Metagenome Family F074088

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F074088
Family Type	Metagenome
Number of Sequences	120
Average Sequence Length	39 residues
Representative Sequence	MNRRKMMFAAIFGSVLLGLAALVGLAGHFATERQDDDDDR
Number of Associated Samples	79
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	75.83 %
% of genes near scaffold ends (potentially truncated)	11.67 %
% of genes from short scaffolds (< 2000 bps)	81.67 %
Associated GOLD sequencing projects	70
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (80.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (28.333 % of family members)
Environment Ontology (ENVO)	Unclassified (52.500 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (67.500 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF00034	Cytochrom_C	40.83
PF02417	Chromate_transp	38.33
PF13442	Cytochrome_CBB3	5.83
PF02777	Sod_Fe_C	1.67
PF01656	CbiA	0.83
PF09828	Chrome_Resist	0.83
PF01554	MatE	0.83
PF02518	HATPase_c	0.83
PF02738	MoCoBD_1	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG2059	Chromate transport protein ChrA	Inorganic ion transport and metabolism [P]	38.33
COG0605	Superoxide dismutase	Inorganic ion transport and metabolism [P]	1.67

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	80.00 %
Unclassified	root	N/A	20.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	80.00 %
Unclassified	root	N/A	20.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	80.00 %
Unclassified	root	N/A	20.00 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	61.67 %
Unclassified	root	N/A	20.00 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	4.17 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	58.33 %
Unclassified	root	N/A	20.00 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	4.17 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	49.17 %
Unclassified	root	N/A	20.00 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	5.00 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	4.17 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	27.50 %
Unclassified	root	N/A	20.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.00 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	4.17 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	21.67 %
Unclassified	root	N/A	20.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.00 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	4.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.00 %
Bradyrhizobium tropiciagri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	10.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.00 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	4.17 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459005\|F1BAP7Q02HIEWU	Not Available	506	Open in IMG/M
3300002245\|JGIcombinedJ26739_100687575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	901	Open in IMG/M
3300002910\|JGI25615J43890_1087886	Not Available	548	Open in IMG/M
3300002914\|JGI25617J43924_10275445	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300004268\|Ga0066398_10018377	Not Available	1144	Open in IMG/M
3300004633\|Ga0066395_10001871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7313	Open in IMG/M
3300005332\|Ga0066388_100120334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3146	Open in IMG/M
3300005332\|Ga0066388_100279823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2311	Open in IMG/M
3300005332\|Ga0066388_101774874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	1096	Open in IMG/M
3300005332\|Ga0066388_102378203	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	960	Open in IMG/M
3300005332\|Ga0066388_103137461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	844	Open in IMG/M
3300005332\|Ga0066388_103842288	All Organisms → cellular organisms → Bacteria → Proteobacteria	766	Open in IMG/M
3300005332\|Ga0066388_103955867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	756	Open in IMG/M
