NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074183

Metagenome / Metatranscriptome Family F074183

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074183
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 175 residues
Representative Sequence MNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKTTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLR
Number of Associated Samples 107
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 74.79 %
% of genes near scaffold ends (potentially truncated) 99.17 %
% of genes from short scaffolds (< 2000 bps) 95.83 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.75

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.167 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(37.500 % of family members)
Environment Ontology (ENVO) Unclassified
(35.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.167 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 71.64%    β-sheet: 0.00%    Coil/Unstructured: 28.36%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.75
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.25.1.2: Ribonucleotide reductase-liked6vk6a_6vk60.63798
a.25.1.2: Ribonucleotide reductase-liked3ge3a_3ge30.62603
f.72.1.0: automated matchesd6khid_6khi0.61582
f.72.1.1: Double antiporter-like subunits from respiratory complex Id3rkod_3rko0.60444
f.72.1.1: Double antiporter-like subunits from respiratory complex Id4he8m_4he80.599


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF13484Fer4_16 20.83
PF08240ADH_N 4.17
PF05231MASE1 1.67
PF01048PNP_UDP_1 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 1.67
COG3447Integral membrane sensor domain MASE1Signal transduction mechanisms [T] 1.67
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 1.67
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.83
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.83
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.17 %
UnclassifiedrootN/A15.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c2172606Not Available549Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_10868068Not Available514Open in IMG/M
3300000880|AL20A1W_1047690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300000956|JGI10216J12902_100552925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300000956|JGI10216J12902_107208182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300001334|A2165W6_1030160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria702Open in IMG/M
3300001361|A30PFW6_1069904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1158Open in IMG/M
3300001536|A1565W1_10081773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300004156|Ga0062589_101764924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300004156|Ga0062589_102705454Not Available516Open in IMG/M
3300004157|Ga0062590_100587911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium975Open in IMG/M
3300004479|Ga0062595_100922294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300004643|Ga0062591_101468718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium680Open in IMG/M
3300005093|Ga0062594_100881336All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300005328|Ga0070676_10761335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300005334|Ga0068869_100137779All Organisms → cellular organisms → Bacteria1882Open in IMG/M
3300005334|Ga0068869_101606137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300005356|Ga0070674_100571000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium952Open in IMG/M
3300005440|Ga0070705_100080845All Organisms → cellular organisms → Bacteria1995Open in IMG/M
3300005466|Ga0070685_10731564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus724Open in IMG/M
3300005526|Ga0073909_10270042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300005530|Ga0070679_100480911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1186Open in IMG/M
3300005543|Ga0070672_101906310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus535Open in IMG/M
3300005564|Ga0070664_100536510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1081Open in IMG/M
3300006576|Ga0074047_11095986Not Available508Open in IMG/M
3300006578|Ga0074059_11976574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1241Open in IMG/M
3300006606|Ga0074062_12609123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300006845|Ga0075421_101367241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300006847|Ga0075431_101813723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300006871|Ga0075434_101914984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300006871|Ga0075434_101932388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300006953|Ga0074063_14055767All Organisms → cellular organisms → Bacteria2207Open in IMG/M
3300007076|Ga0075435_101727508Not Available549Open in IMG/M
