NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074104

Metagenome / Metatranscriptome Family F074104

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074104
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 121 residues
Representative Sequence MTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Number of Associated Samples 116
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.50 %
% of genes near scaffold ends (potentially truncated) 50.83 %
% of genes from short scaffolds (< 2000 bps) 74.17 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(29.167 % of family members)
Environment Ontology (ENVO) Unclassified
(41.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.833 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 13.39%    β-sheet: 8.66%    Coil/Unstructured: 77.95%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF01545Cation_efflux 8.33
PF14742GDE_N_bis 1.67
PF00293NUDIX 0.83
PF13683rve_3 0.83
PF01243Putative_PNPOx 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 8.33
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 8.33
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 8.33


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_10867373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14516Open in IMG/M
3300001686|C688J18823_10077057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142313Open in IMG/M
3300002244|JGI24742J22300_10016020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141263Open in IMG/M
3300002568|C688J35102_120656844All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1305Open in IMG/M
3300003569|Ga0007420J51693_1024351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14930Open in IMG/M
3300003573|Ga0007412J51696_1030281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14882Open in IMG/M
3300004081|Ga0063454_100190170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141151Open in IMG/M
3300004081|Ga0063454_100495527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14857Open in IMG/M
3300004785|Ga0058858_1359919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14844Open in IMG/M
3300005160|Ga0066820_1016336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14547Open in IMG/M
3300005162|Ga0066814_10019055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14937Open in IMG/M
3300005165|Ga0066869_10090043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14600Open in IMG/M
3300005169|Ga0066810_10162606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14540Open in IMG/M
3300005335|Ga0070666_10063860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142496Open in IMG/M
3300005337|Ga0070682_100030252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M143267Open in IMG/M
3300005338|Ga0068868_100153893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141895Open in IMG/M
3300005439|Ga0070711_101289364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14633Open in IMG/M
3300005440|Ga0070705_101636743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14543Open in IMG/M
3300005445|Ga0070708_101786678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14571Open in IMG/M
3300005468|Ga0070707_100653956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141014Open in IMG/M
3300005518|Ga0070699_101235150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14685Open in IMG/M
3300005526|Ga0073909_10107400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141112Open in IMG/M
3300005536|Ga0070697_100668692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14915Open in IMG/M
3300005545|Ga0070695_101001524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14680Open in IMG/M
3300005578|Ga0068854_100054419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142878Open in IMG/M
3300006163|Ga0070715_10050812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141781Open in IMG/M
3300006173|Ga0070716_100204571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141315Open in IMG/M
3300006572|Ga0074051_11678159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141288Open in IMG/M
3300006573|Ga0074055_10014024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142025Open in IMG/M
3300006575|Ga0074053_10014474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14971Open in IMG/M
3300006576|Ga0074047_11829114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium872Open in IMG/M
3300006577|Ga0074050_11204917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14804Open in IMG/M
3300006578|Ga0074059_10015124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141750Open in IMG/M
3300006579|Ga0074054_12169692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141615Open in IMG/M
3300006580|Ga0074049_12475152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14570Open in IMG/M
3300006581|Ga0074048_12922291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14724Open in IMG/M
3300006603|Ga0074064_11673213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14926Open in IMG/M
3300006604|Ga0074060_12073003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141311Open in IMG/M
3300006605|Ga0074057_12337707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141348Open in IMG/M
3300006606|Ga0074062_10683801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14755Open in IMG/M
