Basic Information | |
---|---|
Family ID | F074095 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 48 residues |
Representative Sequence | DGIKLILENFGKEYPDAPRRDPKEFVDGSIIERLKNERFVEGLKS |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 5.83 % |
% of genes near scaffold ends (potentially truncated) | 86.67 % |
% of genes from short scaffolds (< 2000 bps) | 84.17 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.333 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.333 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.88% β-sheet: 0.00% Coil/Unstructured: 67.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF09084 | NMT1 | 35.00 |
PF13379 | NMT1_2 | 5.00 |
PF00903 | Glyoxalase | 5.00 |
PF04365 | BrnT_toxin | 4.17 |
PF10282 | Lactonase | 3.33 |
PF05960 | DUF885 | 2.50 |
PF04909 | Amidohydro_2 | 1.67 |
PF01878 | EVE | 0.83 |
PF13676 | TIR_2 | 0.83 |
PF00753 | Lactamase_B | 0.83 |
PF13964 | Kelch_6 | 0.83 |
PF13358 | DDE_3 | 0.83 |
PF08402 | TOBE_2 | 0.83 |
PF03713 | DUF305 | 0.83 |
PF13384 | HTH_23 | 0.83 |
PF05199 | GMC_oxred_C | 0.83 |
PF09459 | EB_dh | 0.83 |
PF01546 | Peptidase_M20 | 0.83 |
PF13482 | RNase_H_2 | 0.83 |
PF01979 | Amidohydro_1 | 0.83 |
PF14907 | NTP_transf_5 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 35.00 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 35.00 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 4.17 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 2.50 |
COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.83 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.83 |
COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.83 |
COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.33 % |
Unclassified | root | N/A | 1.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_87233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 988 | Open in IMG/M |
3300000789|JGI1027J11758_11987151 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300000955|JGI1027J12803_106446730 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300000956|JGI10216J12902_111856878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. | 2472 | Open in IMG/M |
3300002124|C687J26631_10208767 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300002485|C687J35088_10265681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 501 | Open in IMG/M |
3300004013|Ga0055465_10009452 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
3300004114|Ga0062593_103305176 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300004281|Ga0066397_10015386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1061 | Open in IMG/M |
3300004463|Ga0063356_102114249 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300004463|Ga0063356_104331151 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300004480|Ga0062592_101402107 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300004808|Ga0062381_10026444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1521 | Open in IMG/M |
3300005329|Ga0070683_101823647 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300005330|Ga0070690_101658032 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005333|Ga0070677_10061465 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
3300005340|Ga0070689_101872996 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005355|Ga0070671_101511496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