3300005332\|Ga0066388_105244747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	657	Open in IMG/M
3300005332\|Ga0066388_105621937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	635	Open in IMG/M
3300005439\|Ga0070711_100761225	Not Available	819	Open in IMG/M
3300005531\|Ga0070738_10181105	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	987	Open in IMG/M
3300005764\|Ga0066903_100000136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	36117	Open in IMG/M
3300005764\|Ga0066903_100674686	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1814	Open in IMG/M
3300005764\|Ga0066903_100728107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1756	Open in IMG/M
3300005764\|Ga0066903_101366454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1328	Open in IMG/M
3300005764\|Ga0066903_101705474	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	1200	Open in IMG/M
3300005764\|Ga0066903_103006748	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	913	Open in IMG/M
3300005764\|Ga0066903_104892031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	712	Open in IMG/M
3300005764\|Ga0066903_105102771	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	696	Open in IMG/M
3300006028\|Ga0070717_11534751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	604	Open in IMG/M
3300006047\|Ga0075024_100043486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1861	Open in IMG/M
3300006163\|Ga0070715_10355626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	801	Open in IMG/M
3300007255\|Ga0099791_10002659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7246	Open in IMG/M
3300007258\|Ga0099793_10152659	All Organisms → cellular organisms → Bacteria	1094	Open in IMG/M
3300007788\|Ga0099795_10017264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2298	Open in IMG/M
3300009038\|Ga0099829_10531776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	976	Open in IMG/M
3300009090\|Ga0099827_10271918	Not Available	1429	Open in IMG/M
3300009792\|Ga0126374_10241594	Not Available	1173	Open in IMG/M
3300010043\|Ga0126380_10073210	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1953	Open in IMG/M
3300010043\|Ga0126380_10201582	Not Available	1333	Open in IMG/M
3300010046\|Ga0126384_10002790	All Organisms → cellular organisms → Bacteria → Proteobacteria	10606	Open in IMG/M
3300010046\|Ga0126384_10009369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6053	Open in IMG/M
3300010046\|Ga0126384_11699280	Not Available	597	Open in IMG/M
3300010047\|Ga0126382_10873059	All Organisms → cellular organisms → Bacteria	775	Open in IMG/M
3300010048\|Ga0126373_12566516	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300010159\|Ga0099796_10137242	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	953	Open in IMG/M
3300010358\|Ga0126370_10261313	All Organisms → cellular organisms → Bacteria → Proteobacteria	1349	Open in IMG/M
3300010358\|Ga0126370_10273014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	1325	Open in IMG/M
3300010358\|Ga0126370_10743030	Not Available	868	Open in IMG/M
3300010358\|Ga0126370_11114540	Not Available	728	Open in IMG/M
3300010359\|Ga0126376_10557333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1074	Open in IMG/M
3300010359\|Ga0126376_11415802	All Organisms → cellular organisms → Bacteria	720	Open in IMG/M
3300010360\|Ga0126372_10584574	Not Available	1068	Open in IMG/M
3300010360\|Ga0126372_11684409	Not Available	675	Open in IMG/M
3300010360\|Ga0126372_12012556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	624	Open in IMG/M
3300010362\|Ga0126377_12535117	Not Available	588	Open in IMG/M
3300010362\|Ga0126377_13098652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	537	Open in IMG/M
3300010366\|Ga0126379_10222360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1835	Open in IMG/M
3300010366\|Ga0126379_10514071	Not Available	1271	Open in IMG/M