3300006755|Ga0079222_10443788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14924Open in IMG/M
3300006953|Ga0074063_10133075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14548Open in IMG/M
3300009101|Ga0105247_10205202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141326Open in IMG/M
3300009148|Ga0105243_10005004All Organisms → cellular organisms → Bacteria10387Open in IMG/M
3300009174|Ga0105241_10176833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141767Open in IMG/M
3300009177|Ga0105248_10034029All Organisms → cellular organisms → Bacteria5696Open in IMG/M
3300010147|Ga0126319_1297385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142297Open in IMG/M
3300010154|Ga0127503_10943846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14968Open in IMG/M
3300010371|Ga0134125_10070798All Organisms → cellular organisms → Bacteria3879Open in IMG/M
3300010396|Ga0134126_10163112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142692Open in IMG/M
3300010400|Ga0134122_10331776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141318Open in IMG/M
3300010400|Ga0134122_11094314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14789Open in IMG/M
3300011106|Ga0151489_1222276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14738Open in IMG/M
3300011107|Ga0151490_1708103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14876Open in IMG/M
3300012212|Ga0150985_102232590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14956Open in IMG/M
3300012212|Ga0150985_112940976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141066Open in IMG/M
3300012941|Ga0162652_100096804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14525Open in IMG/M
3300012951|Ga0164300_10009246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M143031Open in IMG/M
3300012957|Ga0164303_10281669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14970Open in IMG/M
3300012958|Ga0164299_10025073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142510Open in IMG/M
3300012961|Ga0164302_10087078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141684Open in IMG/M
3300012987|Ga0164307_10073368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142052Open in IMG/M
3300012988|Ga0164306_11161862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14645Open in IMG/M
3300012989|Ga0164305_10063202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142228Open in IMG/M
3300013297|Ga0157378_10505016All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300014968|Ga0157379_10063398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M143304Open in IMG/M
3300014969|Ga0157376_10071985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142939Open in IMG/M
3300017792|Ga0163161_10056621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142848Open in IMG/M
3300017997|Ga0184610_1263028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14572Open in IMG/M
3300018000|Ga0184604_10367942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14512Open in IMG/M
3300018051|Ga0184620_10004110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142967Open in IMG/M
3300019269|Ga0184644_1161345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14701Open in IMG/M
3300019866|Ga0193756_1006494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141454Open in IMG/M
3300019868|Ga0193720_1045259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14624Open in IMG/M
3300019872|Ga0193754_1008148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141070Open in IMG/M
3300019874|Ga0193744_1094529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14558Open in IMG/M
3300019878|Ga0193715_1115247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14524Open in IMG/M
3300019879|Ga0193723_1115662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14747Open in IMG/M
3300020000|Ga0193692_1060443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14849Open in IMG/M
3300020005|Ga0193697_1083271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14776Open in IMG/M
3300020006|Ga0193735_1071910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14998Open in IMG/M
3300020016|Ga0193696_1003944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M144239Open in IMG/M
3300020022|Ga0193733_1010348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142633Open in IMG/M
3300021510|Ga0222621_1000185All Organisms → cellular organisms → Bacteria6292Open in IMG/M
3300021951|Ga0222624_1125075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14827Open in IMG/M
3300025899|Ga0207642_10004545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M144482Open in IMG/M
3300025921|Ga0207652_10314582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141413Open in IMG/M
3300025930|Ga0207701_10729918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14838Open in IMG/M
3300025986|Ga0207658_11076732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14734Open in IMG/M
3300026121|Ga0207683_11229686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14694Open in IMG/M
3300027821|Ga0209811_10162309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14833Open in IMG/M
3300027821|Ga0209811_10169806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14816Open in IMG/M
