Ga0307276_100002853 | 3300028705 | Soil | MPLTLVVLLAGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0307276_102244051 | 3300028705 | Soil | MPLTLLVLLAGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0307293_103029331 | 3300028711 | Soil | MRLTLVALLAGLAIAALVYVVSGGHVLFLPLFLLLPFGLFLGRRRRRS |
| Ga0307313_102950321 | 3300028715 | Soil | MPLTLVVLVSGLAIAVLVYAVSGGHVFFLPLILLLPLGLFIGR |
| Ga0307319_100467862 | 3300028722 | Soil | MPLTLVVLLAGFAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0307319_101083391 | 3300028722 | Soil | MRLTLVALLAGVAIAALVYVVSGGHVLFLPLFLLLPFGLFLG |
| Ga0307316_102299951 | 3300028755 | Soil | GLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0307320_104275662 | 3300028771 | Soil | QTPVMRVTLFLLLAGLAIAALVYVVSGGHVIFLPLVFLLPLGLFFGRRRRY |
| Ga0307282_100187952 | 3300028784 | Soil | MPLTLVLLIAGLALAVLVYVVSGGHVFFLPLILLLPLGLFIGRRRRS |
| Ga0307323_102641581 | 3300028787 | Soil | MRLTLVALLAGLAIAALVYVVSGGHVLFLPLFLLL |
| Ga0307290_101400602 | 3300028791 | Soil | MIVTLVVLLAGLAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0307290_101773792 | 3300028791 | Soil | RGDTTAMPLTLVVLLCGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0307290_102305652 | 3300028791 | Soil | VRLTLVALLAGLAIAVLVYVVSGGHVFFLPLILLLPLGLFIGRRRRS |
| Ga0307281_100068063 | 3300028803 | Soil | MPLTLVLLLAGIAVAVLVYVVSGGHFFFLPLILLLPFGLFIGRRRRS |
| Ga0307305_103776232 | 3300028807 | Soil | MPRTFVVLLGGLAVAVLVYVLSSGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0307296_102026651 | 3300028819 | Soil | MPLTLLLLLAGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0307312_106014381 | 3300028828 | Soil | MRVTLVAVLAGLAIAALVYAVSGGHVLFLPLFLLLPFGLFVG |
| Ga0307312_107489111 | 3300028828 | Soil | MPVTLVVLLVGFAVAVLVYVISGGHVFFLPLILLLPFG |
| Ga0307289_103865112 | 3300028875 | Soil | VLLGGLAIAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0307278_10000004103 | 3300028878 | Soil | MPRTFVVLLGGLAVAVLVYVLSSGRVFFLPLILLLPFGLFIGRRRRS |
| Ga0307278_102759082 | 3300028878 | Soil | TLVALLAGLAIAALVYVVSGGHVLFLPLFLLLPFGLFLGRRGRRSSGS |
| Ga0307278_103023822 | 3300028878 | Soil | MPLTLVVLVAGLAIAVLVYVVSGGHVFFLPLILLLPLGFFIGRRRRS |
| Ga0307308_100731491 | 3300028884 | Soil | LAVAVLVYVLSGGHVFFLPLILLLPFGLFIGRRRRS |
| Ga0307304_100845802 | 3300028885 | Soil | MPLTLVLLLAGLAIAVLVYVVSGGHVFFLPLILLLPFGLFIGRRRRSSRD |
| Ga0308204_101866161 | 3300031092 | Soil | MPLALVVLLAGLAIAVLVYVLSGGHVFFLPLILLLPFGFFIGRRRRS |
| Ga0307495_101497071 | 3300031199 | Soil | MPLTLVVLLAGLSIAVLVYVVSGGHVFFLPLLLLLPFGLFIGRRRRS |
| Ga0307496_100075751 | 3300031200 | Soil | MPLTLVVLLAGFAIAVLVYVVSGGHVFFLPLLLLLPFGLFIGRRRRS |
| Ga0308194_100224622 | 3300031421 | Soil | MPRTFVVLLDGLAVAVLVYVLSSGHVFFLPLILLLPFGLFIGRRRRS |
| ⦗Top⦘ |