3300010366\|Ga0126379_12033407	Not Available	677	Open in IMG/M
3300010376\|Ga0126381_100821272	Not Available	1335	Open in IMG/M
3300010376\|Ga0126381_103974833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	576	Open in IMG/M
3300010398\|Ga0126383_10028207	All Organisms → cellular organisms → Bacteria → Proteobacteria	4414	Open in IMG/M
3300010398\|Ga0126383_10839192	Not Available	1003	Open in IMG/M
3300010398\|Ga0126383_12595712	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300011269\|Ga0137392_10783162	Not Available	788	Open in IMG/M
3300012096\|Ga0137389_10236079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1533	Open in IMG/M
3300012096\|Ga0137389_10625406	Not Available	925	Open in IMG/M
3300012199\|Ga0137383_10825028	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	677	Open in IMG/M
3300012202\|Ga0137363_10075636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2492	Open in IMG/M
3300012203\|Ga0137399_10613161	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	915	Open in IMG/M
3300012204\|Ga0137374_10998866	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	605	Open in IMG/M
3300012205\|Ga0137362_11437841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	576	Open in IMG/M
3300012357\|Ga0137384_10896221	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300012362\|Ga0137361_10459137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1170	Open in IMG/M
3300012685\|Ga0137397_10438401	All Organisms → cellular organisms → Bacteria	973	Open in IMG/M
3300012924\|Ga0137413_10539751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	864	Open in IMG/M
3300012927\|Ga0137416_10364361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1216	Open in IMG/M
3300012927\|Ga0137416_10448511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1102	Open in IMG/M
3300012944\|Ga0137410_10137772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1848	Open in IMG/M
3300012971\|Ga0126369_10442496	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1347	Open in IMG/M
3300012971\|Ga0126369_10647024	Not Available	1131	Open in IMG/M
3300012971\|Ga0126369_12289120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	627	Open in IMG/M
3300015241\|Ga0137418_10959963	Not Available	622	Open in IMG/M
3300015245\|Ga0137409_10124717	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2370	Open in IMG/M
3300016294\|Ga0182041_11544357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	612	Open in IMG/M
3300016294\|Ga0182041_11830721	Not Available	563	Open in IMG/M
3300016341\|Ga0182035_10899568	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	781	Open in IMG/M
3300016357\|Ga0182032_11558499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	574	Open in IMG/M
3300020199\|Ga0179592_10203582	All Organisms → cellular organisms → Bacteria	897	Open in IMG/M
3300020580\|Ga0210403_10832276	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	732	Open in IMG/M
3300021086\|Ga0179596_10102183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1304	Open in IMG/M
3300021086\|Ga0179596_10378733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	712	Open in IMG/M
3300021088\|Ga0210404_10273591	Not Available	924	Open in IMG/M
3300021170\|Ga0210400_11457745	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300021178\|Ga0210408_10248834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	1416	Open in IMG/M
3300021432\|Ga0210384_10823345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	827	Open in IMG/M
3300021478\|Ga0210402_10799657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	868	Open in IMG/M
3300021560\|Ga0126371_10055370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3808	Open in IMG/M
3300021560\|Ga0126371_10094625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2962	Open in IMG/M
3300021560\|Ga0126371_10572487	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1278	Open in IMG/M