3300007821|Ga0104323_119233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1501Open in IMG/M
3300007822|Ga0104325_108358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1149Open in IMG/M
3300009093|Ga0105240_12765097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300009094|Ga0111539_11451946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium796Open in IMG/M
3300009156|Ga0111538_12007906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium727Open in IMG/M
3300010375|Ga0105239_12785053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300011992|Ga0120146_1036858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium843Open in IMG/M
3300011996|Ga0120156_1039682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria862Open in IMG/M
3300012005|Ga0120161_1112899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300012503|Ga0157313_1055458Not Available528Open in IMG/M
3300012514|Ga0157330_1059830Not Available563Open in IMG/M
3300012899|Ga0157299_10133563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300012903|Ga0157289_10385059Not Available522Open in IMG/M
3300012910|Ga0157308_10075492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium940Open in IMG/M
3300012941|Ga0162652_100028728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium822Open in IMG/M
3300012951|Ga0164300_10902124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300012951|Ga0164300_11057896Not Available527Open in IMG/M
3300012951|Ga0164300_11192489Not Available504Open in IMG/M
3300012957|Ga0164303_10451016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium810Open in IMG/M
3300012958|Ga0164299_11130400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300012984|Ga0164309_10747369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300012985|Ga0164308_10986101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria748Open in IMG/M
3300012987|Ga0164307_10759629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria766Open in IMG/M
3300012988|Ga0164306_11416605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300012989|Ga0164305_10096197All Organisms → cellular organisms → Bacteria1888Open in IMG/M
3300013297|Ga0157378_11784197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300013297|Ga0157378_12187579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300013306|Ga0163162_10626284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1201Open in IMG/M
3300013308|Ga0157375_11360024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium836Open in IMG/M
3300014968|Ga0157379_10731897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium930Open in IMG/M
3300015245|Ga0137409_10914014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300018028|Ga0184608_10372848Not Available624Open in IMG/M
3300018061|Ga0184619_10198878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium921Open in IMG/M
3300018071|Ga0184618_10140332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium981Open in IMG/M
3300018465|Ga0190269_11934562Not Available510Open in IMG/M
3300019279|Ga0184642_1584298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300019361|Ga0173482_10295183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria710Open in IMG/M
3300019867|Ga0193704_1009343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1966Open in IMG/M
3300021080|Ga0210382_10348893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300021510|Ga0222621_1041178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium961Open in IMG/M
3300021968|Ga0193698_1054771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300025893|Ga0207682_10258567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium812Open in IMG/M
3300025907|Ga0207645_10780219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300025913|Ga0207695_11546162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300025932|Ga0207690_10345618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1175Open in IMG/M
3300025932|Ga0207690_11714571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300025935|Ga0207709_11033693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium673Open in IMG/M
3300025935|Ga0207709_11383475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300025935|Ga0207709_11588539Not Available543Open in IMG/M
3300025941|Ga0207711_11593357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300025942|Ga0207689_10306989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1315Open in IMG/M
3300025945|Ga0207679_10456637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1134Open in IMG/M
3300025981|Ga0207640_10361120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300026023|Ga0207677_12312874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300026095|Ga0207676_12426585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300026142|Ga0207698_11404413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300027821|Ga0209811_10366527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300028381|Ga0268264_10985194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium849Open in IMG/M