3300005434|Ga0070709_10301231 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300005438|Ga0070701_11150875 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005440|Ga0070705_100883092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 718 | Open in IMG/M |
3300005457|Ga0070662_101940028 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300005458|Ga0070681_10014728 | All Organisms → cellular organisms → Bacteria | 7775 | Open in IMG/M |
3300005530|Ga0070679_102024416 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300005545|Ga0070695_100951726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 696 | Open in IMG/M |
3300005558|Ga0066698_10073479 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
3300005829|Ga0074479_10832445 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300005841|Ga0068863_102666508 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300005887|Ga0075292_1002984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2041 | Open in IMG/M |
3300005895|Ga0075277_1081970 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300006049|Ga0075417_10628780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 548 | Open in IMG/M |
3300006049|Ga0075417_10667004 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300006163|Ga0070715_10236044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 948 | Open in IMG/M |
3300006173|Ga0070716_100220414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1274 | Open in IMG/M |
3300006173|Ga0070716_101078993 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300006237|Ga0097621_102295537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
3300006853|Ga0075420_100675593 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300006853|Ga0075420_101275553 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300006871|Ga0075434_100642326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1080 | Open in IMG/M |
3300006876|Ga0079217_10079732 | Not Available | 1413 | Open in IMG/M |
3300006880|Ga0075429_100519727 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300006880|Ga0075429_100958746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 748 | Open in IMG/M |
3300006969|Ga0075419_10400796 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300007004|Ga0079218_10733034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 935 | Open in IMG/M |
3300007076|Ga0075435_101360363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 622 | Open in IMG/M |
3300009137|Ga0066709_100049722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4718 | Open in IMG/M |
3300009157|Ga0105092_10029572 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
3300009157|Ga0105092_10663569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 605 | Open in IMG/M |
3300009162|Ga0075423_10693879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1074 | Open in IMG/M |
3300009162|Ga0075423_11380304 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300009176|Ga0105242_10641590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1031 | Open in IMG/M |
3300010040|Ga0126308_10698997 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300010047|Ga0126382_12493749 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300010358|Ga0126370_10037831 | All Organisms → cellular organisms → Bacteria | 2971 | Open in IMG/M |