3300021560\|Ga0126371_13265766	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300024330\|Ga0137417_1322395	All Organisms → cellular organisms → Bacteria	2228	Open in IMG/M
3300025905\|Ga0207685_10238386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	874	Open in IMG/M
3300026320\|Ga0209131_1002283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	13106	Open in IMG/M
3300026355\|Ga0257149_1004202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1690	Open in IMG/M
3300026482\|Ga0257172_1006897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1763	Open in IMG/M
3300026490\|Ga0257153_1064364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	743	Open in IMG/M
3300027654\|Ga0209799_1010163	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2009	Open in IMG/M
3300027655\|Ga0209388_1007038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2944	Open in IMG/M
3300027826\|Ga0209060_10003943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	11996	Open in IMG/M
3300027874\|Ga0209465_10011712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3905	Open in IMG/M
3300027874\|Ga0209465_10022090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2939	Open in IMG/M
3300027915\|Ga0209069_10008108	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5187	Open in IMG/M
3300028047\|Ga0209526_10360624	Not Available	972	Open in IMG/M
3300031128\|Ga0170823_15048937	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300031231\|Ga0170824_115035167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1145	Open in IMG/M
3300031474\|Ga0170818_108306906	All Organisms → cellular organisms → Bacteria	765	Open in IMG/M
3300031845\|Ga0318511_10326078	All Organisms → cellular organisms → Bacteria	697	Open in IMG/M
3300031890\|Ga0306925_11884891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	569	Open in IMG/M
3300031954\|Ga0306926_12991502	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300031954\|Ga0306926_13018110	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	502	Open in IMG/M
3300032076\|Ga0306924_10256116	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2010	Open in IMG/M
3300032180\|Ga0307471_101574555	All Organisms → cellular organisms → Bacteria	814	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	98.33%
Aquatic	Environmental → Aquatic	1.67%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	98.33%
Sediment	Environmental → Aquatic → Sediment	1.67%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	75.00%
Loam	Environmental → Terrestrial → Soil → Loam	23.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.67%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	53.33%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	20.00%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	18.33%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.67%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	28.33%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	23.33%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	18.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.67%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.33%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.50%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.50%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.67%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.67%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.67%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.83%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300002910	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm	Environmental	Open in IMG/M
3300002914	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300024330	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300026355	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A	Environmental	Open in IMG/M
3300026482	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B	Environmental	Open in IMG/M
