| Basic Information | |
|---|---|
| Family ID | F074179 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MDNVTMIRVAAGVLAVILLAIVIARRKRMASSKRVTPRK |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.33 % |
| % of genes near scaffold ends (potentially truncated) | 10.00 % |
| % of genes from short scaffolds (< 2000 bps) | 50.83 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (17.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02643 | DUF192 | 41.67 |
| PF00482 | T2SSF | 33.33 |
| PF07811 | TadE | 10.00 |
| PF13400 | Tad | 4.17 |
| PF13629 | T2SS-T3SS_pil_N | 1.67 |
| PF00072 | Response_reg | 0.83 |
| PF01656 | CbiA | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| PF08666 | SAF | 0.83 |
| PF08308 | PEGA | 0.83 |
| PF00491 | Arginase | 0.83 |
| PF00437 | T2SSE | 0.83 |
| PF13817 | DDE_Tnp_IS66_C | 0.83 |
| PF00528 | BPD_transp_1 | 0.83 |
| PF01625 | PMSR | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG1430 | Uncharacterized conserved membrane protein, UPF0127 family | Function unknown [S] | 41.67 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.83 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573002|GZIGXIF02I6BFZ | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 522 | Open in IMG/M |
| 3300001385|JGI20193J14888_1006534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2618 | Open in IMG/M |
| 3300003369|JGI24140J50213_10013160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3152 | Open in IMG/M |
| 3300004152|Ga0062386_100005092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9115 | Open in IMG/M |
| 3300004152|Ga0062386_100005575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8759 | Open in IMG/M |
| 3300004152|Ga0062386_100066939 | All Organisms → cellular organisms → Bacteria | 2724 | Open in IMG/M |
| 3300004152|Ga0062386_100088181 | All Organisms → cellular organisms → Bacteria | 2374 | Open in IMG/M |
| 3300004152|Ga0062386_100300370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1280 | Open in IMG/M |
| 3300004472|Ga0068974_1185945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 560 | Open in IMG/M |
| 3300004635|Ga0062388_100862743 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005524|Ga0070737_10005884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11494 | Open in IMG/M |
| 3300005529|Ga0070741_10007867 | All Organisms → cellular organisms → Bacteria | 21757 | Open in IMG/M |
| 3300005529|Ga0070741_11236227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 628 | Open in IMG/M |
| 3300005533|Ga0070734_10027939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3607 | Open in IMG/M |
| 3300005533|Ga0070734_10032751 | All Organisms → cellular organisms → Bacteria | 3272 | Open in IMG/M |
| 3300005538|Ga0070731_10515864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300006642|Ga0075521_10163463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300006795|Ga0075520_1001842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10381 | Open in IMG/M |
| 3300006795|Ga0075520_1255339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300006861|Ga0063777_1411064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300009547|Ga0116136_1170070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300009617|Ga0116123_1056871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300009665|Ga0116135_1004523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5641 | Open in IMG/M |
| 3300009665|Ga0116135_1021549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2210 | Open in IMG/M |