3300010360|Ga0126372_10704639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 986 | Open in IMG/M |
3300010362|Ga0126377_12427671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 600 | Open in IMG/M |
3300010371|Ga0134125_12774662 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300010375|Ga0105239_11979381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 676 | Open in IMG/M |
3300010391|Ga0136847_10581636 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010398|Ga0126383_13581032 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300010399|Ga0134127_10169122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2005 | Open in IMG/M |
3300010399|Ga0134127_12767654 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300011412|Ga0137424_1092049 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300011431|Ga0137438_1140572 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300012171|Ga0137342_1110253 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300012350|Ga0137372_10154169 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
3300012360|Ga0137375_10156482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2218 | Open in IMG/M |
3300012510|Ga0157316_1002150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1314 | Open in IMG/M |
3300012582|Ga0137358_10823213 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300012929|Ga0137404_11069358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 739 | Open in IMG/M |
3300012930|Ga0137407_10059974 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
3300012948|Ga0126375_10013003 | All Organisms → cellular organisms → Bacteria | 3612 | Open in IMG/M |
3300012951|Ga0164300_10709443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
3300012958|Ga0164299_11010293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
3300012964|Ga0153916_11139325 | Not Available | 859 | Open in IMG/M |
3300012964|Ga0153916_12398876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
3300013306|Ga0163162_10560744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1270 | Open in IMG/M |
3300014270|Ga0075325_1004805 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
3300014311|Ga0075322_1089332 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300014314|Ga0075316_1082107 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300014885|Ga0180063_1163041 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300016371|Ga0182034_10412289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1111 | Open in IMG/M |
3300017659|Ga0134083_10032695 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
3300018063|Ga0184637_10035334 | All Organisms → cellular organisms → Bacteria | 3031 | Open in IMG/M |
3300018075|Ga0184632_10076255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1462 | Open in IMG/M |
3300018422|Ga0190265_10266874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1767 | Open in IMG/M |
3300018422|Ga0190265_12626485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
3300018429|Ga0190272_11188015 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300018431|Ga0066655_11389433 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300019356|Ga0173481_10494589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 621 | Open in IMG/M |