3300028592|Ga0247822_11801204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300028704|Ga0307321_1145664Not Available502Open in IMG/M
3300028711|Ga0307293_10253946Not Available558Open in IMG/M
3300028714|Ga0307309_10027970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1138Open in IMG/M
3300028716|Ga0307311_10012839All Organisms → cellular organisms → Bacteria2010Open in IMG/M
3300028716|Ga0307311_10035060Not Available1302Open in IMG/M
3300028718|Ga0307307_10026445All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300028720|Ga0307317_10150758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300028721|Ga0307315_10069493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1004Open in IMG/M
3300028744|Ga0307318_10205115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300028755|Ga0307316_10295213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300028771|Ga0307320_10052789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1502Open in IMG/M
3300028778|Ga0307288_10394841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300028784|Ga0307282_10027935All Organisms → cellular organisms → Bacteria2418Open in IMG/M
3300028784|Ga0307282_10417289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300028784|Ga0307282_10437333Not Available634Open in IMG/M
3300028799|Ga0307284_10302549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300028809|Ga0247824_10958921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300028810|Ga0307294_10108896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium886Open in IMG/M
3300028814|Ga0307302_10579789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300028824|Ga0307310_10214109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium914Open in IMG/M
3300028875|Ga0307289_10078050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1340Open in IMG/M
3300028878|Ga0307278_10357719All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300028880|Ga0307300_10319577Not Available529Open in IMG/M
3300028884|Ga0307308_10147148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1127Open in IMG/M
3300028885|Ga0307304_10005410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3804Open in IMG/M
3300031091|Ga0308201_10359555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300033551|Ga0247830_10895417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil37.50%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.33%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.50%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.67%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.67%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000880Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001334Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001361Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007821Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 SoapdenovoEnvironmentalOpen in IMG/M
3300007822Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011992Permafrost microbial communities from Nunavut, Canada - A23_65cm_12MEnvironmentalOpen in IMG/M
3300011996Permafrost microbial communities from Nunavut, Canada - A39_65cm_12MEnvironmentalOpen in IMG/M
3300012005Permafrost microbial communities from Nunavut, Canada - A15_80cm_0MEnvironmentalOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_217260613300000033SoilWIGWVRLGAVPFAIFQVAIGQNYPGHYELWAWITTGIFAVGTLALFALSRREWPKTTLKRIGFAALTFDFAIVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALALTAASAPVMAGFEWLRSDRYPPRTYHVDYVTLQLGLEVLLGLIVGWLMQRLVGQSXVAETRAAEAEKLRDQL
ICChiseqgaiiFebDRAFT_1086806813300000363SoilMNGELKRLRDVERWIGWLRAVAVPFAAFQVAIGSGYPPGYQVWAWSTTVVFAAGAAALFLLSRREWPRPAQRRLGLAALTFDFAIVSAYVLVYSFEQGSPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHNAPRSYHVDYVTLQLG
AL20A1W_104769023300000880PermafrostVNGELKRLRDVERWIGWIRLAGVPFAVFQVAIGSGYPSGYRVWAWVTTAIFALGAAVLFLLSRREWQRPAQRWLGLAALTFDFGIVSAYVLIYSFESASPIRQIMFLPLVEAALRYGIPGALGLAAASAPVMAIFEWLRARHSDPRSYHVDYVTLQLGIEVLMGLIVGW
JGI10216J12902_10055292513300000956SoilVNGELRRLRDVERWIGWVRLGAVPFAIFQVAIGANYPAHYELWAWITTGIFTIGTLALFALSRRDWSKTTLKRIGLAALTFDFAIVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALALTAASAPVMAGFEWLRSDRYPPRTYHIDYVTLQLGLEVLLGLI
JGI10216J12902_10720818213300000956SoilVNGELRRLRDVERWIGWVRLGAVPFAIFQVAIGANYPPHYELWAWITTVIFAVGTLALFALSRREWPKATLKRIGLAALTFDFAIVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALALTAASAPVMAGFEWLRSDRYPPRTYHVDYVTLQLGLEVLLGLIVGWLMQ
A2165W6_103016023300001334PermafrostVNGELKRLRDVERWIGWIRLAGVPFAVFQVAIGSGYPSGYRVWAWVTTAIFALGAAVLFLLSRREWQRPAQRWLGLASLTFDFGIVSAYVLIYSFESASSIRQIMFLPLVEAALRYGIPGALGLAAASAPVMAIFEWLRARHSDPRSYHVDYVTLQLGIEVLMG