| 3300009762|Ga0116130_1015845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2577 | Open in IMG/M |
| 3300009870|Ga0131092_10521656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300010143|Ga0126322_1249380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300010341|Ga0074045_10782411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300010376|Ga0126381_100236199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2467 | Open in IMG/M |
| 3300010379|Ga0136449_103437129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 605 | Open in IMG/M |
| 3300010397|Ga0134124_12271124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300011064|Ga0138525_1119603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300011082|Ga0138526_1209278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300012469|Ga0150984_113380645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300012469|Ga0150984_114533219 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300014155|Ga0181524_10046439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2800 | Open in IMG/M |
| 3300014155|Ga0181524_10233476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 875 | Open in IMG/M |
| 3300014156|Ga0181518_10001525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 23749 | Open in IMG/M |
| 3300014159|Ga0181530_10653366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300014162|Ga0181538_10285384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300014164|Ga0181532_10000009 | All Organisms → cellular organisms → Bacteria | 263954 | Open in IMG/M |
| 3300014164|Ga0181532_10094710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1870 | Open in IMG/M |
| 3300014200|Ga0181526_10217946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300014325|Ga0163163_11116530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300014492|Ga0182013_10055097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2979 | Open in IMG/M |
| 3300014501|Ga0182024_12791147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300014654|Ga0181525_10059841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2152 | Open in IMG/M |
| 3300016702|Ga0181511_1027392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10298 | Open in IMG/M |
| 3300016702|Ga0181511_1121830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1947 | Open in IMG/M |
| 3300016702|Ga0181511_1487023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10329 | Open in IMG/M |
| 3300016730|Ga0181515_1050638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5650 | Open in IMG/M |
| 3300016750|Ga0181505_10196275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300017823|Ga0187818_10494879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 548 | Open in IMG/M |
| 3300017935|Ga0187848_10018122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3767 | Open in IMG/M |
| 3300017948|Ga0187847_10008595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6934 | Open in IMG/M |
| 3300017948|Ga0187847_10051293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2354 | Open in IMG/M |
| 3300017948|Ga0187847_10284910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 902 | Open in IMG/M |
| 3300017970|Ga0187783_10026774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4273 | Open in IMG/M |
| 3300018009|Ga0187884_10096473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300018019|Ga0187874_10009279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5798 | Open in IMG/M |