3300019377|Ga0190264_10981760 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300020061|Ga0193716_1078586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1465 | Open in IMG/M |
3300021063|Ga0206227_1090753 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300021859|Ga0210334_10023504 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300024056|Ga0124853_1305086 | All Organisms → cellular organisms → Bacteria | 2754 | Open in IMG/M |
3300024056|Ga0124853_1364764 | All Organisms → cellular organisms → Bacteria | 2319 | Open in IMG/M |
3300025311|Ga0209343_10195211 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
3300025324|Ga0209640_10961464 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300025903|Ga0207680_10552427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 822 | Open in IMG/M |
3300025905|Ga0207685_10348978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 745 | Open in IMG/M |
3300025930|Ga0207701_10135113 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
3300025931|Ga0207644_11370392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
3300025961|Ga0207712_10213957 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300025988|Ga0208141_1013446 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300026020|Ga0208531_1002978 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
3300026051|Ga0208911_1003575 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300026088|Ga0207641_12487069 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300026142|Ga0207698_10958804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 865 | Open in IMG/M |
3300027682|Ga0209971_1017897 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
3300027880|Ga0209481_10457662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 657 | Open in IMG/M |
3300028145|Ga0247663_1021099 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300031716|Ga0310813_11618043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 605 | Open in IMG/M |
3300031912|Ga0306921_11156398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 864 | Open in IMG/M |
3300031942|Ga0310916_10448361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1099 | Open in IMG/M |
3300032205|Ga0307472_101543942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 650 | Open in IMG/M |
3300032782|Ga0335082_10023708 | All Organisms → cellular organisms → Bacteria | 6577 | Open in IMG/M |
3300033004|Ga0335084_10560564 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300033289|Ga0310914_11673355 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300033486|Ga0316624_10091820 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
3300033513|Ga0316628_100086953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3444 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.50% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.17% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.33% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.33% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.33% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.50% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.50% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.50% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.67% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.67% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.67% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.83% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.83% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.83% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.83% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300002485 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 | Environmental | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