A30PFW6_106990413300001361PermafrostVNGELKRLRDVERWIGWIRLAGVPFAVFQVAIGSGYPSGYRVWAWVTTAIFALGAAVLFLLSRREWQRPAQRWLGLASLTFDFGIVSAYVLIYSFESASPIRQIMFLPLVEAALRYGIPGALGLAAASAPVMAIFEWLRARHSDPRSYHVDYVTLQLGIEVLMGLIVGWLVLRMVGQTEVAETRAGEA
A1565W1_1008177313300001536PermafrostVNGELKRLRDVERWIGWIRLAGVPFAVFQVAIGSGYPSGYRVWAWVTTAIFALGAAVLFLLSRREWQRPAQRWLGLAALTFDFGIVSAYVLIYSFESASSIRQIMFLPLVEAALRYGIPGALGLAAASAPVMAIFEWLRARHSDPRSYHVDYVTLQLGIEVLMGLIVGWLVLRMVGQTEVAETRAGEA
Ga0062589_10176492413300004156SoilMNGELGRLRAVERWVGWIRLVAVPFAIFQVAISTYPGGSYELWAWVTTGIFTVGALVLFRLGRRDWSLGAQHRLGLAALGFDFAVVSAYVLIFNYEHASPIRQVMFLPLVEGALRYGIWGALAVVAASAPVMAVFEWLRQRHTEPHDYRLDYVTLQLGIEVLMGLI
Ga0062589_10270545413300004156SoilMNGELGRLRAVERWVGWIRLAAAPFAIFQIAISTYPGGSYELWAWLTTGIFSVGALVLFRLGRRDWSLGAQHRLGLAALGFDFAVVSAYVLIFNFEDASPIRQVMFLPLIEAALRYGIWGALVVVVASAPVMGVFEWLRQRHTEPHDY
Ga0062590_10058791123300004157SoilVNAELRRLRDVERWVAWVRLGAVPFAIFQVAIAEGYPRHYELWAWITTGVLAAGALLMFGLSRREWPKETLKRIGLAALSFDFAIVSAYTLIYTFQPSSPIRQLMYLPLVEAALRYGIVGALAVAAASAPVMAGFEWLRSDRYPPRTYRVDYVTLQLGLEVLLGLIVGWLMLRLLGQSTVAETRAAEAEKLRDQLGRRADV
Ga0062595_10092229423300004479SoilMNGELQRLRDVERWIAWVRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAAGALALFALSRREWPKTTLKRIGIAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKLRDQL
Ga0062591_10146871823300004643SoilMNGELGRLRAVERWVGWIRLVAVPFAIFQVAISTYPGGSYELWAWVTTGIFTVGALVLFRLGRRDWSLGAQHRLGLAALGFDFAVVSAYVLIFNYEHASPIRQVMFLPLVEGALRYGIWGALAVVAASAPVMAVFEWLRQRHTEPHDYRLDYVTLQLGI
Ga0062594_10088133613300005093SoilVNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGLFTVGALVLFWLSRRAWPQVTQSRLGLVALVFDFAVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVAASAPVMAVFESLREQRSDPRTYHLDYVTLQLGIELLMGLFVGWL
Ga0070676_1076133513300005328Miscanthus RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKPTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKLRDQLGRRADALEAANRCARAL
Ga0068869_10013777913300005334Miscanthus RhizosphereLSAELERLRDAERWIAWVRLGAVPFAIFQVAIATHSPGNRQVWAWIATAVLTVGAIAIWALSRREWPKRTLQRIGLAALCFDFAIVSVFTLIYSFEQASPIRQLMYLPLVEAALRYGILGALAVTAASAPVMIAFERLREQRVTPREFRVDYVTLQLGLEVLIGL
Ga0068869_10160613713300005334Miscanthus RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKTTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLR
Ga0070674_10057100013300005356Miscanthus RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKTTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKLRDQLGRRADALEAANRCA
Ga0070705_10008084513300005440Corn, Switchgrass And Miscanthus RhizosphereVGARKAQLSAELERLRDAERWIAWVRLGAVPFAIFQVAIATHSPGNRQVWAWIATAVLTVGAIAIWALSRREWPKRTLQRIGLAALCFDFAIVSVFTLIYSFEQASPIRQLMYLPLVEAALRYGILGALAVTAASAPVMIAFERLREQRVTPREFRVDYVTLQLGLEVLIGLIVGWLMLR
Ga0070685_1073156413300005466Switchgrass RhizosphereLSAELERLRDVERWIAWVRLGAVPFAIFQVAIAANYPGNRELWAWIATAVLTVGALLIWAVSRRELPKRTLQRIGLAALCFDFAIVSAFLLLYSFEQASPIRQLMYLPLVEAALRYGILGALAVVAASAPVMIAFELLRERRTEPREFRVDYVTLQLGVEVLIGLIVGWLMLR
Ga0073909_1027004213300005526Surface SoilVNGELRRLRDVERWIGWVRLGAVPFAIFQVALAGGYPDGYELRAWITTGILTVGTLVLFVLSRREWPKATLKRIGLGALAFDFAIASAYTLIYSFQPASPIRQVMYLPLVEAALRYGIVGALAVTAASAPVMVAFEWLRSGRYPPRTFHLDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAA
Ga0070679_10048091113300005530Corn RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKPTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKLRDQLGRRADALEAANRCARALSS
Ga0070672_10190631013300005543Miscanthus RhizosphereGAASLSAELERLRDVERWIAWVRLGAVPFAIFQVAIAANYPGNRELWAWIATAVLTVGALLIWAVSRRELPKRTLQRIGLAALCFDFAIVSAFLLLYSFEQASPIRQLMYLPLVEAALRYGILGALAVVAASAPVMIAFELLRERRTEPREFRVDYVTLQLGVEVLIGLIVGWLMLR
Ga0070664_10053651013300005564Corn RhizosphereVGAREAPLNGELRRLRDVERWIAWVRLAAVPFAIFQVAIAQDYPAGRELSAWLATGALGVGALAIFELSRRELTKSALQRIGLVALAFDFAIVSVYTLIFSFEQASPIRQLMYLPLVEGALRYGIIGALAVAAASAPVMVAFEWLRERRFEPRTFRLDYVTLQLGLEVLIGLIVG
Ga0074047_1109598613300006576SoilVNGELKRLRAVERWIGGIRLVAVPFAVFQVAITSGYPSRYEVWAWVTTGLFAVGALVLFRLGRKDWPRAAQHRLGAAALVFDFAAVSAYILIFSFEDSSPVRQVMYLPLIEAALRYGIWGAVAVVVASAPVMAVFEWLREHCPCAACGGPRPGTPEVVA
Ga0074059_1197657423300006578SoilMSGELQRLREVERWIAWVRLGAVPFAVFQVAIGANYPGDRELWGWLTTAFLTAGALALFALSRREWPKTTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQLMYLPLVEAALRYGIVGALGIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKLRDQLGRRADALEA
Ga0074062_1260912313300006606SoilMSGELQRLREVERWIAWVRLGAVPFAVFQVAIGANYPGDRELWGWLTTAFLTAGALALFALSRREWPKTTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQLMYLPLVEAALRYGIVGALGIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIV
Ga0075421_10136724113300006845Populus RhizosphereMNGELGRLRAVERWVGWIRLAAVPFAIFQVAISTYPGGSYELWAWVTTGVFTVGALVLFRLGRRDWSLGAQHRLGLAALGFDFAVVSAYVLIFNYEDASPIRQVMFLPLVEGALRYGIWGALAVVAASAPVMAVFEWLRQRH
Ga0075431_10181372313300006847Populus RhizosphereVNGELQRLRDVERWIGWVRLGAVPFAIFQVSISEHYPPHYELRAWLVTGIFALGTLALFALSRREWSKSALKRVGFAALTFDFAIVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALALAAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGI
Ga0075434_10191498413300006871Populus RhizosphereMNGELGRLRAVERWVGWIRLAAVPFAIFQIAISTYPGGSYELWAWLTTGIFSVGALVLFRLGRRDWSLGAQHRLGLAALGFDFAVVSAYVLIFNFEDASPIRQVMFLPLIEAALRYGIWGALAVVVASAPVMGVFEWLRQRHTEPHDYRLD
Ga0075434_10193238813300006871Populus RhizosphereRWVGWIRLAAVPFAIFQVAISTYPGGSYELWAWVTTGIFTVGALVLFRLGRRDWSLGAQHRLGLAALGFDFAVVSAYVLIFNYEDASPIRQVMFLPLVEGALRYGIWGALAVVAASAPVMAVFEWLRQRHTQPRDYRLDYVTLQLGIEVLMGLIVGWLVWRLQGETGVAEERAGESERLRDQLGRRADTLEAANRCAR
Ga0074063_1405576713300006953SoilMNGELQRLREVERWMAWVRLGAVPFAVFQVAIGANYPGDRELWGWLTTAFLTAGALALFALSRREWPKTTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQLMYLPLVEAALRYGIVGALGIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGL
Ga0075435_10172750813300007076Populus RhizosphereMNGELGRLRAVERWVGWIRLAAVPFAIFQVAISTYPGGSYELWAWVTTGVFTVGALVLFRLGRRDWSLGAQHRLGLAALGFDFAVVSAYVLIFNYEDASPIRQVMFLPLVEGALRYGIWGALAVVAASAPVMAVFEWLRQRHTQPRDYRLDYVTLQLGIE
Ga0104323_11923323300007821SoilVNGELKRLRDVERWIGWIRLAGVPFAAFQVAIGSGYPSGYRLWAWVTTAIFAAGASVLFLLSRREWERSALRRLGLAALIFDFAIVSAYVLVYSFEQGSPIRQIMFLPLVEAALRYGILGALVLAAASAPVMATFEWLRERHSAPRSYHLDYVTLQLGIEVLMGLIVGWLVLRLVGQTEVAETRAGEA
Ga0104325_10835823300007822SoilVNGELKRLRDVERWIGWIRLAGVPFAAFQVAIGSGYPSGYRLWAWVTTAIFAAGASVLFLLSRREWERSALRRLGLAALIFDFAIVSAYVLVYSFEQGSPIRQIMFLPLVEAALRYGILGALVLAAASAPVMATFEWLRERHSAPRSY
Ga0105250_1028961513300009092Switchgrass RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKPTLKRIGLVALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKLRDQLGRRADVLEAANRCARALSSSLQLDQAFDSFIREVR
Ga0105240_1276509713300009093Corn RhizosphereMGAREAPVNGELRRLRDVERWIGWVRLGAVPFAIFQVAIGENYPAHYELWEWITTAFFAVGTLALFALSRREWPKTTLKRIGLAALTFDFAIVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALALTAASAPVMAGFEWLRSDRYPPRTYHVDYVTLQLG
Ga0111539_1145194623300009094Populus RhizosphereMNGELGRLRAVERWVGWIRLAAVPFAIFQVAISTYPGGSYELWAWVTTGIITVGALVLFRLGRRDWSLGAQHRLGLAALGFDFAVVSAYVLIFNFEEASPIRQVMFLPLIEAALRYGIWGALAVVVASAPVMGVFEWLRQRHTEPHDYRLDYVTLQLGIEVLMGLIVGWLVWRLQGETGVAE
Ga0111538_1200790623300009156Populus RhizosphereMNGELGRLRAVERWVGWIRLAAVPFAIFQVAISTYPGGSYELWAWVTTGIFTVGALVLFRLGRRDWSLGAQHRLGLAALGFDFAVVSAYVLIFNYEDASPIRQVMFLPLVEGALRYGIWGALAVVAASAPVMAVFEWLRQRHTQPHDYRLDYV
Ga0105239_1278505313300010375Corn RhizosphereLSAELERLRDVERWIAWVRLGAVPFAIFQVAIATHSPGNRQFWAWIATAVLTVGAIAIWALSRREWPKRTLQRIGLAALCFDFAIVSVFTLIYSFEQASPIRQLMYLPLVEAALRYGILGALAVTAASAPVMIAFERLREQRVTPREFRVDYVTLQL
Ga0120146_103685823300011992PermafrostVNGELKRLRDVERWIGWIRLAGVPFAVFQVAIGSGYPSGYRVWAWVTTAIFALGAAVLFLLSRREWQRPAQRWLGLASLTFDFGIVSAYVLIYSFESASPIRQIMFLPLVEAALRYGIPGALGLAAASAPVMAIFEWLRARHSAPRSYHV
Ga0120156_103968213300011996PermafrostVNGELKRLRDVERWIGWIRLAGVPFAVFQVAIGSGYPSGYRVWAWVTTAIFALGAAVLFLLSRREWQRPAQRWLGLAALTFDFGIVSAYVLIYSFESASSIRQIMFLPLVEAALRYGIPGALGLAAASAPVMAIFEWLRARHSDPRSYHVDYVTLQLGIEVLMGLIVGWLVLRMV
Ga0120161_111289923300012005PermafrostVNGELKRLRDVERWIGWIRLAGVPFAAFQVAIGSGYPSGYRLWAWVTTAIFSAGASVLFLLSRREWERSALRRLGLAALIFDFAIVSAYVLVYSFEQGSPIRQIMFLPLVEAALRYGILGALVLAAASGPVMATFEWLRERHSAPRSYHLDYVTLQLGIEVLMGLIVGWLVLRLVGQTQVAET
Ga0157313_105545813300012503Arabidopsis RhizosphereMSGELRRLRAVERWVGWIRLVAVPFALFQVAISTYPGGSYELWAWVTTGIFTAGALVLFRLGRRDWTLAAQHRLGLAALGFDFAVVSAYVLIFNFEDASPIRQVMFLPLVEGALRSGIWGALAVVAASAPVMAVFEWLRQRHTEPHDYRLDYVTLQLGIE
Ga0157330_105983013300012514SoilVAVPFAVFQVAISTYPGGSYELWAWVTTGIFTAGALVLFRLGRRDWTLAAQHRLGLAALGFDFAVVSAYVLIFNFEDASPIRQVMFLPLVEGALRYGIWGALAVVAASAPVMAVFEWLRQRHTEPHDYRLDYVTLQLGIEVLMGLIVGWLVWRLQGETGVAEERAGESERLRDQLGRRADTLEAANR
Ga0157299_1013356323300012899SoilVNGELRRLRDVERWIGWVRLGAVPFAIFQVAIGQNYPGHYELWAWITTGIFAVGTLAIFGLSRREWPKTTLKRIGLAALTFDFAIVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAVTAASAPVMAGFEWLRQRRFEPRTYRVDYVTLQLGLEVLIGLIVGWLMLRLLKQSTVAETRAADAERLRDQLGRRAD
Ga0157289_1038505913300012903SoilFAIFQVAIAEGYPRHYELWAWITTGVLAAGALLMFGLSRREWPKETLKRIGLAALSFDFAIVSAYTLIYTFQPSSPIRQLMYLPLVEAALRYGIVGALAVAAASAPVMAGFEWLRSDRYPPRTYRVDYVTLQLGLEVLLGLIVGWLMLRLLGQSTVAETRAAEAEKLRDQLGR
Ga0157308_1007549213300012910SoilVGARKAPLNAELRRLRDVERWVAWVRLGAVPFAIFQVAIAEGYPRHYELWAWITTGVLAAGALLMFGLSRREWPKETLKRIGLAALSFDFAIVSAYTLIYTFQPSSPIRQLMYLPLVEAALRYGIVGALAVAAASAPVMAGFEWLRSDRYPPRTYRVDYVTLQLGLEVLLGLIVGWLMLRLL
Ga0162652_10002872813300012941SoilMGAPAARGARVNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGLFTVGALVLFWLSRRDWPRATQSRLGLIALAFDFAVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVAASAPVMAVFELLRERRSEPRTYHLDYVTLQLGIELLMG
Ga0164300_1090212423300012951SoilMNGELKRLRDVERWIGWIRAAAVPFAAFQVAIGSGYPPGYEVWAWSTTMIFAAGAAVLFLLSRREWPLPAQRRLGLAALTFDFAIVSAYVLIYSFEQGSPVRQIMFLPLVEAALRYGILGALVLTGASAAVMATFEWLRERHSAPRSYHLDYVTLQL
Ga0164300_1105789613300012951SoilGAVPLAIFQVAIGQHYPAGRELWAWLTTAALGVGAIAIFALSRRDLTKQALQRIGLAALAFDFAIVSVYTLIFSFEAASPIRQVMYLPLVEAALRYGIVGALAVAVASAPVMAGFEWVRERRFEPHTFRVDYVTLQLGLEVLIGLIVGWLMLRLLGQTRVAETRAADAERLRDQL
Ga0164300_1119248913300012951SoilFFQVAIARHYPADYELWAWLTTGVLAVGAPAFWAISRREWTKEALKRIGLAALTFDFAVASAYTLIYSFEQASPVRQVMYLPLVEAALRYGIVGALALTAASAPVMAGYEWLRSDRFAPHRYHVDYVTLQLGLEVLLGLIVGWLMLRLLGQSTVAETRAVEAEKLRD
Ga0164303_1045101613300012957SoilVGASEAQLNGELRRLQDTERWIAWVRLGAVPLAIFQVAIGQHYPAGRELWAWLATAALGVGAIAIFALSRRDLTKQALQRIGLAALAFDFAIVSVYTLIFSVEAASPIRQVMYLPLVEAALRYGIVGALAVAVASAPVMAGFEWVRERRFEPHTYRFD
Ga0164299_1113040013300012958SoilRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKTTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKLRDQLGRRADALEAANRCARALS
Ga0164309_1074736913300012984SoilMNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYEVWAWMTTMIFAAGAAVLFLLSRREWPLPAQRRLGLAALTFDFAIVSAYVLIYSFEQGSPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHSAPRSYHLDYVTLQLGIEVLMGLIVGWL
Ga0164308_1098610113300012985SoilVNGELRRLRDVECWIGWVRLGAVPFAIFQVAIGEHYPRHYELWAWITTGIFAVGALAFFALSRREWPKTALKRIGLAALTFDFAVASAYTLIYSFEQASPVRQVMYLPLVEAALRYGIVGALALTAASAPVMAGYEWLRSDRFAPHRYHVDYVTLQLGLEVLLGLIVGWLMLRLLGQSTVAETRAVEAEKLRDQLGRRADVLESANRCARALS
Ga0164307_1075962913300012987SoilMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKTTLKRIGLAALTFDFAVASAYTLIYSFEQASPVRQVMYLPLVEAALRYGIVGALALTAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQTRVAETRAADAERLRDQLGRRADALEAANRCARALSSS
Ga0164306_1141660513300012988SoilRASGVGTSEAPLNGELRRLQDTERWIAWVRLGAVPLAVFQVAIGQHYPAGRELWAWLTTAALGLGAIAIFALSRRDLTKQALQRIGLAALAFDFAIVSVYTLIFSFEAASPIRQVMYLPLVEAALRYGIVGALAVAVASAPVMAGFEWVRERRFEPHTYRFDYVTLQLGLEVLIGLIVGWLMLRLLGQTRVAETRAA
Ga0164305_1009619713300012989SoilMNGELQRLRDVERWIGWVRLGAVPFAIFQVALGANYPRGYEVRAWITTGILTVGAVALFVVSRREWPKATLKRIGLAALAFDFAIVSAYTLIYSFEPASPIRQVMYLPLVEAALRYGIVGALAVTVASAPVMVAFEWLRSGRYPPRTFHLDYVTLQLGIEVLLGLIVGWLMLRLLGQ
Ga0157378_1178419713300013297Miscanthus RhizosphereVNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGLFTVGALVLFWLSRRAWPQVTQSRLGLVALVFDFAVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVAASAPVMAVFESLREQRSDPRTYHLDYVTLQLGIELLMGLFV
Ga0157378_1218757913300013297Miscanthus RhizosphereLSAELERLRDVERWIAWVRLGAVPFAIFQVAIATHSPGNRQVWAWIATAVLTVGAIAIWALSRREWPKRTLQRIGLAALCFDFAIVSVFTLIYSFEQASPIRQLMYLPLVEAALRYGILGALAVTAASAPVMIAFERLREQRVTPREFRVDYVTLQ
Ga0163162_1062628413300013306Switchgrass RhizosphereMNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGVFTVGALALFWLSRRDWPRTTQSRLGLVALAFDFAVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVAASAPVLAVFESLREHRSDPRTYHLDYVTLQLGIELLMGL
Ga0157375_1136002413300013308Miscanthus RhizosphereVGAREAPLNGELRRLRDVERWIAWVRLAAVPFAIFQVAIAQDYPAGRELSAWLATGALGVGALAIFELSRRELTKSALQRIGLVALAFDFAIVSVYTLIFSFEQASPIRQLMYLPLVEGALRYGIIGALAVAAASAPVMVAFEWLRERRFEPRTFRLDYVTLQLGLEVLIGLIVGWLMLRLVGQTRVAEARA
Ga0157379_1073189723300014968Switchgrass RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKATLKRIGLVALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKLR
Ga0137409_1091401413300015245Vadose Zone SoilVNGELRRLRDVERWIGWVRLGAVPFAIFQVAIGEHYPRHYELWAWITTGIFAVGALAFFALSRREWSKTALKRIGLAALTFDFAIASTYTLIYSFEQASPVRQVMYLPLVEAALRYGIVGALALTAASGPVMAGYEWLRSDRFAPHRYHVDYVTLQLGLEVLLGLIVGWLMLRLLGQSTVAETRAVEAEKLRDQL
Ga0184608_1037284813300018028Groundwater SedimentVNGELRRLRAVERWIGWVRLGAVPFAIFQVSVTNDYPHGYRLWGWITTAVLVAGGLTFFWLGRRDWKQTAQRRLGLAALAFDFAIASAYALIYSFESDSPIREVMFLPLVEAALRYGIAGALVLVAMSAPVMAVFEWLRERRFAPHDYHVSYVTLQLGLEVLLGLIVGWLVHRLGGQTTVAETR
Ga0184619_1019887813300018061Groundwater SedimentVNGELKRLRAVERWIGWVRLGAIPFAIFQVSVASGYPDGYLLWGWVTTAVLAAGGLTFFWLGRQDWETSAQRRLGLAALTFDFAIASAYTLIYHFEPDSPIRQVMFLPLVEAALRYGIVGALVLAVASAPVMAVFEWLRERRFEPHRYHLNYVTLQFGLEVLVGLIVGWLVLRLLGQTTVAEARAGE
Ga0184618_1014033213300018071Groundwater SedimentMNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWITTMIFAAGAAVLFVLSRREWPRTAQRRLGLAALTFDFAIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHSAPRSYHVDYVTLQLGIEVLMGLIVG
Ga0190269_1193456213300018465SoilFAIFQVSVASGYPDRYLLWGWVTTAVLAAGGLTFFWLGRQDWETSAQRRLGLAALTFDFAIASAYTLIYHFEPDSPIRQVMFLPLVEAALRYGIVGALVLAVASAPVMAVFEWLRERRFEPHRYHLNYVTLQFGLEVLVGLIVGWLVLRLLGQTTVAEARAGEAERLRD
Ga0184642_158429813300019279Groundwater SedimentMNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWITTMIFAAGAAVLFVLSRREWPRTAQRRLGLAALTFDFAIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHGAPRSYHVD
Ga0173482_1029518323300019361SoilVGARKAPLNAELRRLRDVERWVAWVRLGAVPFAIFQVAIAEGYPRHYELWAWITTGVLAAGALLMFGLSRREWPKETLKRIGLAALSFDFAIVSAYTLIYTFQPSSPIRQLMYLPLVEAALRYGIVGALAVAAASAPVMAGFEWLRSDRYPPRTYRVDYVTLQLG
Ga0193704_100934333300019867SoilVNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGVFTVGALVLFWLSRREWPRATQSRLGLVALAFDFAVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVAASAPVMAVFESLREHRSDPRTYHLDYVTLQLGIELLMGLFVGWLVGRLRSETAVAEERAGEAERLR
Ga0210382_1034889313300021080Groundwater SedimentMNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWITTMIFAAGAAVLFVLSRREWPRTAQRRLGLAALTFDFAIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHGAPRSYHVDYVTLQLGIEVLMGLIVGWLV
Ga0222621_104117823300021510Groundwater SedimentVNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGLFTVGALVLFWLSRRDWPRTTQSRLGLVALAFDFAVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVILVAASAPVMAVFESLREHRSDPRTYHLDYVTLQLGIELLMGLFVGWLV
Ga0193698_105477113300021968SoilRLRDAERWIAWVRLGAVPFAVFQVAIGQNYPRDYELWAWITTGILAIGALTLFALSRREWPTATLKRIGLAALTFDFAVASAYTLIYSFEQASPVRQVMYLPLVEAALRYGIVGALALTAASAPVMAGYEWLRSDRFAPHRYHVDYVTLQLGLEVLLGLIVGWLMLRLL
Ga0207682_1025856723300025893Miscanthus RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKPTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQLMYLPLVEAALRYGILGALAVTAASAPVMIAFERLREQRVTPREFRVDYVTLQLGLEVLIGLIVGWLMLRLLGQSSVAETRAAD
Ga0207645_1078021913300025907Miscanthus RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKPTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKLRDQLGR
Ga0207695_1154616213300025913Corn RhizosphereNSELWGWLTTAFLAVGALALFALSRREWPKPTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKLRDQLGRRADALEAANRCARALSSSLEL
Ga0207690_1034561813300025932Corn RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKATLKRIGLVALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAEKL
Ga0207690_1171457113300025932Corn RhizosphereRDVERWIAWVRLGAVPFAIFQVAIATHSPGNRQVWAWIATAVLTVGAIAIWALSRREWPKRTLQRIGLAALCFDFAIVSVFTLIYSFEQASPIRQLMYLPLVEAALRYGILGALAVTAASAPVMISFERLREQRVTPREFRVDYVTLQLGVEVLIGLIVGWLMLRLLGQSSVAET
Ga0207709_1103369323300025935Miscanthus RhizosphereVNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGVFTVGALALFWLSRRDWPRTTQSRLGLVALAFDFAVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVAASAPVMAVFESLREQRSDPRTYHLDYVTLQ
Ga0207709_1138347513300025935Miscanthus RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKTTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTV
Ga0207709_1158853913300025935Miscanthus RhizosphereFAIFQVAIGASYPPHYELWAWITTGIFTVGTLALFALSRREWPKTTLKRIGLAALTFDFAIVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALALTAASAPVMAGFEWLRSDRYPPRTYHVDYVTLQLGLEVLLGLIVGWLMQRLVGQSTVAETRAAESEKLRDQLGRRADVLEA
Ga0207711_1159335713300025941Switchgrass RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKATLKRIGLVALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEA
Ga0207689_1030698923300025942Miscanthus RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKTTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAAEAE
Ga0207679_1045663713300025945Corn RhizosphereVGAREAPLNGELRRLRDVERWIAWVRLAAVPFAIFQVAIAQDYPAGRELSAWLATGALGVGALAIFELSRRELTKSALQRIGLVALAFDFAIVSVYTLIFSFEQASPIRQLMYLPLVEGALRYGIIGALAVAAASAPVMVAFEWLRERRFEPRTFRLDYVTLQLGLEVLIGLIVGWLMLRLV
Ga0207640_1036112013300025981Corn RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKPTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVG
Ga0207677_1231287413300026023Miscanthus RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKPTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQ
Ga0207676_1242658513300026095Switchgrass RhizosphereSAELERLRDVERWIAWVRLGAVPFAIFQVAIATGYPGNREFWAWLATAALTVGALAFFWLSRREWPKRTLQGIGLTALCFDFATVSVYTLIYSYESDSPIRQLMYLPLVEAALRYGILGALAVVAASAPVMIAFESLRERRLAPHEFRVDYVTLQLGLEVLIGLIVGWLMLRL
Ga0207698_1140441313300026142Corn RhizosphereMNGELQRLRDVERWIAWIRLGAVPFAVFQVAIGANYPGNRELWGWLTTAFLAVGALALFALSRREWPKPTLKRIGLAALTFDFAVVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALAIVAASAPVMAGYEWLRSDRFAPHDYRVDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAE
Ga0209811_1036652713300027821Surface SoilNGELRRLRDVERWIGWVRLGAVPFAIFQVALAGGYPDGYELRAWITTGILTVGTLVLFVLSRREWPKATLKRIGLGALAFDFAIASAYTLIYSFQPASPIRQVMYLPLVEAALRYGIVGALAVTAASAPVMVAFEWLRSGRYPPRTFHLDYVTLQLGIEVLLGLIVGWLMLRLLGQSTVAEARAA
Ga0268264_1098519423300028381Switchgrass RhizosphereVNGELKRLRDVERWIGGIRLAAAPFAIFQVAIASGYPSGYRVWAWVTTGVFTVGALALFWLSRRDWPRTTQSRLGLVALAFDFAVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVAASAPVLAVFESLREHRSDPRTYHLDYVTLQLGIELLMGLFVGWLVGRLRSETAVAEERAGEAERLR
Ga0247822_1180120413300028592SoilYELWAWITTGIFAVGALAFFALSRREWSKTVLKRIGLAALTFDFAIASTYTLIYSFEQASPVRQVMYLPLVEAALRYGIVGALALTAASAPVMAGYEWLRSDRFAPHRYHVDYVTLQLGLEVLLGLIVGWLMLRLLGQSTVAETRAVEAEKLRDQLGRRADVLESANRCARALS
Ga0307321_114566413300028704SoilARVNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGLFTVGALALFWLSRRDWPQATQSRLGLVALAFDFVVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVVASAPVMAVFESLREHRSDPRTYHLDYVTLQLGIELLMSL
Ga0307293_1025394613300028711SoilVNGELRRLRAVERWIGWVRLGAVPFAIFQVSVTNDYPHGYRLWGWITTAVLVAGGLTFFWLGRRDWKQTAQRRLGLAALAFDFAIASAYALIYSFESESPIREVMFLPLVEAALRYGIAGALVLVAMSAPVMAVFEWLRERRFAPHDYHVSYVTLQLGLEVLLGLIVGWLVHRLGG
Ga0307309_1002797023300028714SoilMNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWITTMIFAAGAAVLFVLSRREWPRTAQRRLGLAALTFDFAIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHSAPRSYHVDYVTLQLGIEVLMGLIVGWLVLRLVGQTEVAETRAGEAERLRDQLG
Ga0307311_1001283913300028716SoilMNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWITTMIFAAGAAVLFVLSRREWPRTAQRRLGLAALTFDFAIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHGAPRSYHVDYVTLQLGIEVLMGLIVGWLVLRLVGQTEVAETTAGEAE
Ga0307311_1003506013300028716SoilVNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGLFTVGALALFWLSRRDWPQATQSRLGLVALAFDFVVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVAASAPVMAVFESLREHRSDPRTYHLDYVTLQLG
Ga0307307_1002644523300028718SoilVNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWSTTMVFAAGSAVLFLLSRREWPRPAQRRLGLAALTFDFLIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHSAPRSYHVDYVTLQLGIEVLM
Ga0307317_1015075813300028720SoilVNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWSTTMVFAAGSAVLFLLSRREWPRPAQRRLGLAALTFDFLIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHGAPRSYHVDYVTLQLGIEVLMGLIVGWLVL
Ga0307315_1006949313300028721SoilVNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGLFTVGALALFWLSRRDWPQATQSRLGLVALAFDFVVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVAASAPVMAVFESLREHRSDPRTYHLDYVTLQLGIELLMGL
Ga0307318_1020511523300028744SoilVNGELKRLRDVERWIGGIRLAAVPFAIFQVAIASGYPSGYRVWAWVTTGLFTVGALALFWLSRRDWPQATQSRLGLVALAFDFVVVSAYVLIFSFEDASPVRQLMYLPLVEAALRYGIWGAVVFVAASAPVMAVFESLREHRSDPRTYHLDY
Ga0307316_1029521313300028755SoilVNGELRRLRDVERWIGWVRLGAVPLAVFQVAIGQHYPPHYELWAWLVTGILAVGALAIFALSRREWSKAALKRIGFAALTFDFAIVSAYTLIFSFEQASPIRQVMYLPLVEAALRYGIVGAVALTAASAPVMAGYEWLRSDRFAPHRYHVDYVTLQLGLEVLLGLIVGWLMLRL
Ga0307320_1005278913300028771SoilVNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWSTTMVFAAGSAVLFLLSRREWPRPAQRRLGLAALTFDFLIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHGAPRSYHVDY
Ga0307288_1039484113300028778SoilAALNGELQRLRDVERWIAWVRLGAVPLAIFQVAIGQHYPAGRELWAWLTTAALAVGALVLFALGRRELTKPALQRIGVAALAFDFAIVSAYTLIFSFESASPIRQVMYLPLVEAALRYGIVGALAVTAASAPVMAGFEWVRERRFEPHTYRVDYVTLQVGLEVMIGLIVGWLMLRVLGQTRVAETR
Ga0307282_1002793533300028784SoilVNGELKRLRDVERWIGWVRLGAVPFAIFQVAIGRNYPGDYRLWAWVTTGLLAVGTLLIFWLSRRDWPKASLKRLGFAALTFDFAIVSAYTLIYSFEPSSPIRQLMYLPLVEAALRYGIRGALVVVVASAPVMVAFEWLRERRLAPRSYHLDYVTLQLGLEVLLGLIVGWLMLRLLGQTTVAESR
Ga0307282_1041728913300028784SoilVNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWSTTMVFAAGSAVLFLLSRREWPRPAQRRLGLAALTFDFLIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHGAPRSYHVDYVTLQLGIEVLMGLIVGWLVLRLVGQTEVAETRAGEAERLRDQLG
Ga0307282_1043733323300028784SoilVNGELRRLRAVERWIGWVRLGAVPFAIFQVSVTNDYPHGYRLWGWITTAVLIVGGLTFFWLGRRDWKQAAQRRLGLAALAFDFAIASAYALIYSFESESPIREVMFLPLVEAALRYGIAGALVLVAMSAPVMAVFEWLRERRFAPHDYHVSYVTLQLGLEVLLGLIVGWLVHRLGGQTTV
Ga0307284_1030254913300028799SoilVNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWSTTMVFAAGSAVLFLLSRREWPRPAQRRLGLAALTFDFLIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHGAPRSYHVDYVTLQLGIEVLMGLIVGWLVLRLVGQ
Ga0247824_1095892113300028809SoilRVNGELRRLRDVERWIGWVRLGAVPFAIFQVAIGANYPPHYELWAWITTGIFTVGTLALFALSRREWPKTTLKRIGLAALTFDFAIVSAYTLIYSFEQASPIRQVMYLPLVEAALRYGIVGALALTAASAPVMAGFEWLRSDRYPPRTYHVDYVTLQLGLEVLLGLIVGWLMQRLVGQS
Ga0307294_1010889623300028810SoilMNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWITTMIFAAGAAVLFVLSRREWPRTAQRRLGLAALTFDFAIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHGAPRSYHVDYVTLQLGIEVLMGLIVGWLVLRLVGQTEVAETRAGEA
Ga0307302_1057978913300028814SoilRMNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWSTTMVFAAGSAVLFLLSRREWPRPAQRRLGLAALTFDFLIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHGAPRSYHVDYVTLQLGIEVLMGLIVGWLVLRLVGQTEVAETR
Ga0307310_1021410913300028824SoilVNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWSTTMVFAAGSAVLFLLSRREWPRPAQRRLGLAALTFDFLIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHGAPRSYHV
Ga0307289_1007805023300028875SoilVNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWSTTMVFAAGSAVLFLLSRREWPRPAQRRLGLAALTFDFLIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHSAPRSYH
Ga0307278_1035771913300028878SoilVNGELKRLRAVERWIGWVRLGAIPFAIFQVSVASGYPDGYLLWGWVTTAVLAAGGLTFFWLGRQDWETSAQRRLGLAALTFDFAIASAYTLIYHFEPDSPIRQVMFLPLVEAALRYGIVGALVLAVASAPVMAVFEWLRERRFEPHRYHLNYVTLQFG
Ga0307300_1031957713300028880SoilERWIGWVRLGAIPFAIFQVSVASGYPDGYLLWGWVTTAVLAAGGLTFFWLGRQDWETSAQRRLGLAALTFDFAIASAYTLIYHFEPDSPIRQVMFLPLVEAALRYGIVGALVLAVASAPVMAVFEWLRERRFEPHRYNLNYVTLQFGLEVLVGLIVGWLVLRLLGQTTVAEARAGE
Ga0307308_1014714823300028884SoilMNGELKRLRDVERWIGWIRAVAVPFAAFQVAIGSGYPPGYRVWAWITTMIFAAGAAVLFVLSRREWPRTAQRRLGLAALTFDFAIVSAYVLIYSFEQASPVRQIMFLPLVEAALRYGILGALVLTAASAPVMATFEWLRERHSAPRSYHVDYVTLQLGIEVLMGLIVGWLVLRLVGQTEVAETRAGEAERLRD
Ga0307304_1000541073300028885SoilVNGELKRLRDVERWIGWVRLGAVPFAIFQVAIGRNYPGDYRLWAWVTTGLLAVGTLLIFWLSRRDWPKASLKRLGFAALTFDFAIVSAYTLIYSFEPSSPIRQLMYLPLVEAALRYGIRGALVVVVASAPVMVAFEWLRERRLAPRSYHLDYV
Ga0308201_1035955513300031091SoilVNGELKRLRDVERWIGWVRLGAVPFAIFQVAIGRNYPGDYRLWAWVTTGLLAVGTLLIFWLSRRDWPKASLKRLGFAALTFDFAIVSAYTLIYSFEPSSPIRQLMYLPLVEAALRYGIRGALVVVVASAPVMVAFEWLRERRLAPRSYHLDYVT
Ga0247830_1089541723300033551SoilVNGELRRLRDVERWIGWVRLGAVPFAIFQVAIGEHYPRHYELWAWITTGIFAVGALAFFALSRREWSKTALKRIGLAALTFDFAIASAYTLIYSFEQASPVRQVMYLPLVEAALRYGIVGALALTAASAPVMAGYEWLRSDRFAPHRYHVDYVTLQLGLEVLLGLIVGWLMLRLLGQSTVAETRAIEAEK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.