3300026490	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A	Environmental	Open in IMG/M
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027655	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)	Environmental	Open in IMG/M
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E41_06400990	2170459005	Grass Soil	MNRRKAIFAAVFGSILLGLAALVGLAGHFATARQDDDDD
JGIcombinedJ26739_1006875752	3300002245	Forest Soil	MKRRKVIFIAVFGSVFLGLAALVGLAGHFATARQDDNDD*
JGI25615J43890_10878861	3300002910	Grasslands Soil	EIHMNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR*
JGI25617J43924_102754451	3300002914	Grasslands Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR*
Ga0066398_100183771	3300004268	Tropical Forest Soil	MNRRQMMFAAIFGSVLLGLAALIGLAGHFATERQDDDDDR*
Ga0066395_100018717	3300004633	Tropical Forest Soil	MNRRKMMFVAVFGSVRLGLAALVGLAGHFATERQDDDNDR*
Ga0066388_1001203343	3300005332	Tropical Forest Soil	MTRRKLMFAAIFGSALVGLAALVGLAGYFATEREDDDDDR*
Ga0066388_1002798234	3300005332	Tropical Forest Soil	MTRRKLMFAAIFGSVLLSLAALVGLAGYFATEREDDDDDR*
Ga0066388_1017748742	3300005332	Tropical Forest Soil	MNRRKMIFAAIFGSALLGLAALVGLAGHFATARQDDDDDDQ*
Ga0066388_1023782032	3300005332	Tropical Forest Soil	MNRRQMMFAAIFGSVLLGLAALVGLAGYFATERQDDDDDR*
Ga0066388_1031374612	3300005332	Tropical Forest Soil	MNRRKMMFVAIFGSALLGLAALVGLAGHFATARQDDDDDR*
Ga0066388_1038422882	3300005332	Tropical Forest Soil	MNRRQMMFAAIFGSVLLGLAVLVGLAGYFATERQDDDDDR*
Ga0066388_1039558672	3300005332	Tropical Forest Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDE*
Ga0066388_1052447472	3300005332	Tropical Forest Soil	MNRRKMVFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR*
Ga0066388_1056219372	3300005332	Tropical Forest Soil	MNRRKMMFAAIFSALLGLAALVGLAGHFATARQDDDDNQ*
Ga0070711_1007612252	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MNRRNMMIAAAFGSVLLGLAALVGLAGHFATARQDDDDE*
Ga0070738_101811053	3300005531	Surface Soil	MNRRKLMFAAIFDSALLGLAALVGLAGHFASARQDDDDR*
Ga0066903_10000013642	3300005764	Tropical Forest Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGHYAIERQDDDEVR*
Ga0066903_1006746864	3300005764	Tropical Forest Soil	CSPVGSWSNRRFCMTRRKLMFAAIFGSVLLSLAALVGLAGYFATEREDDDDDR*
Ga0066903_1007281072	3300005764	Tropical Forest Soil	MNRRTLMFAAIFGSALLGLAALAGLAGQFATARQDNDDDE*
Ga0066903_1013664542	3300005764	Tropical Forest Soil	MNRRKVMFAAIFGSALLGLAALIGLADHFATARQDDDDDR*
Ga0066903_1017054742	3300005764	Tropical Forest Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDEDQ*
Ga0066903_1030067482	3300005764	Tropical Forest Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFSTARQDDDDDR*
Ga0066903_1048920312	3300005764	Tropical Forest Soil	MSRRKMMFAAIFGSALLGLAALVRLAGHFATARQDNDDDQ*
Ga0066903_1051027712	3300005764	Tropical Forest Soil	MTRRKLMLAAIFGSALVGLAALVGLAGYFATARDDDDDDQ*
Ga0070717_115347511	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MNRRKAIFAAVLGSILVGLAALVGLAGHFATARQDDDDD*
Ga0075024_1000434861	3300006047	Watersheds	MNRRKMMFAAVFGVLLGLAALVGLAGHFATARQDDDDD*
Ga0070715_103556262	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MNRRKMMFTAVFGSVLLGLAALVGLAGHFATGRQDDDDDQ*
Ga0099791_100026596	3300007255	Vadose Zone Soil	MMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ*
Ga0099793_101526593	3300007258	Vadose Zone Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ*
Ga0099795_100172645	3300007788	Vadose Zone Soil	RKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR*
Ga0099829_105317762	3300009038	Vadose Zone Soil	MNRRKMMFAAVFGSALLGLAALVGLAGHFATARRDDDDDQ*
Ga0099827_102719183	3300009090	Vadose Zone Soil	MNRRKLMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR*
Ga0126374_102415941	3300009792	Tropical Forest Soil	MMFAAIFGSVLLGLAALVGLAGYFATERQDDDDDR*
Ga0126380_100732103	3300010043	Tropical Forest Soil	MFAAIFGSALVGLAALVGLAGYFATEREDDDDDR*
Ga0126380_102015823	3300010043	Tropical Forest Soil	MNRRQMMFAAIFGSVLLGLVVLVGLAGYFATERQDDDDDR*