3300026020 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes) | Environmental | Open in IMG/M |
3300026051 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_01282330 | 2199352025 | Soil | PTLEGTKLILENFGKEYPDAPKRDPKEFVDSSIMDRLKNERFVEGLKY |
JGI1027J11758_119871511 | 3300000789 | Soil | NFGKEYPDAPRRDPKEFVDGSMIDRLKQERFAEGLKQ* |
JGI1027J12803_1064467301 | 3300000955 | Soil | DYPAPTLEGIKLILENFGKEYPDAPRRDPKEFVDGSMIDRLKQERFAEGLKQ* |
JGI10216J12902_1118568783 | 3300000956 | Soil | FVASLMPDYIAPTFDGIKLILENFGKEYPDAPKRDPKEFADGSIIERLKQEKFAEGLKF* |
C687J26631_102087671 | 3300002124 | Soil | GKEYPDAPRRDAKEFVDGSLSERLKQERFVENLKY* |
C687J35088_102656811 | 3300002485 | Soil | TLDGLKVILENFGKEYPDAPRRDPKEFVDGSISERLKQERFVESLKY* |
Ga0055465_100094521 | 3300004013 | Natural And Restored Wetlands | ILENFGKEYPDAPKRDPREFVDGSIIERLKQEKFVENLKF* |
Ga0062593_1033051762 | 3300004114 | Soil | DFVASLMPDYMAPTYDGIKVILENFGKEYPDAPKRDPKEFADGSIIERLKQEKFAEGLKF |
Ga0066397_100153861 | 3300004281 | Tropical Forest Soil | DFVSSLIPDYPAPTLDGIRLILENFGKEYPDAPRRDPKEFVDGSIIERLKQERFAEGLKQ |
Ga0063356_1021142492 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PDYIAPTFDGIKLILENFGKEYPDAAKRDPKEFADGSIIERLKQEKFAEGLKY* |
Ga0063356_1043311511 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PDYIAPTFDGIKLILENFGKEYPDAAKRDPKEFADGSIIERLKQEKFAEGLKF* |
Ga0062592_1014021072 | 3300004480 | Soil | TFDGIKLILENFGKEYPDAAKRDPKEFADGSIIERLKQEKFAEGLKY* |
Ga0062381_100264441 | 3300004808 | Wetland Sediment | PDYIAPTFDGIKLILENFGKEYPDAPKRDPKDFADGSIIERLKQEKFAEGLRF* |
Ga0070683_1018236472 | 3300005329 | Corn Rhizosphere | SLMPDYIAPTLDGIKVILENFGKEYPDAPKRDPKEFVDSSIIERLKNERFVEGLKS* |
Ga0070690_1016580321 | 3300005330 | Switchgrass Rhizosphere | LMPDYIAPTLEGTKLILENFGKEYPDAPKRDPKEFVDGSIIDRLKNERFVEGLKY* |
Ga0070677_100614653 | 3300005333 | Miscanthus Rhizosphere | APTLDGIKLILENFGKEYPDAPKRDPKEFVDSSIIERLKNERFVEGLKS* |
Ga0070689_1018729962 | 3300005340 | Switchgrass Rhizosphere | DGIKLILENFGKEYPDAPRRDPKEFVDGSIIERLKNERFVEGLKS* |
Ga0070671_1015114962 | 3300005355 | Switchgrass Rhizosphere | PTLEGIKVILDNFGKEYPDAPRRDPKEFVDGTIIERLKQERFAENLK* |
Ga0070709_103012311 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LENFGKEYPDALRRDPKEFVDGSFIDRLKQERFVETLKQ* |
Ga0070701_111508752 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | YIAPTFDGIKLILENFGKEYPDAAKRDPKEFADGSIIERLKQEKFAEGLKS* |
Ga0070705_1008830922 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | KLILENFGKEYPDAPRRDPKEFIDGSIIERLKNERFVEGLKS* |
Ga0070662_1019400282 | 3300005457 | Corn Rhizosphere | GTKLILENFGKEYPDAPKRDPKEFVDSSIMDRLKNERFVEGLKY* |
Ga0070681_100147288 | 3300005458 | Corn Rhizosphere | FVASLMPDYIAPTLDGIKVILENFGKEYPDAPKRDPKEFVDSSIIERLKNERFVEGLKS* |
Ga0070679_1020244162 | 3300005530 | Corn Rhizosphere | MPDYIAPTLDGIKLILENFGKEYPDAPRRDPKEFVDGSIIDRLKNERFVEGLKY* |
Ga0070695_1009517262 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AALMPDYIAPTLDGIKLILENFGKEYPDAPRRDPKEFVDGSITDRLKNERFVEGLKY* |