3300028707|Ga0307291_1004621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142942Open in IMG/M
3300028712|Ga0307285_10014415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141748Open in IMG/M
3300028714|Ga0307309_10005526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142095Open in IMG/M
3300028793|Ga0307299_10011182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M143169Open in IMG/M
3300028875|Ga0307289_10189491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14846Open in IMG/M
3300028881|Ga0307277_10019180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142669Open in IMG/M
3300028885|Ga0307304_10000047All Organisms → cellular organisms → Bacteria19952Open in IMG/M
3300030989|Ga0308196_1007999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141042Open in IMG/M
3300030990|Ga0308178_1001927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142099Open in IMG/M
3300030993|Ga0308190_1002738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142005Open in IMG/M
3300031082|Ga0308192_1085996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14519Open in IMG/M
3300031093|Ga0308197_10005333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142148Open in IMG/M
3300031097|Ga0308188_1034631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14533Open in IMG/M
3300031170|Ga0307498_10324187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14583Open in IMG/M
3300031226|Ga0307497_10415521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14646Open in IMG/M
3300031421|Ga0308194_10006314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M142039Open in IMG/M
3300031455|Ga0307505_10265209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14801Open in IMG/M
3300031720|Ga0307469_11133796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14736Open in IMG/M
3300031740|Ga0307468_100067520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141967Open in IMG/M
3300032174|Ga0307470_10205596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141262Open in IMG/M
3300032205|Ga0307472_100115512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141884Open in IMG/M
3300034659|Ga0314780_026835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141026Open in IMG/M
3300034660|Ga0314781_020335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141027Open in IMG/M
3300034661|Ga0314782_004108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141921Open in IMG/M
3300034662|Ga0314783_154840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14532Open in IMG/M
3300034663|Ga0314784_019694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141047Open in IMG/M
3300034664|Ga0314786_006571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141545Open in IMG/M
3300034669|Ga0314794_027342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14964Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil29.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.33%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.33%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere3.33%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.50%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.50%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.67%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.83%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003569Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_36 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003573Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_28 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004785Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005160Soil and rhizosphere microbial communities from Laval, Canada - mgLMBEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019872Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1EnvironmentalOpen in IMG/M
3300019874Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030989Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031097Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034660Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034662Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034663Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034669Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1086737323300000789SoilMTSNSENTALTYREPKSRVGRRCASTLPAHGSVQIRAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQFVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATLRGPQCGEALHEKAVNEAA*
C688J18823_1007705723300001686SoilMTSNSENTVLTYREPKSRVGQRCVSTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETNLEVREQLVHRDSFLATPTPGACTADGLASVRAVRLGALGPAATLRGPQRGKAPHEKAVYEAA*
JGI24742J22300_1001602023300002244Corn, Switchgrass And Miscanthus RhizosphereMTSNSENTALTYREPKSRVGRRCXSTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEAL
C688J35102_12065684413300002568SoilMTHTFEIAALTNREPKPRNGQCCASSKLRHGSAQIGAGAARSLPKSDSAGGPRHLGPGGVAREMYLEAREQLVHRGTFLATPTPGAYTADGLTCVRAVRLGALGPAATLRGPQRGKATHEKAVYEAA*
Ga0007420J51693_102435123300003569Avena Fatua RhizosphereMTSNSENTVLTYREPKSRVGQRCVSTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETNLEVREQLVHRDSFLATPTPGACTADGLASVRAVRLGALGPAATLRGPQRGKAP
Ga0007412J51696_103028123300003573Avena Fatua RhizosphereMTSNSENTVLTYREPKSRVGQRCVSTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETNLEVREQLVHRDSFLATPTPGACTADGLASVRAVRLGALG
Ga0063454_10019017013300004081SoilMTHTFEIAALTNREPKPRNGQCCASSKLRHGSAQIGAGAARSLPKSDSAGGPRHLGPGGVAREMYLEAREQLVHRGTFLATPTPGAYTADGLTCVRAVRLGALGPAATLRGPQRGKATH
Ga0063454_10049552713300004081SoilMTSNSENTVLTYREPKSRVGQRCVSTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETNLEVREQLVHRDSFLATPTPGAYTADRLASVRAVRLGALGPAATLRGPQRGKAPHEKAVYEAA*
Ga0058858_135991923300004785Host-AssociatedMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAA
Ga0066820_101633613300005160SoilRKKQPMTSNSEKTALTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFLGSGGLARETNLEVREQLVHRDTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKALHEKAVNEAA*
Ga0066814_1001905523300005162SoilMTSNCENTALTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARDTYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0066869_1009004313300005165SoilRKKQPMTSNSENTALTFREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0066810_1016260613300005169SoilMTSNSENTALTFREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0070666_1006386023300005335Switchgrass RhizosphereMTSNSENTALTYREPKSRVGRRCTSTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALHEKAVNEAA*
Ga0070682_10003025233300005337Corn RhizosphereMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYAADGLARVRAVRVGAL
Ga0068868_10015389323300005338Miscanthus RhizosphereMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALHEKAVNEAA*
Ga0070711_10128936413300005439Corn, Switchgrass And Miscanthus RhizosphereMTSNFENTALTYREPKSRVGRRCASTMFGRGSAEIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0070705_10163674313300005440Corn, Switchgrass And Miscanthus RhizosphereMTSNSENTALTYREPKSRIGRRCASTLLGHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARATYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0070708_10178667823300005445Corn, Switchgrass And Miscanthus RhizosphereMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRG
Ga0070707_10065395623300005468Corn, Switchgrass And Miscanthus RhizosphereRCASTLLGHGSAQIGAGTARSLPKSDLLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALDEKAVNEAA*
Ga0070699_10123515023300005518Corn, Switchgrass And Miscanthus RhizosphereSTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARATYLEVREQLVHRGTFLATPTPGAYTADGLACVRAVRLGALGPAATLRGLQRGKAPHEKAVNEAA*
Ga0073909_1010740023300005526Surface SoilMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGFARGTYLEVREQLVHRGTFLATPTPGAHTADGLARVRAVRVGALGPAATLRGSQCGKSPDEKAVNEAA*
Ga0070697_10066869213300005536Corn, Switchgrass And Miscanthus RhizosphereGGGVTKDQQRKKQPMTSNSENTALSFREPESRVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPPPGAYTADGLACVRAGRVGALGPAATQRGPQRGKAPYGKAVNEAA*
Ga0070695_10100152423300005545Corn, Switchgrass And Miscanthus RhizosphereMTSNSENTALSFREPESRVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAAT
Ga0068854_10005441923300005578Corn RhizosphereMTSNSENTALTYREPKSRVGRRCTSTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATPRGPQCGEALHEKAVNEAA*
Ga0070715_1005081233300006163Corn, Switchgrass And Miscanthus RhizosphereMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATLRGPQSGKAPMRKP*
Ga0070716_10020457113300006173Corn, Switchgrass And Miscanthus RhizosphereMTSNSENTALTYREPKSRVGRRCTSTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAAT
Ga0074051_1167815923300006572SoilMTSNSENTALTFREPESRVGRRCASTLPAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074055_1001402423300006573SoilMTSNSENTVLTYREPKSRVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074053_1001447413300006575SoilRKKQPMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIEAGAARSLPKSDSLRGPRFLGSGGLARETNLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074047_1182911413300006576SoilYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074050_1120491713300006577SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074059_1001512423300006578SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARDTYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATRRGPQRGKALHEKAVNEAA*
Ga0074054_1216969223300006579SoilMTSNSENTALTYREPKSRVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLDVCEQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074049_1247515223300006580SoilTKDQKRKKQPMTSNSENTALTFREPESRVGRRCASTLPAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074048_1292229123300006581SoilGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074064_1167321323300006603SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIEAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074060_1207300323300006604SoilMTSNSENTALTYREPESRVGRRCASTLLGHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074057_1233770723300006605SoilRKKQPMTSNSENTALTYREPKSRVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRDTFLATPPLGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0074062_1068380113300006606SoilTKDQKRKKQPMTSNSENTALTFREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0079222_1044378823300006755Agricultural SoilMKPMTDNFEKTAQMTWEPKSRVGRRCSPELSGRGPKQIETEAAQSLPKSDLARGRRFLGADGLAREKYLEARGQLVHRGFLATPAPGADTADGLAVVRAARVGALGPAATLCGPQRGEAQQENAVEVAA*
Ga0074063_1013307523300006953SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARDTYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAAT
Ga0105247_1020520223300009101Switchgrass RhizosphereMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALDEKAVNEAA*
Ga0105243_10005004103300009148Miscanthus RhizosphereMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDWLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALHEKAVNEAA*
Ga0105241_1017683323300009174Corn RhizosphereMTSNSENTALTYREPKSRVGRRCTSTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGWLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALHEKAVNEAA*
Ga0105248_1003402923300009177Switchgrass RhizosphereMTSNSENTALTYREPKSRVGRRCTSTLLAHGSVQIGAGAARSLPKSDWLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALHEKAVNEAA*
Ga0126319_129738513300010147SoilMTSNSENTALTYREPKSRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAYVRAVRVGALGPAATQRGLQRGEAPYEKAVNEAA*
Ga0127503_1094384623300010154SoilMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGFARETYLEVREQLVHRGTFLATPTPGAHTADGLARVRAGRVGKKKKKLKE*
Ga0134125_1007079853300010371Terrestrial SoilMTSNSENTALTYREPKARIGRRCASTLLAHGSAQIGAGTAQSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0134126_1016311233300010396Terrestrial SoilMTSNSENTALTYREPKSRIGRRCASTLLAHGSAQIGAGTAQSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0134122_1033177623300010400Terrestrial SoilMTSNSENTALSFREPESRVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPPPGAYTADGLACVRAGRVGALGPAATLRGPQRGKAPYGKAVNEAA*
Ga0134122_1109431423300010400Terrestrial SoilMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGWLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALDEKAVNEAA*
Ga0151489_122227613300011106SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFLGSGGLARETNLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPQEKP*
Ga0151490_170810313300011107SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIEAGAARSLPKSDSLLGPRFPGSGGLARDTYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0150985_10223259023300012212Avena Fatua RhizosphereMTSKFENTALTHREPKSRVGRRCGSIMFGRGAAEIRARAARSLPKSDSLRGPRFPGSDGLARETYLEVREQLVHRGTFLATPAPGACTADGFACVRAVRVGALGPAATLRGLQRGKAAHEKAVNEAA
Ga0150985_11294097623300012212Avena Fatua RhizosphereMTHTFEIAALTNREPKARNGQCCASSKLRHGSAQIGAGAARSLPKSDSAGGPRHLGPGGVAREMYLEAREQLVHRGTFLATPTPGAYTADGLTCVRAVRLGALGPAATLRGPQRGKATHEKAVYEAA*
Ga0162652_10009680413300012941SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIEAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAAT
Ga0164300_1000924623300012951SoilMTSNSENTALTYREPKSRIGRRCASTLLGHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0164303_1028166923300012957SoilMTSNSENTALTYREPKSRIGRRCASTLLGHGSAQIGAGTARSLPKSDSLRGPRFPGSGGFARGTYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKASHEKAVNEAA*
Ga0164299_1002507323300012958SoilMTSNFENTALTYREPKSRVGRRCASTMFGRGSAEIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0164302_1008707823300012961SoilMTSNSENTALTYREPKSRVGRRCASTMFGRGSAEIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGSQC
Ga0164307_1007336823300012987SoilMTSNSENTALTYREPKSRIGRRCASTLLGHRSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0164306_1116186223300012988SoilMTSNSENTALTYREPKSRVGRRCASTMFGRGSAEIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0164305_1006320213300012989SoilENTALTYREPKSRVGRRCASTMFGRGSAEIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA*
Ga0157378_1050501633300013297Miscanthus RhizosphereMTSNSENTALSFREPESRVGRRCASTLLGHGSAQIGAGTAQSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALHEKAVNEAA*
Ga0157379_1006339833300014968Switchgrass RhizosphereMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALHQKAVNEAA*
Ga0157376_1007198523300014969Miscanthus RhizosphereMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGWLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALHEKAVNEAA*
Ga0163161_1005662123300017792Switchgrass RhizosphereMTSNSENTALTYREPKSRVGRRCTSTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALDEKAVNEAA
Ga0184610_126302813300017997Groundwater SedimentMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Ga0184604_1036794223300018000Groundwater SedimentMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQR
Ga0184620_1000411053300018051Groundwater SedimentGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Ga0184644_116134523300019269Groundwater SedimentGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGALGPAATQRGPQRGKALYEKAVNEAA
Ga0193756_100649423300019866SoilMTSNSENTALTFREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Ga0193720_104525923300019868SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKA
Ga0193754_100814823300019872SoilMTSNSENTALTFREPESRVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEDREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Ga0193744_109452913300019874SoilSTKDQKRKKQPMTSNSENTALTYREPESRVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVRERLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Ga0193715_111524723300019878SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQ
Ga0193723_111566223300019879SoilMTSNSENTALTYREPESRVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEDREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Ga0193692_106044313300020000SoilMTSNSENTALTYREPESRSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPTPGAYTVDVLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA
Ga0193697_108327113300020005SoilENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGALGPAATQRGPQRGKALYERAVNEAA
Ga0193735_107191023300020006SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAESRSRRGACS
Ga0193696_100394423300020016SoilMTSNSENTALTFREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGALGPAATQRGPQRGKALYERAVNEAA
Ga0193733_101034813300020022SoilMTSNSENTALTYREPKSRVGRRCASTLLAHGSAQIEAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGALGPAATQRGPQRGKALYEKAVNEAA
Ga0222621_100018523300021510Groundwater SedimentMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYFEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Ga0222624_112507513300021951Groundwater SedimentMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGALGPAATQRGPQRGKALYEKAVNEAA
Ga0207642_1000454513300025899Miscanthus RhizosphereMTSNSENTALTYREPKSRVGRRCTSTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVG
Ga0207652_1031458223300025921Corn RhizosphereNTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALHEKAVNEA
Ga0207701_1072991823300025930Corn, Switchgrass And Miscanthus RhizosphereKQPMTSNSENTALTYREPKSRVGRRCTSTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALHEKAVNEAA
Ga0207658_1107673213300025986Switchgrass RhizosphereMTSNSENTALTYREPKSRVGRRCTSTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVPVGALGPA
Ga0207683_1122968623300026121Miscanthus RhizosphereCASTMFGRGSAEIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA
Ga0209811_1016230923300027821Surface SoilMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGFARGTYLEVREQLVHRGTFLATPTPGAHTADGLARVRAVRVGALGPAATLRGSQCGKSPDEKAVNEAA
Ga0209811_1016980623300027821Surface SoilMTSNSENTALTYREPKSRIGRRCASTLLGHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGPAATLRGPQRGKAPHEKAVNEAA
Ga0307291_100462123300028707SoilMTSNSENTALTFREPESRIGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Ga0307285_1001441523300028712SoilMTSNSENTALTFREPESRIGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYFEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Ga0307309_1000552613300028714SoilMTSNSENTALTFREPESRIGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGALGPAATQRGPQRGKALYEKAVNEAA
Ga0307299_1001118233300028793SoilMTSNSENTALTFREPESRIGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGALGPAATQRGPQRGKALYEKAV
Ga0307289_1018949123300028875SoilMTSNSENTALTYREPKSRVGRRSASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGPARETYLEVHEQLIRRGTFLATPTPGAYTADGLARVRAARVGALGPAATLRGPQCGK
Ga0307277_1001918023300028881SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGALGPAATQRGPQRGKAPYEKAVNEAA
Ga0307304_1000004713300028885SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARV
Ga0308196_100799923300030989SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGALGPAATQRGPQRGK
Ga0308178_100192713300030990SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGAL
Ga0308190_100273813300030993SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGP
Ga0308192_108599613300031082SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYFEVREQLVHRGTFLATPTPGAYTADGLAGVRAARVGAL
Ga0308197_1000533323300031093SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGKA
Ga0308188_103463113300031097SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGAL
Ga0307498_1032418713300031170SoilGVGRRCASTLPAHGSVQIGVGAARSLPKSDSLRGPRFPGSGGLAREKTYLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAATPRGPQCGEALQEKAVNEAA
Ga0307497_1041552113300031226SoilMTSNSENTALTFREPESRVGRRCVSTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLACVRAVRVGALGP
Ga0308194_1000631413300031421SoilMTSNSENTALTYREPESRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAARVGALGPAATQRGPQRGK
Ga0307505_1026520913300031455SoilMTSNSENTALTYREPKSRVGRRCASTLLAHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTVDGLTCVRAVRVGALGPAATLRGPQHGKAPHE
Ga0307469_1113379613300031720Hardwood Forest SoilMTSNSENTALTFREPESQVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPPPGAYTADVLAGVRAGRVGALGPAATQRGPQRG
Ga0307468_10006752023300031740Hardwood Forest SoilMTSNSENTALTFREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRDTFLATPAPGAYTADRFASVRAVRLGALGPAATLRGLQRGEAPHEKAVNEAA
Ga0307470_1020559623300032174Hardwood Forest SoilMTSNSENTALTYREPKSRIGRRCASTLLAHGSAQIGAGTAQSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAVRVGALGP
Ga0307472_10011551223300032205Hardwood Forest SoilMTSNSENTALTFREPESRVGRRCASTLLGHGSAQIGAGAARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAHTADGLACVRAVRVGALGPAATLRGPRRGKAPTRQP
Ga0314780_026835_2_3673300034659SoilMTSNSENTVLTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAVRVGALGPAATLRGPQRGKAPREKA
Ga0314781_020335_1_3573300034660SoilMTSNSENTVLTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAVRVGALGPAATLRGPQRGKAPR
Ga0314782_004108_1610_19213300034661SoilMTSNSENTVLTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAVRVGALG
Ga0314783_154840_3_3113300034662SoilMTSNSENTVLTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAVRVGAL
Ga0314784_019694_723_10463300034663SoilMTSNSENTVLTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAVRVGALGPAAT
Ga0314786_006571_2_3253300034664SoilMTSNSENTALTYREPKSRVGRRCASTLLAHGSVQIGAGAARSLPKSDSLRGPRFPGSGGLARETNLEVREQLVHRGTFLATPTPGAYTADGLARVRAVRVGALGPAAT
Ga0314794_027342_521_9043300034669SoilMTSNSENTVLTYREPESRVGRRCASTLLAHGSAQIGAGTARSLPKSDSLRGPRFPGSGGLARETYLEVREQLVHRGTFLATPTPGAYTADGLACVRAVRVGALGPAAPLRGPQRGKAPREKAVNAAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.