Ga0126384_100027902	3300010046	Tropical Forest Soil	MMFAAIFGSVLLGLAALIGLAGHFATERQDDDDDR*
Ga0126384_1000936911	3300010046	Tropical Forest Soil	MFAAIFGSVLLSLAALVGLAGYFATEREDDDDDR*
Ga0126384_116992801	3300010046	Tropical Forest Soil	RRLRMTRRKLMFAAIFGSVLLSLAALVGLAGYFATEREDDDDDR*
Ga0126382_108730592	3300010047	Tropical Forest Soil	MNRGKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR*
Ga0126373_125665162	3300010048	Tropical Forest Soil	MNRRQMMFAAVFASVLLGLAALIGLAGHFATARQDDDEDQ*
Ga0099796_101372422	3300010159	Vadose Zone Soil	MNRRKMMFAAIFGSVLLGLAALVGLAGHFATERQDDDDDR*
Ga0126370_102613133	3300010358	Tropical Forest Soil	MMFAAVFGSVLLGLAALVGLASYFAVPKEEDDDDQ*
Ga0126370_102730142	3300010358	Tropical Forest Soil	MNRRKMMLAAIFGSVLLSLAALVGLAGYFATEREDDDDDR*
Ga0126370_107430302	3300010358	Tropical Forest Soil	MNRRKMMTAAIFGSALLGLAALVGLAGHFATARQDDDDE
Ga0126370_111145402	3300010358	Tropical Forest Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDD*
Ga0126376_105573332	3300010359	Tropical Forest Soil	MMFAAIFGSALLGLAALVGLAGHFATERQDDDDDQ*
Ga0126376_114158021	3300010359	Tropical Forest Soil	MTRRKMMLAAIFGSALVGLAALVGLAGYFANGRDEDDDDQ*
Ga0126372_105845742	3300010360	Tropical Forest Soil	MIFAAIFGSALLGLAAPVGLAGHFATERQDGDDDR*
Ga0126372_116844091	3300010360	Tropical Forest Soil	MFAAIFGSALLGLAALVGLAGHFATARQDDDEDQ*
Ga0126372_120125562	3300010360	Tropical Forest Soil	MNRRKMMFAAIFGSVLLGLAALIGLAGHFATARQDDDDDQ*
Ga0126377_125351171	3300010362	Tropical Forest Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATEREDDDDDR*
Ga0126377_130986522	3300010362	Tropical Forest Soil	MNRRKMMTAAIFGSALLGLAALVGLAGHFATARQDDDDE*
Ga0126379_102223602	3300010366	Tropical Forest Soil	MMFAAIFGSVLLGLAVLVGLAGYFATERQDDDDDR*
Ga0126379_105140712	3300010366	Tropical Forest Soil	MMFAAIFGSALLGLAALVRLAGHFATARQDNDDDQ*
Ga0126379_120334071	3300010366	Tropical Forest Soil	MNRRKMMFAAIFGSALLGLAALAGLAGHFATARQDDDDDQ*
Ga0126381_1008212723	3300010376	Tropical Forest Soil	MFAAIFGSVLLSLAALVGWAGYFATEREDDDDDR*
Ga0126381_1039748332	3300010376	Tropical Forest Soil	MMFAAIFGSALLGLAVLVRLAGHFATARQDNDDDQ*
Ga0126383_100282071	3300010398	Tropical Forest Soil	MFAAIFGSVLLGLAALIGLAGHFATERQDDDDDR*
Ga0126383_108391922	3300010398	Tropical Forest Soil	MNRRKVMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ*
Ga0126383_125957121	3300010398	Tropical Forest Soil	MFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR*
Ga0137392_107831622	3300011269	Vadose Zone Soil	HMNRRKMMFAAIFGSVLLGLATFVVLAGPFATERQDDDDDR*
Ga0137389_102360791	3300012096	Vadose Zone Soil	MMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR*
Ga0137389_106254063	3300012096	Vadose Zone Soil	HMNRRKMMFAAIFGSVLLGLAALVGLAGHFATERQDDDDDR*
Ga0137383_108250282	3300012199	Vadose Zone Soil	MNRRKMMFAAIFGSALLGLAALVALAGHFATERQDDDDDR*
Ga0137363_100756363	3300012202	Vadose Zone Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDEDE*
Ga0137399_106131612	3300012203	Vadose Zone Soil	MNRRKMMFAAIFGSVLLGLAALVGLAGHFATARQDDGEDQ*
Ga0137374_109988662	3300012204	Vadose Zone Soil	MTRRIVLLAAIVGSAVLGLAALVGLAGHYAEPRKDDED*
Ga0137362_114378412	3300012205	Vadose Zone Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDGDDDR*
Ga0137384_108962211	3300012357	Vadose Zone Soil	MMIAAVFGSVLLGLAALVGLAGHFATARQDDDDE*
Ga0137361_104591372	3300012362	Vadose Zone Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDNQ*
Ga0137397_104384012	3300012685	Vadose Zone Soil	MMFAAIFGSALLGLAALVGLASHFATSRQDNDDDQ*
Ga0137413_105397512	3300012924	Vadose Zone Soil	MNRRKMMFAAVFGSVLLGLAAFFCFDDHAATERQDDDDDR*
Ga0137416_103643612	3300012927	Vadose Zone Soil	MNRRKMMFAAIFASALLGLAALVGLAGHFATARQDDDEDQ*
Ga0137416_104485112	3300012927	Vadose Zone Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGHFATARQDDDDDQ*
Ga0137410_101377724	3300012944	Vadose Zone Soil	MNRRKMMFAAIFGSALLCLAALVGLAGHFATARQDDDEDE*
Ga0126369_104424962	3300012971	Tropical Forest Soil	MNRRKVMFAAVFGSVLLGLAAPVGLAGHFATERQDGDDDR*