Ga0066698_100734793 | 3300005558 | Soil | MPDYIAPTIEGTKLILENFGKQYPDAPRRDPKEFVDGSIIDRLKNERFVEGLKS* |
Ga0074479_108324451 | 3300005829 | Sediment (Intertidal) | DGIKLILENFGKEYPDAPRRDPKEFVDGSLIERLKQEKFVESLKF* |
Ga0068863_1026665082 | 3300005841 | Switchgrass Rhizosphere | DGIKVILENFGKEYPDAPKRDPKEFVDSSIIERLKNERFVEGLKS* |
Ga0075292_10029843 | 3300005887 | Rice Paddy Soil | FVSSLMPDYISPTLDGIKVILENFGKEYPDAPKRDPREFVDGSIIERLKQEKFVENLKF* |
Ga0075277_10819702 | 3300005895 | Rice Paddy Soil | KVILENFGKEYPDAPRRDPKEFVDGSLIDRLKQEKFVEGLRF* |
Ga0075417_106287801 | 3300006049 | Populus Rhizosphere | PDYIVPTLDGIKLILENFGKEYPDAARRDPKEFIDGSLIERLRQEKFVEGLKS* |
Ga0075417_106670041 | 3300006049 | Populus Rhizosphere | RLILENFGKEYPDAPRRDPKEFVDGSIIERLKQERFAEGLKQ* |
Ga0070715_102360441 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LDGIKLILENFGKEYPDAPRRDPKEFVDGSIIERLKNERFVEGLKS* |
Ga0070716_1002204142 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DYPAPTLDGIRLILENFGKEYPDAPRRDPKEFVDGSIIERLKQERFAEGLKQ* |
Ga0070716_1010789931 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DFVASLMPDYIAPTLDGIKLILENFGKEYPDAPRRDPKEFVDGSIIERLKNERFVEGLKS |
Ga0097621_1022955371 | 3300006237 | Miscanthus Rhizosphere | TLEGIKVILDNFGKEYPDAPRRDPKEFVDGTIIERLKQERFAENLK* |
Ga0075420_1006755933 | 3300006853 | Populus Rhizosphere | SLMPDYITPTFDGIKLILENFGKEYPDAAKRDPKEFADGSIIERLKQEKFAEGLKF* |
Ga0075420_1012755531 | 3300006853 | Populus Rhizosphere | TFDGIKLILENFGKEYPDAAKRDPKEFADGSIIERLKQEKFAEGLKF* |
Ga0075434_1006423261 | 3300006871 | Populus Rhizosphere | EGTKLILENFGKEYPDAPKRDPKEFVDSSIMDRLKNERFVEGLKY* |
Ga0079217_100797323 | 3300006876 | Agricultural Soil | ENFGKEYPDAPKRDPKEFADSSIMDRLKQEKFVENLKF* |
Ga0075429_1005197273 | 3300006880 | Populus Rhizosphere | SLMPDYIAPTLDGIKLILENFGKEYPDAPKREPKEFVDGSLMERLKQEKFVEGLKY* |
Ga0075429_1009587461 | 3300006880 | Populus Rhizosphere | ENFGKEYPEAPRRDPKEFIDGSPIERLKQEKFVEGLKY* |
Ga0075419_104007961 | 3300006969 | Populus Rhizosphere | IAPTLDGIKLILENFGKEYPDAPKREPKEFVDGSLMERLKQEKFVEGLKY* |
Ga0079218_107330341 | 3300007004 | Agricultural Soil | ENFGKEYPDAPKRDPKEFADSSIMDRLKQEKFVENLRF* |
Ga0075435_1013603631 | 3300007076 | Populus Rhizosphere | DGIKVILENFGKEYPDAPRRDPKEFVDGSIIDRLKNERFVEGLKY* |
Ga0066709_1000497223 | 3300009137 | Grasslands Soil | MPDYIAPTIEGTRLILENFGKEYPDATRRDPKEFVDGSLIERLKQEKFAEGLKY* |
Ga0105092_100295724 | 3300009157 | Freshwater Sediment | IRLILENFGKEYPDAPRRDPKEFVDGSIIDRLKQERFVESLKF* |
Ga0105092_106635692 | 3300009157 | Freshwater Sediment | GKEYPDAPRRDPKEFVDGSIIERLKQERFAEGLKQ* |
Ga0075423_106938792 | 3300009162 | Populus Rhizosphere | VASLMPDYIAPTLDGIKLILENFGKEYPDAPKRDPKEFVDSSIIERLKNERFVEGLKS* |
Ga0075423_113803041 | 3300009162 | Populus Rhizosphere | PTFDGIKLILENFGKEYPDAAKRDPKEFADGSLIERLKQEKFAEGLKF* |
Ga0105242_106415901 | 3300009176 | Miscanthus Rhizosphere | LENFGKEYPDAPKRDPKEFVDSSIMERLKSERFVEGLKY* |
Ga0126308_106989971 | 3300010040 | Serpentine Soil | ENFGKEYPDAPRRDPKEFVDSSIIDRLKQERFAESLKF* |
Ga0126382_124937492 | 3300010047 | Tropical Forest Soil | RLILENFGKEYPGAPRRDPKEFVDGSIIERLKQERFVEGLKQ* |
Ga0126370_100378311 | 3300010358 | Tropical Forest Soil | ILENFGKEYPDAPRRDPKEFVDGSIIERLKQERFAQGLKQ* |
Ga0126372_107046391 | 3300010360 | Tropical Forest Soil | LENFGKEYPDAPRRDPKEFVDGSFIDRLEQERFAEGLKQ* |
Ga0126377_124276712 | 3300010362 | Tropical Forest Soil | LENFGKEYPDAPRRDPKEFVDGSIIDRLKQERFVGGLKQ* |
Ga0134125_127746622 | 3300010371 | Terrestrial Soil | VASLMPDYIAPTLDGIKLILENFGKEYPDAPRRDPKEFVDGSIIDRLKNERFVEGLKY* |
Ga0105239_119793811 | 3300010375 | Corn Rhizosphere | NFGKEYPDAPKRDPKEFVDSAIMDRLKNERFVEGLKY* |
Ga0136847_105816361 | 3300010391 | Freshwater Sediment | LILENFGKEYPDAPRRDPKEFADGSIIERLKEEKFVEGLKF* |
Ga0126383_135810321 | 3300010398 | Tropical Forest Soil | TLEGIKLILENFGREYPDAPRRDPKEFVDGSFIDRLKQERFAEGLKQ* |
Ga0134127_101691221 | 3300010399 | Terrestrial Soil | VLTNPKPRRDPKEFVDSSIMDWLKQEKFVEGLKF* |
Ga0134127_127676542 | 3300010399 | Terrestrial Soil | PDYISPTLDGIKLILENFGKEYPDAPRRDPKEFADGSIMDRLKQEKFVESLKF* |
Ga0137424_10920492 | 3300011412 | Soil | YMAPTLEGLKVILENFGKEYPDAPKRDPKEFADGSIIERLKQEKFAEGLKF* |
Ga0137438_11405722 | 3300011431 | Soil | DGLKVILENFGKEYPDAPKRDPKEFADGSIIERLKQEKFAEGLRF* |
Ga0137342_11102531 | 3300012171 | Soil | PDYPAPTLDGIRLILENFGKEYPDAPRRDPKEFVDGSIIDRLKQERFAEGLKQ* |
Ga0137372_101541693 | 3300012350 | Vadose Zone Soil | MPDYIAPTIEGTNLILENFGKEYPDAPRHDPKEFVDGSIIDRLKNERFVEGLKS* |
Ga0137375_101564825 | 3300012360 | Vadose Zone Soil | MPDYIAPTLEGIKLILENFGKEYPDAPKRDPKEFVDGSLIERLKQEKFVEGLKY* |
Ga0157316_10021501 | 3300012510 | Arabidopsis Rhizosphere | NFGKEYPDAPKRDPKEFVDSSIMDRLKNERFVEGLKY* |
Ga0137358_108232131 | 3300012582 | Vadose Zone Soil | SLMPDYIAPTLDGIKLILENFGKEYPDAPRRDPKEFVDGSIIERLKQEKFVEGLRF* |
Ga0137404_110693582 | 3300012929 | Vadose Zone Soil | PDYITPTLEGTKLILENFGKEYPDAPKRDPKEFVDSSIMDRLKNERFVEGLKY* |
Ga0137407_100599744 | 3300012930 | Vadose Zone Soil | MPDYIAPTIEGTKLILENFGKEYPDAPRRDPKEFVDGSIIDRLKNERFVEGLKS* |
Ga0126375_100130031 | 3300012948 | Tropical Forest Soil | APTLDGIRLILENFGKEYPDAPRRDPKEFVDGSIIERLKQERFAQGLKQ* |
Ga0164300_107094432 | 3300012951 | Soil | LMPDYIAPTLEGIKVILDNFGKEYPDAPRRDPKEFVDGTIIERLKQERFAENLK* |
Ga0164299_110102932 | 3300012958 | Soil | ALMPDYIAPTLEGIKVILDNFGKEYPDAPRRDPKEFVDGTIIERLKQERFAENLK* |
Ga0153916_111393252 | 3300012964 | Freshwater Wetlands | LILEKFGKYPDASRRVPKEFIDSSFIDRLKQERFAEGLKQ* |
Ga0153916_123988761 | 3300012964 | Freshwater Wetlands | DGLKLILENFGKEYPDAPRRDPKEFIDGSISERLKQERFVESLKY* |
Ga0163162_105607442 | 3300013306 | Switchgrass Rhizosphere | PDYIAPTLEGTKLILENFGKEYPDAPKRDPKEFVDGSIIDRLKNERFVEGLKY* |
Ga0075325_10048054 | 3300014270 | Natural And Restored Wetlands | MPDYPAPNLDGIKVILENFGKEYPDALRRDPKEFVDGSIIERLKQEKFAEGLKF* |
Ga0075322_10893321 | 3300014311 | Natural And Restored Wetlands | APNLDGIKVILENFGKEYPEAPKRDPKEFVDGSLIDRLKQEKFVEGLKF* |
Ga0075316_10821072 | 3300014314 | Natural And Restored Wetlands | SPTLDGIKVILENFGKEYPDAPKRDPREFVDGSIIERLKQEKFVENLKF* |
Ga0180063_11630411 | 3300014885 | Soil | LDGIKLILENFGKEYPDAPRRDPKEFVDGSLIERLKQERFVESLKY* |
Ga0182034_104122892 | 3300016371 | Soil | DGIRLILDNFGKEYPDAPRRDPREFVDGSIIERLKQERFAEGLKQ |
Ga0134083_100326951 | 3300017659 | Grasslands Soil | MPDYIAPTIEGTKLILENFGKEYPDAPRRDAKEFVDGSIIDRLKNERFVEGLKS |
Ga0184637_100353342 | 3300018063 | Groundwater Sediment | LESLNRDSIRLILENFGKEYPDASRRDPKEFADGSFIERLKQERFVESLKQ |
Ga0184632_100762551 | 3300018075 | Groundwater Sediment | FDFVSSLMPDYIAPTIEGTRLILENFGKEYPDAPKRDPKEFVDGSIIDRLKNERFVEGLK |
Ga0190265_102668743 | 3300018422 | Soil | LIKKYPDARRRDPKEFADSSIMDRLKQEKFVEGLKF |
Ga0190265_126264852 | 3300018422 | Soil | GKEYPDAPRRDPKEFVDTSIMDRLKQEKFAEGLKF |
Ga0190272_111880151 | 3300018429 | Soil | MPDYISPTLDGIKLILENFSKEYPDAPRRDPKEFVDSSIMDRLKQEKFVEGLKF |
Ga0066655_113894331 | 3300018431 | Grasslands Soil | KLSMEKFGKEYPDAPRRDPKEFVDGSIIDRLKNERFVEGLKS |
Ga0173481_104945892 | 3300019356 | Soil | LDGVKLILENFGKEYPDAAKRDPKEFVDSSIIERLKNERFVEGLKS |
Ga0190264_109817602 | 3300019377 | Soil | LMPDYISPTLDGIKLILENFGKEYPDAPKRDPKEFADGSIMDRLKQEKFVEGLKF |
Ga0193716_10785861 | 3300020061 | Soil | SLMPDYITRTIEGTKLILENFGKEYPDAPKRDPKEFVDSSIMDRLKNERFVEGLKY |
Ga0206227_10907531 | 3300021063 | Deep Subsurface Sediment | YIAPTLDGLKLILENFGKEYPDAPRRDPKEFADGSIIERLKQEKFAESLRF |
Ga0210334_100235042 | 3300021859 | Estuarine | ATKLILENCGKEYPDAPKRDPKEFADGSIIERLKQEKFAEGLKY |
Ga0124853_13050865 | 3300024056 | Freshwater Wetlands | MAPTYDGLKIILENFGKEYPDAPKRDPKEFADGSIIERLKQEKFAEGLKF |
Ga0124853_13647643 | 3300024056 | Freshwater Wetlands | MPDYMAPTFDGIKVILENFGKEYPDAPKRDPKEFADGSIIERLKQEKFAEGLKF |
Ga0209343_101952112 | 3300025311 | Groundwater | DGIKLILENFGKEYPDAPRRDPKEFIDGSISERLKQERFVESLKY |
Ga0209640_109614642 | 3300025324 | Soil | DFVSALMPDYIAPTLDGIKVILENFGKEYPDAPRRDPKEFADGSIIERLKQEKFAEGLKF |
Ga0207680_105524271 | 3300025903 | Switchgrass Rhizosphere | TLDGIKVILENFGKEYPDAPKRDPKEFVDSSIIERLKNERFVEGLKS |
Ga0207685_103489781 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LDGIKLILENFGKEYPDAPRRDPKEFVDGSIIERLKNERFVEGLKS |
Ga0207701_101351131 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | DYIAPTFDGIKLILENFGKEYPDAAKRDPKEFADGSIIERLKQEKFAEGLKS |
Ga0207644_113703921 | 3300025931 | Switchgrass Rhizosphere | PTLEGIKVILDNFGKEYPDAPRRDPKEFVDGTIIERLKQERFAENLK |
Ga0207712_102139573 | 3300025961 | Switchgrass Rhizosphere | GKEYPDAPKRDPKEFVDSSIMDRLKNERFVEGLKY |
Ga0208141_10134462 | 3300025988 | Rice Paddy Soil | LENFGKEYPDAPRRDPKEFVDGSLIDRLKQEKFVEGLRF |
Ga0208531_10029781 | 3300026020 | Rice Paddy Soil | GIKVILENFGKEYPDAPKRDPREFVDGSIIERLKQEKFVENLKF |
Ga0208911_10035752 | 3300026051 | Natural And Restored Wetlands | MPDYPAPNLDGIKVILENFGKEYPDALRRDPKEFVDGSIIERLKQEKFAEGLKF |
Ga0207641_124870691 | 3300026088 | Switchgrass Rhizosphere | DGIKVILENFGKEYPDAPKRDPKEFVDSSIIERLKNERFVEGLKS |
Ga0207698_109588042 | 3300026142 | Corn Rhizosphere | YIAPTLDGIKLILENFGKEYPDAPKRDPKEFVDSSIIERLKNERFVEGLKS |
Ga0209971_10178971 | 3300027682 | Arabidopsis Thaliana Rhizosphere | GKEYPDAPKRDPREFVDGSIIERLKQEKFVENLKF |
Ga0209481_104576621 | 3300027880 | Populus Rhizosphere | KLILENFGKEYPDAPKREPKEFVDGSLMERLKQEKFVEGLKY |
Ga0247663_10210991 | 3300028145 | Soil | ALMPDYMAPTLDGLKVILENFGKEYPDAPKRDPKEFADSSIIERLKQEKFVEGLKF |
Ga0310813_116180431 | 3300031716 | Soil | GIKLILENFGKEYPDAPRRDPKEFVDGSIIERLKNERFVEGLKS |
Ga0306921_111563981 | 3300031912 | Soil | FVALLMPDYIAPTLDGIKLILENFGKEYPDAPKRDPKEFVDGSIIERLKSERFVEGLKS |
Ga0310916_104483611 | 3300031942 | Soil | SLIPDYIAPTLDGIKLILENFGKEYPDAPKRDPNEFVDGSIIERLKSERFVEGLKS |
Ga0307472_1015439422 | 3300032205 | Hardwood Forest Soil | FGKEYPDAPKRDPKEFVDGSIMDRLKNERFVEGLKY |
Ga0335082_100237081 | 3300032782 | Soil | FGKEYPDAPRRDPKEFVDSSFIDRLKQERFVEGLR |
Ga0335084_105605642 | 3300033004 | Soil | GIKLILENFGKEYPDAPRRDPKEFVDSSFIDRLKQERFVEGLKQ |
Ga0310914_116733551 | 3300033289 | Soil | NFGKEYPDAPKRDPNEFVDGSIIERLKSERFVEGLKS |
Ga0316624_100918201 | 3300033486 | Soil | GIKVILENVGKEYPDAPRRDPKEFVDGSLIDRLKQEKFVEGLKF |
Ga0316628_1000869532 | 3300033513 | Soil | MLENFGKEYQDAPHCDPKEFIDGSYIERLKSERLVENLKF |
⦗Top⦘ |