| 3300018025|Ga0187885_10030098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2955 | Open in IMG/M |
| 3300018030|Ga0187869_10148767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300018030|Ga0187869_10257366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300018034|Ga0187863_10044337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2564 | Open in IMG/M |
| 3300018038|Ga0187855_10234510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300018057|Ga0187858_10014442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6399 | Open in IMG/M |
| 3300018090|Ga0187770_10328075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1194 | Open in IMG/M |
| 3300021406|Ga0210386_10086364 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
| 3300022524|Ga0224534_1025352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1501 | Open in IMG/M |
| 3300022533|Ga0242662_10114405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300022724|Ga0242665_10171826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300024295|Ga0224556_1005690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3432 | Open in IMG/M |
| 3300025474|Ga0208479_1041125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300025475|Ga0208478_1034209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1002 | Open in IMG/M |
| 3300025481|Ga0208079_1001247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13482 | Open in IMG/M |
| 3300025650|Ga0209385_1020106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2700 | Open in IMG/M |
| 3300025650|Ga0209385_1184025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300025650|Ga0209385_1214831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300025878|Ga0209584_10302501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300027394|Ga0209904_1001408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2031 | Open in IMG/M |
| 3300027773|Ga0209810_1225734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300027812|Ga0209656_10008970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6349 | Open in IMG/M |
| 3300027812|Ga0209656_10026244 | All Organisms → cellular organisms → Bacteria | 3506 | Open in IMG/M |
| 3300027826|Ga0209060_10056725 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300027869|Ga0209579_10031679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2882 | Open in IMG/M |
| 3300027968|Ga0209061_1013647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4895 | Open in IMG/M |
| 3300028800|Ga0265338_10049844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3790 | Open in IMG/M |
| 3300030629|Ga0210268_1124046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300031040|Ga0265754_1012349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300031231|Ga0170824_126367433 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031234|Ga0302325_10025166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12371 | Open in IMG/M |
| 3300031235|Ga0265330_10334899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300031446|Ga0170820_11039575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300031708|Ga0310686_115950510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 782 | Open in IMG/M |
| 3300031939|Ga0308174_10874522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 758 | Open in IMG/M |
| 3300032160|Ga0311301_10011530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 27905 | Open in IMG/M |
| 3300032160|Ga0311301_10113575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5170 | Open in IMG/M |
| 3300032515|Ga0348332_11937930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1353 | Open in IMG/M |
| 3300032770|Ga0335085_10008936 | All Organisms → cellular organisms → Bacteria | 15182 | Open in IMG/M |
| 3300032783|Ga0335079_10002216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22450 | Open in IMG/M |
| 3300032783|Ga0335079_10071346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3954 | Open in IMG/M |
| 3300032783|Ga0335079_10275156 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300032805|Ga0335078_10256024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2384 | Open in IMG/M |
| 3300032828|Ga0335080_11425659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 688 | Open in IMG/M |
| 3300032829|Ga0335070_10392629 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300032892|Ga0335081_10002677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 28020 | Open in IMG/M |
| 3300032892|Ga0335081_10009956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15323 | Open in IMG/M |
| 3300032892|Ga0335081_10065343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5606 | Open in IMG/M |
| 3300032892|Ga0335081_11451878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300032893|Ga0335069_10291327 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300032895|Ga0335074_10002325 | All Organisms → cellular organisms → Bacteria | 25885 | Open in IMG/M |
| 3300032895|Ga0335074_10177023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2646 | Open in IMG/M |
| 3300032895|Ga0335074_10540743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1190 | Open in IMG/M |
| 3300032898|Ga0335072_10113975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3417 | Open in IMG/M |
| 3300032898|Ga0335072_10159631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2747 | Open in IMG/M |
| 3300033134|Ga0335073_10053255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5398 | Open in IMG/M |
| 3300033134|Ga0335073_10060954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5000 | Open in IMG/M |
| 3300033134|Ga0335073_10150857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2943 | Open in IMG/M |
| 3300033134|Ga0335073_11252194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 739 | Open in IMG/M |
| 3300033402|Ga0326728_10003389 | All Organisms → cellular organisms → Bacteria | 49731 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 17.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 14.17% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 10.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 8.33% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.67% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.83% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.83% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.83% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300001385 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004472 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_00185940 | 2189573002 | Grass Soil | MDTLTMLRVVAGTIAVILLVVIVARRKRMASAKRPGARY |
| JGI20193J14888_10065342 | 3300001385 | Arctic Peat Soil | MDSVLIIRIIAGVVAVALLAIIVARRKRMASANRLTSKH* |
| JGI24140J50213_100131604 | 3300003369 | Arctic Peat Soil | MDSVLMIRIGAGVVAVILLAIIVARRKRMASANRLTSKH* |
| Ga0062386_10000509210 | 3300004152 | Bog Forest Soil | MDNVLMIRVIAGILAVILLTIIIARRKRMASMKRPPTRT* |
| Ga0062386_1000055753 | 3300004152 | Bog Forest Soil | MDNITLIRIVAGVVAVILLAIVVTRRKRMASSRQAALRK* |
| Ga0062386_1000669393 | 3300004152 | Bog Forest Soil | MDSVTMIRMAAGVVAVVLLGVIIARRKRMSSSRRTSPRR* |
| Ga0062386_1000881812 | 3300004152 | Bog Forest Soil | MDSVTMIRVAAGVLAVILLGVIIARRKRMAAARRSSPRR* |
| Ga0062386_1003003702 | 3300004152 | Bog Forest Soil | MDSVTMIRMAAGVLAVVLLGVIIARRKRMSTARRTSPKR* |
| Ga0068974_11859452 | 3300004472 | Peatlands Soil | METMDGVTMIRVVAGVLAVVLLGIVIARRKRMSATKRMTPPRK* |
| Ga0062388_1008627432 | 3300004635 | Bog Forest Soil | MDNTTMIRAGAAVLIVILLAIIIARRKRMASSKRVTPRK* |
| Ga0070737_100058848 | 3300005524 | Surface Soil | MIRVVAGIVAVILLAIIIARRKRMASARRTTTPKR* |
| Ga0070741_1000786714 | 3300005529 | Surface Soil | MDTVTMIRLAAGVLAVILLGVIIARRKRLSSARRPTVKR* |
| Ga0070741_112362272 | 3300005529 | Surface Soil | MDNVLMVRIVAGGIAVILLAVIIARRKRMASAKRLASRR* |
| Ga0070734_100279392 | 3300005533 | Surface Soil | MDSVTMIRLAAGVLAVILLGVIIARRKRLSSARRPTPKR* |
| Ga0070734_100327513 | 3300005533 | Surface Soil | MDTVTLIRLAAGALAVVLLGVIVARRKRMASARGNGLKRY* |
| Ga0070731_105158642 | 3300005538 | Surface Soil | MDSVTMIRVAAGALAIVLLGVIVARRKRMSSTSSSKRMSAKR* |
| Ga0075521_101634632 | 3300006642 | Arctic Peat Soil | MDSVLMIRIGAGVIAVILLAIIVARRKRMASANRLTSANRLTSKH* |
| Ga0075520_10018423 | 3300006795 | Arctic Peat Soil | MDNVTMIRVAAAVVAVILLAIVIARRKRMAAGRRMTPKK* |
| Ga0075520_12553392 | 3300006795 | Arctic Peat Soil | MDSVLMIRIAAGVIAVILLAIIVARRKRMASANRLTSKH* |
| Ga0063777_14110643 | 3300006861 | Peatlands Soil | MDNVMMIRVVAGVIAVILLAIVIARRKRMASGKRITPKK* |
| Ga0116136_11700701 | 3300009547 | Peatland | MDNVTMIRLAAGVLAVILLAIVIARRKRMAASKRVTPRK* |
| Ga0116123_10568712 | 3300009617 | Peatland | MDNVTMIRVAAGVLAVILLAIVIARRKRMASSKRVTPRK* |
| Ga0116135_10045234 | 3300009665 | Peatland | MDNVTMVRVAAGVLAVILLAIVIARRKRMASSKRVTPRK* |
| Ga0116135_10215492 | 3300009665 | Peatland | MDVTMVRVIAGVVAVILLAVIVTRRKRMASAKRPTPKR* |
| Ga0116130_10158454 | 3300009762 | Peatland | MDNVTMIRVAAGVLAVILLAIVIARRKRMAASKRVTPRK* |
| Ga0131092_105216563 | 3300009870 | Activated Sludge | MDSVAMIRLIAGVVAVVLVAMIVARRKRMAPNKR* |
| Ga0126322_12493801 | 3300010143 | Soil | ARNMYTVTMIRVVAGGLAVLLLMVVIARRKRMSSAKRPSAKR* |
| Ga0074045_107824111 | 3300010341 | Bog Forest Soil | MDSVTMIRVAAGVLAVILLGVIIARRKRMSSARRPSARR* |
| Ga0126381_1002361994 | 3300010376 | Tropical Forest Soil | MDNVTMVRVVAGVLAVLLLGVIVARRKRMSSSKRPTVKR* |
| Ga0136449_1034371292 | 3300010379 | Peatlands Soil | MDGVTMIRMVAGVVAVVLLGIIIARRKRLSSARRPTPRR* |
| Ga0134124_122711242 | 3300010397 | Terrestrial Soil | MDGVTMIRVVAGVLAVILLFIIIARRKRMSSVRRTNTKR* |
| Ga0138525_11196032 | 3300011064 | Peatlands Soil | MDNVMMIRVVAGVIAVILLAIVIARRKRMASESV* |
| Ga0138526_12092781 | 3300011082 | Peatlands Soil | RRVMDNVMMIRVVAGVIAVILLAIVIARRKRMASGKRITPKK* |
| Ga0150984_1133806452 | 3300012469 | Avena Fatua Rhizosphere | MESVTMIRVVAAVLAVILLGVIIARRKRMASVRRTSMKR* |
| Ga0150984_1145332192 | 3300012469 | Avena Fatua Rhizosphere | MDGITMIRVVAGVLAVILLFIIIARRKRMSSVRRTTKR* |
| Ga0181524_100464392 | 3300014155 | Bog | MDNVTMIRVAAGVLAIILLVIVIARRKRMATSKRVTPRK* |
| Ga0181524_102334762 | 3300014155 | Bog | MDSVLMIRIGAAVVAVILLAVIIARRKRMASVRHVSAK* |
| Ga0181518_1000152516 | 3300014156 | Bog | MDSVLMIRVGAAVVAVILLAIVVARRKRMASARRVTPKR* |
| Ga0181530_106533662 | 3300014159 | Bog | MDNVTMIRVAAGVLAIILLVIVIARRKRMATSKRVTPR |
| Ga0181538_102853843 | 3300014162 | Bog | AGAMDTVTMIRVGAGLLAVILLGVIVARRKRMSTSKRPPISKR* |
| Ga0181532_10000009220 | 3300014164 | Bog | MDTVTMIRVGAGLLAVILLGVIVARRKRMSTSKRPPISKR* |
| Ga0181532_100947102 | 3300014164 | Bog | MDNVTMIRVVAGVLLVILLGILIARRKRMASTKRVTPRK* |
| Ga0181526_102179462 | 3300014200 | Bog | MDSVTMIRVAAGVLAVILLGVIIARRKRMSSARRPTARR* |
| Ga0163163_111165303 | 3300014325 | Switchgrass Rhizosphere | MDGVTMIRVVAGVLAVILLFIIIARRKRMSSVRRTGIKR* |
| Ga0182013_100550972 | 3300014492 | Bog | MDGVTMIRVIAGVLAVILLGVVIARRKRMSTTKRPSQRR* |
| Ga0182024_127911472 | 3300014501 | Permafrost | VLMIRIGAAVFAVILLAIVIARRKRMAAGRRMTPRK* |
| Ga0181525_100598412 | 3300014654 | Bog | MDNVTMIRVIAGVLAVILLAIVIARRKRMSSSSTKRLTPRK* |
| Ga0181511_10273929 | 3300016702 | Peatland | MDNVTMIRVAAGVLAIILLVIVIARRKRMATSKRVTPRK |
| Ga0181511_11218302 | 3300016702 | Peatland | MDSVLMIRIGAAVVAVILLAVIIARRKRMASVRHVSAK |
| Ga0181511_148702310 | 3300016702 | Peatland | MDTVTMIRVGAGLLAVILLGVIVARRKRMSTSKRPPISKR |
| Ga0181515_10506384 | 3300016730 | Peatland | MDSVLMIRVGAAVVAVILLAIVVARRKRMASARRVTPKR |
| Ga0181505_101962751 | 3300016750 | Peatland | NTMDSVTMIRVAAGVLAVILLGVIIARRKRMSSARRPTARR |
| Ga0187818_104948792 | 3300017823 | Freshwater Sediment | MDTVMMIRVAAGVVAVILLGVVIARRKRMASSKRVTPRR |
| Ga0187848_100181224 | 3300017935 | Peatland | MDNVTMIRVAAGVLAVILLAIVIARRKRMASSKRVTPRK |
| Ga0187847_100085959 | 3300017948 | Peatland | MDNVMMIRIIAGVLCVILLAIVIARRKRMASSKRLTPRK |
| Ga0187847_100512932 | 3300017948 | Peatland | MDNVTMIRLAAGVLAVILLAIVIARRKRMAASKRVTPRK |
| Ga0187847_102849102 | 3300017948 | Peatland | MDNVTMIRVVAGVLLVILLGILIARRKRMASTKRVTPRK |
| Ga0187783_100267745 | 3300017970 | Tropical Peatland | MDTILMIRIIAGVVAVILLAIVIARRKRMASTKRVTPRK |
| Ga0187884_100964733 | 3300018009 | Peatland | MDVTMVRVIAGVVAVILLAVIVTRRKRMASAKRPVPKR |
| Ga0187874_100092794 | 3300018019 | Peatland | MDNVTMVRVAAGVLAVILLAIVIARRKRMASSKRVTPRK |
| Ga0187885_100300985 | 3300018025 | Peatland | MDVTMIRVIAGVVAVILLAVIVTRRKRMASAKRPIPKR |
| Ga0187869_101487672 | 3300018030 | Peatland | MDSVLMIRIGAAVVAVILLAIVVARRKRMASSKRVTPRR |
| Ga0187869_102573661 | 3300018030 | Peatland | MDNVTMIRVAAGVLAVILLAIVIARRKRMAASKRVTPRK |
| Ga0187863_100443375 | 3300018034 | Peatland | MDSVTMIRVAAGVLAVILLGVIIARRKRMSSARRPTARR |
| Ga0187855_102345102 | 3300018038 | Peatland | MDNVTMIRVAAGVLAVILLAIVIARRKRMASSKRV |
| Ga0187858_100144429 | 3300018057 | Peatland | MDNVMMIRVVAGVIAVILLAIVIARRKRMASGRRITPKK |
| Ga0187770_103280753 | 3300018090 | Tropical Peatland | MDNVTMIRVASGVLAVILLGVIIARRKRLSSTRRSSSRR |
| Ga0210386_100863642 | 3300021406 | Soil | MDTVTMVRVVAGVLAVVLLGIIVARRKRTSSSKMTSKR |
| Ga0224534_10253523 | 3300022524 | Soil | MDSVLMIRIGAGVIAVILLAIIVARRKRMASANRLTSKH |
| Ga0242662_101144053 | 3300022533 | Soil | MDTVTMVRIASGVVAVILLGVIIARRKRLASARRIK |
| Ga0242665_101718261 | 3300022724 | Soil | MDTVTMIRVVAGVLAVVLLGVIVARRKRMSSSKMTSKR |
| Ga0224556_10056902 | 3300024295 | Soil | MDNVTMIRVIAGVLAVILLAIVIARRKRMSSSSTKRLTPRK |
| Ga0208479_10411252 | 3300025474 | Arctic Peat Soil | MDSVLMIRIGAGVVAVILLAIIVARRKRMASANRLTS |
| Ga0208478_10342092 | 3300025475 | Arctic Peat Soil | MDSVLMIRIGAGVVAVILLAIIVARRKRMASANRLTSKH |
| Ga0208079_10012474 | 3300025481 | Arctic Peat Soil | MDSVLIIRIIAGVVAVALLAIIVARRKRMASANRLTSKH |
| Ga0209385_10201063 | 3300025650 | Arctic Peat Soil | MDNVTMIRVAAAVVAVILLAIVITRRKRMAAGRRMTPKK |
| Ga0209385_11840252 | 3300025650 | Arctic Peat Soil | MDSVLMIRIAAGVIAVILLAIIVARRKRMASANRLTSKH |
| Ga0209385_12148311 | 3300025650 | Arctic Peat Soil | MDSVLMIRIGAGVIAVILLAIIVARRKRMASANRLTSANRLTSKH |
| Ga0209584_103025011 | 3300025878 | Arctic Peat Soil | MDSVLMIRIGAGVVAVILLAIIVARRKRMASANRLT |
| Ga0209904_10014083 | 3300027394 | Thawing Permafrost | MDNVTLIRVAAAVVAVVLLAILIARRKRMASGRRMTPKK |
| Ga0209810_12257342 | 3300027773 | Surface Soil | MDNVTMIRVVAGVLAVILLIIMIARRKRMAASRRMTTRK |
| Ga0209656_100089704 | 3300027812 | Bog Forest Soil | MDNVLMIRVIAGILAVILLTIIIARRKRMASMKRPPTRT |
| Ga0209656_100262442 | 3300027812 | Bog Forest Soil | MDNITLIRIVAGVVAVILLAIVVTRRKRMASSRQAALRK |
| Ga0209060_100567253 | 3300027826 | Surface Soil | MDSVTMIRLAAGVLAVILLGVIIARRKRLSSARRPTPKR |
| Ga0209579_100316796 | 3300027869 | Surface Soil | MDTVTMIRLAAGVLAVILLGVIIARRKRLSSARRPTVKR |
| Ga0209061_10136474 | 3300027968 | Surface Soil | MDSVTMIRVVAGIVAVILLAIIIARRKRMASARRTTTPKR |
| Ga0265338_100498444 | 3300028800 | Rhizosphere | MDSVTMIRVAAGALAVIILCVIIARRKKMSSSKRPTGSKR |
| Ga0210268_11240462 | 3300030629 | Soil | MDGVTMIRAIAGVLAVIVLAIVIARRKRMSSTKRVTPRK |
| Ga0265754_10123493 | 3300031040 | Soil | DNVTMIRVAAGVLAVILLAIVIARRKRMAASKRVTPRK |
| Ga0170824_1263674332 | 3300031231 | Forest Soil | MDSTTMIRIVAGVIAVILLMIIVARRKRMASAKRTTPKR |
| Ga0302325_100251668 | 3300031234 | Palsa | MDNVTMIRYGAAVLLVILVVIVFARRKRMASSKRVTPRK |
| Ga0265330_103348992 | 3300031235 | Rhizosphere | MDSVTMIRVAAGALAVIILCVIIARRKKMSSSKRP |
| Ga0170820_110395752 | 3300031446 | Forest Soil | MDSVTMIRIAAGVVAVILLGLIIARRKRLASARRIK |
| Ga0310686_1159505102 | 3300031708 | Soil | MDVTMIRVIAGVVAVILLAVIVTRRKRMASAKRPTPKR |
| Ga0308174_108745222 | 3300031939 | Soil | MDNVTMVRVVAGVLAVILLVIMITRRKRMAASRRMTTRK |
| Ga0311301_1001153014 | 3300032160 | Peatlands Soil | METMDGVTMIRVVAGVLAVVLLGIVIARRKRMSATKRMTPPRK |
| Ga0311301_101135754 | 3300032160 | Peatlands Soil | MDNVMMIRVVAGVIAVILLAIVIARRKRMASGKRITPKK |
| Ga0348332_119379302 | 3300032515 | Plant Litter | MDNTTMIRAAAGVLAVILLGVIVARRKRMSSSKRPTTKR |
| Ga0335085_100089368 | 3300032770 | Soil | MDNVMMVRVVAGIVCVILLAVIITRRKRMASAKRLASRR |
| Ga0335079_1000221618 | 3300032783 | Soil | MDSVTMIRVAAGVLAVILLGVIIARRKRMSSARRTATRR |
| Ga0335079_100713462 | 3300032783 | Soil | MDTVTMIRVVAGVLAVVILCVIVARRKRMSSSKHTVSKR |
| Ga0335079_102751563 | 3300032783 | Soil | MDSVTMIRMVAGVLAVVLLGVIIARRKRMSSARRPTVRR |
| Ga0335078_102560243 | 3300032805 | Soil | MDNVTMIRVVAGVLAVLLLGVIIARRKRMSSSARRPTARR |
| Ga0335080_114256592 | 3300032828 | Soil | MDTVLMIRVVAGVLAVIVLAVIIARRKRMASVKRMSAKR |
| Ga0335070_103926292 | 3300032829 | Soil | MDNVLMIRIVAGVLCVILLAIIIARRKRMASMKRPNTRP |
| Ga0335081_100026777 | 3300032892 | Soil | MDTVTMIRVVSGAIAVVLLGVIIARRKRMASSRRTTMKR |
| Ga0335081_1000995611 | 3300032892 | Soil | MDTVTTIRVVSGALAVLLLGVIIARRKRMSSARRVAAKK |
| Ga0335081_100653436 | 3300032892 | Soil | MDSVTMIRVVAGAVAVVLLGVIIARRKRMASARRSPSRR |
| Ga0335081_114518782 | 3300032892 | Soil | MDSVTMIRVVAGVLAVVLLGVIIARRKRISSARRPTVRR |
| Ga0335069_102913274 | 3300032893 | Soil | MDNVMMVRVVAGIVCVILLAVLISRRKRMASTKRLASRR |
| Ga0335074_1000232515 | 3300032895 | Soil | MDTVTMIRVSAGVLAVILLAVVIARRKRMSSSKRPPISKR |
| Ga0335074_101770233 | 3300032895 | Soil | MDSVTMIRVAAGVLAVLLLGVIVARRKRMSSARRPSPKR |
| Ga0335074_105407432 | 3300032895 | Soil | MDTVTMIRAASGALAVILVGVIVARRKRMASERSRGIKR |
| Ga0335072_101139754 | 3300032898 | Soil | MDSVTMIRVVAGVVAVVLLAVVIARRKSMASSKRSTTKR |
| Ga0335072_101596314 | 3300032898 | Soil | MDSVTMIRVASGVLAVLLLGVIVARRKRMSSARRPSPKR |
| Ga0335073_100532555 | 3300033134 | Soil | MDSVTMIRVASGVLAVILLGVIIARRKRLSTARRSTTRR |
| Ga0335073_100609544 | 3300033134 | Soil | MDSVTMIRVAAAVVAVILLAVIITRRKRMASSKPSKR |
| Ga0335073_101508574 | 3300033134 | Soil | MDGITMIRVGAGVVAVILLGVIVARRKRMSTSKRPMPKR |
| Ga0335073_112521942 | 3300033134 | Soil | MDSVTMIRVAAGVVAVILLGVIIARRKRMSSAARHPSSRR |
| Ga0326728_1000338947 | 3300033402 | Peat Soil | MDTISVIRVGAGVLAVILLAVIVARRKRMSASKRPVSKR |
| ⦗Top⦘ |