Ga0126369_106470242	3300012971	Tropical Forest Soil	MFAAIFCSALVGLAALVGLAGYFATEREDDDDDR*
Ga0126369_122891202	3300012971	Tropical Forest Soil	MMFAAIFASALLGLAALVRLAGHFATARQDNDDDQ*
Ga0137418_109599631	3300015241	Vadose Zone Soil	RKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ*
Ga0137409_101247175	3300015245	Vadose Zone Soil	MMFAAIFGSALLGLAALVALAGHFATARQEDDEDQ*
Ga0182041_115443571	3300016294	Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGPFATERQDDDDDR
Ga0182041_118307212	3300016294	Soil	NRRRMMFAAIFSSALLGLAALVGLAGHFATARQDDDDDQ
Ga0182035_108995682	3300016341	Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDGDDDQ
Ga0182032_115584991	3300016357	Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGHFATARQDDDDDQ
Ga0179592_102035822	3300020199	Vadose Zone Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ
Ga0210403_108322761	3300020580	Soil	MNRRKMMFAAVFGWVLLGLAALVGLAGHFATARQDDDDDQ
Ga0179596_101021832	3300021086	Vadose Zone Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR
Ga0179596_103787332	3300021086	Vadose Zone Soil	MNRRKMMFAAIFGSVLLGLATLVGLAGHFATERQDDDDDR
Ga0210404_102735911	3300021088	Soil	MNRRKMMFAAVFGWVLLGLAALVGLAGHFATERQDDNDDR
Ga0210400_114577451	3300021170	Soil	MNRRKMMFPAVFGSVLLGLAALVGLAGHFATGRQDDDDDQ
Ga0210408_102488343	3300021178	Soil	MNRRKMIFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR
Ga0210384_108233452	3300021432	Soil	MSRRNMMIAAVFGSVLLGLAALVGLAGHFATARQDDDDE
Ga0210402_107996572	3300021478	Soil	MNRRNMMIAAAFGWVLLGLAALVGLAGHFATARQDDDDE
Ga0126371_100553707	3300021560	Tropical Forest Soil	MNRRQMMFAAIFGSVLLGLAVLVGLAGYFATERQDDDDDR
Ga0126371_100946252	3300021560	Tropical Forest Soil	MNRRKMMFVAVFGSVRLGLAALVGLAGHFATERQDDDNDR
Ga0126371_105724873	3300021560	Tropical Forest Soil	MTRRKLMFAAIFGSVLLSLAALVGLAGYFATEREDDDDDR
Ga0126371_132657662	3300021560	Tropical Forest Soil	MMFAAIFGSVLLGLAALVGLAGYFATERQDDDDDR
Ga0137417_13223955	3300024330	Vadose Zone Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDEDQ
Ga0207685_102383862	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MNRRKMMFTAVFGSVLLGLAALVGLAGHFATGRQDDDDDQ
Ga0209131_100228313	3300026320	Grasslands Soil	MNRRKMMFAAIFGSVLLGLAALVGLAGHFATERQDDDDDR
Ga0257149_10042022	3300026355	Soil	MNRRKMMFAAIFGSVLLGLATLLGLAGHFATERQDDDDDR
Ga0257172_10068972	3300026482	Soil	MNRRKLMFAAIFGSVLLGLATLVGLAGHFATERQDDDDDR
Ga0257153_10643641	3300026490	Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDD
Ga0209799_10101633	3300027654	Tropical Forest Soil	MNRRQMMFAAIFGSVLLGLAALVGLAGYFATERQDDDDDR
Ga0209388_10070384	3300027655	Vadose Zone Soil	MMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ
Ga0209060_100039433	3300027826	Surface Soil	MNRRKLMFAAIFDSALLGLAALVGLAGHFASARQDDDDR
Ga0209465_100117124	3300027874	Tropical Forest Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGHYAIERQDDDEVR
Ga0209465_100220902	3300027874	Tropical Forest Soil	MNRRQMMFAAIFGSVLLGLAALIGLAGHFATERQDDDDDR
Ga0209069_100081089	3300027915	Watersheds	MNRRKMMFAAVFGVLLGLAALVGLAGHFATARQDDDDD
Ga0209526_103606242	3300028047	Forest Soil	RRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR
Ga0170823_150489372	3300031128	Forest Soil	MSRRNVMIAAVFGSVLLGLVALVGLAGHFATARQDDDDE
Ga0170824_1150351673	3300031231	Forest Soil	MSRRNMVIAAVFGSVLLGLAALVGLAGHFATARQDDDDE
Ga0170818_1083069062	3300031474	Forest Soil	MSRRKMMIAAVFGSVLIGLAALVGLVDHFATARQDDEDE
Ga0318511_103260782	3300031845	Soil	MNRRKMMFAAVFGSILLGLAALVGLAGHFATARQDDDDDQ
Ga0306925_118848912	3300031890	Soil	MNRRRMMFAAIFGSALLGLAALVGLAGHFATERQDDDDDQ
Ga0306926_129915021	3300031954	Soil	MMFAAIIGSVLLGLAALVGLAGYFATEGKDDDDDR
Ga0306926_130181102	3300031954	Soil	MNRRKMMFAAIFGSALLGLAALVGLAGHFATERQDDDGD
Ga0306924_102561163	3300032076	Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDQ
Ga0307471_1015745551	3300032180	Hardwood Forest Soil	MNRRKMMFAAVFGSVLLGLAALVGLAGHFATYRQDDDDDQ

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F074088

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences