| Basic Information | |
|---|---|
| Family ID | F074088 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MNRRKMMFAAIFGSVLLGLAALVGLAGHFATERQDDDDDR |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.83 % |
| % of genes near scaffold ends (potentially truncated) | 11.67 % |
| % of genes from short scaffolds (< 2000 bps) | 81.67 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (28.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00034 | Cytochrom_C | 40.83 |
| PF02417 | Chromate_transp | 38.33 |
| PF13442 | Cytochrome_CBB3 | 5.83 |
| PF02777 | Sod_Fe_C | 1.67 |
| PF01656 | CbiA | 0.83 |
| PF09828 | Chrome_Resist | 0.83 |
| PF01554 | MatE | 0.83 |
| PF02518 | HATPase_c | 0.83 |
| PF02738 | MoCoBD_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 38.33 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.00 % |
| Unclassified | root | N/A | 20.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02HIEWU | Not Available | 506 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100687575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 901 | Open in IMG/M |
| 3300002910|JGI25615J43890_1087886 | Not Available | 548 | Open in IMG/M |
| 3300002914|JGI25617J43924_10275445 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300004268|Ga0066398_10018377 | Not Available | 1144 | Open in IMG/M |
| 3300004633|Ga0066395_10001871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7313 | Open in IMG/M |
| 3300005332|Ga0066388_100120334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3146 | Open in IMG/M |
| 3300005332|Ga0066388_100279823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2311 | Open in IMG/M |
| 3300005332|Ga0066388_101774874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 1096 | Open in IMG/M |
| 3300005332|Ga0066388_102378203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 960 | Open in IMG/M |
| 3300005332|Ga0066388_103137461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 844 | Open in IMG/M |
| 3300005332|Ga0066388_103842288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300005332|Ga0066388_103955867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 756 | Open in IMG/M |
| 3300005332|Ga0066388_105244747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 657 | Open in IMG/M |
| 3300005332|Ga0066388_105621937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 635 | Open in IMG/M |
| 3300005439|Ga0070711_100761225 | Not Available | 819 | Open in IMG/M |
| 3300005531|Ga0070738_10181105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 987 | Open in IMG/M |
| 3300005764|Ga0066903_100000136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 36117 | Open in IMG/M |
| 3300005764|Ga0066903_100674686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1814 | Open in IMG/M |
| 3300005764|Ga0066903_100728107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1756 | Open in IMG/M |
| 3300005764|Ga0066903_101366454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1328 | Open in IMG/M |
| 3300005764|Ga0066903_101705474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 1200 | Open in IMG/M |
| 3300005764|Ga0066903_103006748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 913 | Open in IMG/M |
| 3300005764|Ga0066903_104892031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 712 | Open in IMG/M |
| 3300005764|Ga0066903_105102771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 696 | Open in IMG/M |
| 3300006028|Ga0070717_11534751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 604 | Open in IMG/M |
| 3300006047|Ga0075024_100043486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1861 | Open in IMG/M |
| 3300006163|Ga0070715_10355626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 801 | Open in IMG/M |
| 3300007255|Ga0099791_10002659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7246 | Open in IMG/M |
| 3300007258|Ga0099793_10152659 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300007788|Ga0099795_10017264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2298 | Open in IMG/M |
| 3300009038|Ga0099829_10531776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 976 | Open in IMG/M |
| 3300009090|Ga0099827_10271918 | Not Available | 1429 | Open in IMG/M |
| 3300009792|Ga0126374_10241594 | Not Available | 1173 | Open in IMG/M |
| 3300010043|Ga0126380_10073210 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1953 | Open in IMG/M |
| 3300010043|Ga0126380_10201582 | Not Available | 1333 | Open in IMG/M |
| 3300010046|Ga0126384_10002790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10606 | Open in IMG/M |
| 3300010046|Ga0126384_10009369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6053 | Open in IMG/M |
| 3300010046|Ga0126384_11699280 | Not Available | 597 | Open in IMG/M |
| 3300010047|Ga0126382_10873059 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300010048|Ga0126373_12566516 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010159|Ga0099796_10137242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 953 | Open in IMG/M |
| 3300010358|Ga0126370_10261313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1349 | Open in IMG/M |
| 3300010358|Ga0126370_10273014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 1325 | Open in IMG/M |
| 3300010358|Ga0126370_10743030 | Not Available | 868 | Open in IMG/M |
| 3300010358|Ga0126370_11114540 | Not Available | 728 | Open in IMG/M |
| 3300010359|Ga0126376_10557333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1074 | Open in IMG/M |
| 3300010359|Ga0126376_11415802 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300010360|Ga0126372_10584574 | Not Available | 1068 | Open in IMG/M |
| 3300010360|Ga0126372_11684409 | Not Available | 675 | Open in IMG/M |
| 3300010360|Ga0126372_12012556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300010362|Ga0126377_12535117 | Not Available | 588 | Open in IMG/M |
| 3300010362|Ga0126377_13098652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300010366|Ga0126379_10222360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1835 | Open in IMG/M |
| 3300010366|Ga0126379_10514071 | Not Available | 1271 | Open in IMG/M |
| 3300010366|Ga0126379_12033407 | Not Available | 677 | Open in IMG/M |
| 3300010376|Ga0126381_100821272 | Not Available | 1335 | Open in IMG/M |
| 3300010376|Ga0126381_103974833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300010398|Ga0126383_10028207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4414 | Open in IMG/M |
| 3300010398|Ga0126383_10839192 | Not Available | 1003 | Open in IMG/M |
| 3300010398|Ga0126383_12595712 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300011269|Ga0137392_10783162 | Not Available | 788 | Open in IMG/M |
| 3300012096|Ga0137389_10236079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1533 | Open in IMG/M |
| 3300012096|Ga0137389_10625406 | Not Available | 925 | Open in IMG/M |
| 3300012199|Ga0137383_10825028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 677 | Open in IMG/M |
| 3300012202|Ga0137363_10075636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2492 | Open in IMG/M |
| 3300012203|Ga0137399_10613161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 915 | Open in IMG/M |
| 3300012204|Ga0137374_10998866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300012205|Ga0137362_11437841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 576 | Open in IMG/M |
| 3300012357|Ga0137384_10896221 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012362|Ga0137361_10459137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1170 | Open in IMG/M |
| 3300012685|Ga0137397_10438401 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012924|Ga0137413_10539751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 864 | Open in IMG/M |
| 3300012927|Ga0137416_10364361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1216 | Open in IMG/M |
| 3300012927|Ga0137416_10448511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1102 | Open in IMG/M |
| 3300012944|Ga0137410_10137772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1848 | Open in IMG/M |
| 3300012971|Ga0126369_10442496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1347 | Open in IMG/M |
| 3300012971|Ga0126369_10647024 | Not Available | 1131 | Open in IMG/M |
| 3300012971|Ga0126369_12289120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300015241|Ga0137418_10959963 | Not Available | 622 | Open in IMG/M |
| 3300015245|Ga0137409_10124717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2370 | Open in IMG/M |
| 3300016294|Ga0182041_11544357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 612 | Open in IMG/M |
| 3300016294|Ga0182041_11830721 | Not Available | 563 | Open in IMG/M |
| 3300016341|Ga0182035_10899568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300016357|Ga0182032_11558499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 574 | Open in IMG/M |
| 3300020199|Ga0179592_10203582 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300020580|Ga0210403_10832276 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 732 | Open in IMG/M |
| 3300021086|Ga0179596_10102183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1304 | Open in IMG/M |
| 3300021086|Ga0179596_10378733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 712 | Open in IMG/M |
| 3300021088|Ga0210404_10273591 | Not Available | 924 | Open in IMG/M |
| 3300021170|Ga0210400_11457745 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300021178|Ga0210408_10248834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 1416 | Open in IMG/M |
| 3300021432|Ga0210384_10823345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 827 | Open in IMG/M |
| 3300021478|Ga0210402_10799657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 868 | Open in IMG/M |
| 3300021560|Ga0126371_10055370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3808 | Open in IMG/M |
| 3300021560|Ga0126371_10094625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2962 | Open in IMG/M |
| 3300021560|Ga0126371_10572487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1278 | Open in IMG/M |
| 3300021560|Ga0126371_13265766 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300024330|Ga0137417_1322395 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
| 3300025905|Ga0207685_10238386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 874 | Open in IMG/M |
| 3300026320|Ga0209131_1002283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13106 | Open in IMG/M |
| 3300026355|Ga0257149_1004202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1690 | Open in IMG/M |
| 3300026482|Ga0257172_1006897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1763 | Open in IMG/M |
| 3300026490|Ga0257153_1064364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 743 | Open in IMG/M |
| 3300027654|Ga0209799_1010163 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2009 | Open in IMG/M |
| 3300027655|Ga0209388_1007038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2944 | Open in IMG/M |
| 3300027826|Ga0209060_10003943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11996 | Open in IMG/M |
| 3300027874|Ga0209465_10011712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3905 | Open in IMG/M |
| 3300027874|Ga0209465_10022090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2939 | Open in IMG/M |
| 3300027915|Ga0209069_10008108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5187 | Open in IMG/M |
| 3300028047|Ga0209526_10360624 | Not Available | 972 | Open in IMG/M |
| 3300031128|Ga0170823_15048937 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031231|Ga0170824_115035167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1145 | Open in IMG/M |
| 3300031474|Ga0170818_108306906 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031845|Ga0318511_10326078 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300031890|Ga0306925_11884891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 569 | Open in IMG/M |
| 3300031954|Ga0306926_12991502 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031954|Ga0306926_13018110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 502 | Open in IMG/M |
| 3300032076|Ga0306924_10256116 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2010 | Open in IMG/M |
| 3300032180|Ga0307471_101574555 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 28.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 18.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.67% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_06400990 | 2170459005 | Grass Soil | MNRRKAIFAAVFGSILLGLAALVGLAGHFATARQDDDDD |
| JGIcombinedJ26739_1006875752 | 3300002245 | Forest Soil | MKRRKVIFIAVFGSVFLGLAALVGLAGHFATARQDDNDD* |
| JGI25615J43890_10878861 | 3300002910 | Grasslands Soil | EIHMNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR* |
| JGI25617J43924_102754451 | 3300002914 | Grasslands Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR* |
| Ga0066398_100183771 | 3300004268 | Tropical Forest Soil | MNRRQMMFAAIFGSVLLGLAALIGLAGHFATERQDDDDDR* |
| Ga0066395_100018717 | 3300004633 | Tropical Forest Soil | MNRRKMMFVAVFGSVRLGLAALVGLAGHFATERQDDDNDR* |
| Ga0066388_1001203343 | 3300005332 | Tropical Forest Soil | MTRRKLMFAAIFGSALVGLAALVGLAGYFATEREDDDDDR* |
| Ga0066388_1002798234 | 3300005332 | Tropical Forest Soil | MTRRKLMFAAIFGSVLLSLAALVGLAGYFATEREDDDDDR* |
| Ga0066388_1017748742 | 3300005332 | Tropical Forest Soil | MNRRKMIFAAIFGSALLGLAALVGLAGHFATARQDDDDDDQ* |
| Ga0066388_1023782032 | 3300005332 | Tropical Forest Soil | MNRRQMMFAAIFGSVLLGLAALVGLAGYFATERQDDDDDR* |
| Ga0066388_1031374612 | 3300005332 | Tropical Forest Soil | MNRRKMMFVAIFGSALLGLAALVGLAGHFATARQDDDDDR* |
| Ga0066388_1038422882 | 3300005332 | Tropical Forest Soil | MNRRQMMFAAIFGSVLLGLAVLVGLAGYFATERQDDDDDR* |
| Ga0066388_1039558672 | 3300005332 | Tropical Forest Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDE* |
| Ga0066388_1052447472 | 3300005332 | Tropical Forest Soil | MNRRKMVFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR* |
| Ga0066388_1056219372 | 3300005332 | Tropical Forest Soil | MNRRKMMFAAIFSALLGLAALVGLAGHFATARQDDDDNQ* |
| Ga0070711_1007612252 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRRNMMIAAAFGSVLLGLAALVGLAGHFATARQDDDDE* |
| Ga0070738_101811053 | 3300005531 | Surface Soil | MNRRKLMFAAIFDSALLGLAALVGLAGHFASARQDDDDR* |
| Ga0066903_10000013642 | 3300005764 | Tropical Forest Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGHYAIERQDDDEVR* |
| Ga0066903_1006746864 | 3300005764 | Tropical Forest Soil | CSPVGSWSNRRFCMTRRKLMFAAIFGSVLLSLAALVGLAGYFATEREDDDDDR* |
| Ga0066903_1007281072 | 3300005764 | Tropical Forest Soil | MNRRTLMFAAIFGSALLGLAALAGLAGQFATARQDNDDDE* |
| Ga0066903_1013664542 | 3300005764 | Tropical Forest Soil | MNRRKVMFAAIFGSALLGLAALIGLADHFATARQDDDDDR* |
| Ga0066903_1017054742 | 3300005764 | Tropical Forest Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDEDQ* |
| Ga0066903_1030067482 | 3300005764 | Tropical Forest Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFSTARQDDDDDR* |
| Ga0066903_1048920312 | 3300005764 | Tropical Forest Soil | MSRRKMMFAAIFGSALLGLAALVRLAGHFATARQDNDDDQ* |
| Ga0066903_1051027712 | 3300005764 | Tropical Forest Soil | MTRRKLMLAAIFGSALVGLAALVGLAGYFATARDDDDDDQ* |
| Ga0070717_115347511 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRRKAIFAAVLGSILVGLAALVGLAGHFATARQDDDDD* |
| Ga0075024_1000434861 | 3300006047 | Watersheds | MNRRKMMFAAVFGVLLGLAALVGLAGHFATARQDDDDD* |
| Ga0070715_103556262 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRRKMMFTAVFGSVLLGLAALVGLAGHFATGRQDDDDDQ* |
| Ga0099791_100026596 | 3300007255 | Vadose Zone Soil | MMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ* |
| Ga0099793_101526593 | 3300007258 | Vadose Zone Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ* |
| Ga0099795_100172645 | 3300007788 | Vadose Zone Soil | RKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR* |
| Ga0099829_105317762 | 3300009038 | Vadose Zone Soil | MNRRKMMFAAVFGSALLGLAALVGLAGHFATARRDDDDDQ* |
| Ga0099827_102719183 | 3300009090 | Vadose Zone Soil | MNRRKLMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR* |
| Ga0126374_102415941 | 3300009792 | Tropical Forest Soil | MMFAAIFGSVLLGLAALVGLAGYFATERQDDDDDR* |
| Ga0126380_100732103 | 3300010043 | Tropical Forest Soil | MFAAIFGSALVGLAALVGLAGYFATEREDDDDDR* |
| Ga0126380_102015823 | 3300010043 | Tropical Forest Soil | MNRRQMMFAAIFGSVLLGLVVLVGLAGYFATERQDDDDDR* |
| Ga0126384_100027902 | 3300010046 | Tropical Forest Soil | MMFAAIFGSVLLGLAALIGLAGHFATERQDDDDDR* |
| Ga0126384_1000936911 | 3300010046 | Tropical Forest Soil | MFAAIFGSVLLSLAALVGLAGYFATEREDDDDDR* |
| Ga0126384_116992801 | 3300010046 | Tropical Forest Soil | RRLRMTRRKLMFAAIFGSVLLSLAALVGLAGYFATEREDDDDDR* |
| Ga0126382_108730592 | 3300010047 | Tropical Forest Soil | MNRGKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR* |
| Ga0126373_125665162 | 3300010048 | Tropical Forest Soil | MNRRQMMFAAVFASVLLGLAALIGLAGHFATARQDDDEDQ* |
| Ga0099796_101372422 | 3300010159 | Vadose Zone Soil | MNRRKMMFAAIFGSVLLGLAALVGLAGHFATERQDDDDDR* |
| Ga0126370_102613133 | 3300010358 | Tropical Forest Soil | MMFAAVFGSVLLGLAALVGLASYFAVPKEEDDDDQ* |
| Ga0126370_102730142 | 3300010358 | Tropical Forest Soil | MNRRKMMLAAIFGSVLLSLAALVGLAGYFATEREDDDDDR* |
| Ga0126370_107430302 | 3300010358 | Tropical Forest Soil | MNRRKMMTAAIFGSALLGLAALVGLAGHFATARQDDDDE |
| Ga0126370_111145402 | 3300010358 | Tropical Forest Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDD* |
| Ga0126376_105573332 | 3300010359 | Tropical Forest Soil | MMFAAIFGSALLGLAALVGLAGHFATERQDDDDDQ* |
| Ga0126376_114158021 | 3300010359 | Tropical Forest Soil | MTRRKMMLAAIFGSALVGLAALVGLAGYFANGRDEDDDDQ* |
| Ga0126372_105845742 | 3300010360 | Tropical Forest Soil | MIFAAIFGSALLGLAAPVGLAGHFATERQDGDDDR* |
| Ga0126372_116844091 | 3300010360 | Tropical Forest Soil | MFAAIFGSALLGLAALVGLAGHFATARQDDDEDQ* |
| Ga0126372_120125562 | 3300010360 | Tropical Forest Soil | MNRRKMMFAAIFGSVLLGLAALIGLAGHFATARQDDDDDQ* |
| Ga0126377_125351171 | 3300010362 | Tropical Forest Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATEREDDDDDR* |
| Ga0126377_130986522 | 3300010362 | Tropical Forest Soil | MNRRKMMTAAIFGSALLGLAALVGLAGHFATARQDDDDE* |
| Ga0126379_102223602 | 3300010366 | Tropical Forest Soil | MMFAAIFGSVLLGLAVLVGLAGYFATERQDDDDDR* |
| Ga0126379_105140712 | 3300010366 | Tropical Forest Soil | MMFAAIFGSALLGLAALVRLAGHFATARQDNDDDQ* |
| Ga0126379_120334071 | 3300010366 | Tropical Forest Soil | MNRRKMMFAAIFGSALLGLAALAGLAGHFATARQDDDDDQ* |
| Ga0126381_1008212723 | 3300010376 | Tropical Forest Soil | MFAAIFGSVLLSLAALVGWAGYFATEREDDDDDR* |
| Ga0126381_1039748332 | 3300010376 | Tropical Forest Soil | MMFAAIFGSALLGLAVLVRLAGHFATARQDNDDDQ* |
| Ga0126383_100282071 | 3300010398 | Tropical Forest Soil | MFAAIFGSVLLGLAALIGLAGHFATERQDDDDDR* |
| Ga0126383_108391922 | 3300010398 | Tropical Forest Soil | MNRRKVMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ* |
| Ga0126383_125957121 | 3300010398 | Tropical Forest Soil | MFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR* |
| Ga0137392_107831622 | 3300011269 | Vadose Zone Soil | HMNRRKMMFAAIFGSVLLGLATFVVLAGPFATERQDDDDDR* |
| Ga0137389_102360791 | 3300012096 | Vadose Zone Soil | MMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR* |
| Ga0137389_106254063 | 3300012096 | Vadose Zone Soil | HMNRRKMMFAAIFGSVLLGLAALVGLAGHFATERQDDDDDR* |
| Ga0137383_108250282 | 3300012199 | Vadose Zone Soil | MNRRKMMFAAIFGSALLGLAALVALAGHFATERQDDDDDR* |
| Ga0137363_100756363 | 3300012202 | Vadose Zone Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDEDE* |
| Ga0137399_106131612 | 3300012203 | Vadose Zone Soil | MNRRKMMFAAIFGSVLLGLAALVGLAGHFATARQDDGEDQ* |
| Ga0137374_109988662 | 3300012204 | Vadose Zone Soil | MTRRIVLLAAIVGSAVLGLAALVGLAGHYAEPRKDDED* |
| Ga0137362_114378412 | 3300012205 | Vadose Zone Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDGDDDR* |
| Ga0137384_108962211 | 3300012357 | Vadose Zone Soil | MMIAAVFGSVLLGLAALVGLAGHFATARQDDDDE* |
| Ga0137361_104591372 | 3300012362 | Vadose Zone Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDNQ* |
| Ga0137397_104384012 | 3300012685 | Vadose Zone Soil | MMFAAIFGSALLGLAALVGLASHFATSRQDNDDDQ* |
| Ga0137413_105397512 | 3300012924 | Vadose Zone Soil | MNRRKMMFAAVFGSVLLGLAAFFCFDDHAATERQDDDDDR* |
| Ga0137416_103643612 | 3300012927 | Vadose Zone Soil | MNRRKMMFAAIFASALLGLAALVGLAGHFATARQDDDEDQ* |
| Ga0137416_104485112 | 3300012927 | Vadose Zone Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGHFATARQDDDDDQ* |
| Ga0137410_101377724 | 3300012944 | Vadose Zone Soil | MNRRKMMFAAIFGSALLCLAALVGLAGHFATARQDDDEDE* |
| Ga0126369_104424962 | 3300012971 | Tropical Forest Soil | MNRRKVMFAAVFGSVLLGLAAPVGLAGHFATERQDGDDDR* |
| Ga0126369_106470242 | 3300012971 | Tropical Forest Soil | MFAAIFCSALVGLAALVGLAGYFATEREDDDDDR* |
| Ga0126369_122891202 | 3300012971 | Tropical Forest Soil | MMFAAIFASALLGLAALVRLAGHFATARQDNDDDQ* |
| Ga0137418_109599631 | 3300015241 | Vadose Zone Soil | RKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ* |
| Ga0137409_101247175 | 3300015245 | Vadose Zone Soil | MMFAAIFGSALLGLAALVALAGHFATARQEDDEDQ* |
| Ga0182041_115443571 | 3300016294 | Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGPFATERQDDDDDR |
| Ga0182041_118307212 | 3300016294 | Soil | NRRRMMFAAIFSSALLGLAALVGLAGHFATARQDDDDDQ |
| Ga0182035_108995682 | 3300016341 | Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDGDDDQ |
| Ga0182032_115584991 | 3300016357 | Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGHFATARQDDDDDQ |
| Ga0179592_102035822 | 3300020199 | Vadose Zone Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ |
| Ga0210403_108322761 | 3300020580 | Soil | MNRRKMMFAAVFGWVLLGLAALVGLAGHFATARQDDDDDQ |
| Ga0179596_101021832 | 3300021086 | Vadose Zone Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR |
| Ga0179596_103787332 | 3300021086 | Vadose Zone Soil | MNRRKMMFAAIFGSVLLGLATLVGLAGHFATERQDDDDDR |
| Ga0210404_102735911 | 3300021088 | Soil | MNRRKMMFAAVFGWVLLGLAALVGLAGHFATERQDDNDDR |
| Ga0210400_114577451 | 3300021170 | Soil | MNRRKMMFPAVFGSVLLGLAALVGLAGHFATGRQDDDDDQ |
| Ga0210408_102488343 | 3300021178 | Soil | MNRRKMIFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR |
| Ga0210384_108233452 | 3300021432 | Soil | MSRRNMMIAAVFGSVLLGLAALVGLAGHFATARQDDDDE |
| Ga0210402_107996572 | 3300021478 | Soil | MNRRNMMIAAAFGWVLLGLAALVGLAGHFATARQDDDDE |
| Ga0126371_100553707 | 3300021560 | Tropical Forest Soil | MNRRQMMFAAIFGSVLLGLAVLVGLAGYFATERQDDDDDR |
| Ga0126371_100946252 | 3300021560 | Tropical Forest Soil | MNRRKMMFVAVFGSVRLGLAALVGLAGHFATERQDDDNDR |
| Ga0126371_105724873 | 3300021560 | Tropical Forest Soil | MTRRKLMFAAIFGSVLLSLAALVGLAGYFATEREDDDDDR |
| Ga0126371_132657662 | 3300021560 | Tropical Forest Soil | MMFAAIFGSVLLGLAALVGLAGYFATERQDDDDDR |
| Ga0137417_13223955 | 3300024330 | Vadose Zone Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATARQDDDEDQ |
| Ga0207685_102383862 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRRKMMFTAVFGSVLLGLAALVGLAGHFATGRQDDDDDQ |
| Ga0209131_100228313 | 3300026320 | Grasslands Soil | MNRRKMMFAAIFGSVLLGLAALVGLAGHFATERQDDDDDR |
| Ga0257149_10042022 | 3300026355 | Soil | MNRRKMMFAAIFGSVLLGLATLLGLAGHFATERQDDDDDR |
| Ga0257172_10068972 | 3300026482 | Soil | MNRRKLMFAAIFGSVLLGLATLVGLAGHFATERQDDDDDR |
| Ga0257153_10643641 | 3300026490 | Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDD |
| Ga0209799_10101633 | 3300027654 | Tropical Forest Soil | MNRRQMMFAAIFGSVLLGLAALVGLAGYFATERQDDDDDR |
| Ga0209388_10070384 | 3300027655 | Vadose Zone Soil | MMFAAIFGSALLGLAALVGLAGHFATARQDDDDDQ |
| Ga0209060_100039433 | 3300027826 | Surface Soil | MNRRKLMFAAIFDSALLGLAALVGLAGHFASARQDDDDR |
| Ga0209465_100117124 | 3300027874 | Tropical Forest Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGHYAIERQDDDEVR |
| Ga0209465_100220902 | 3300027874 | Tropical Forest Soil | MNRRQMMFAAIFGSVLLGLAALIGLAGHFATERQDDDDDR |
| Ga0209069_100081089 | 3300027915 | Watersheds | MNRRKMMFAAVFGVLLGLAALVGLAGHFATARQDDDDD |
| Ga0209526_103606242 | 3300028047 | Forest Soil | RRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDR |
| Ga0170823_150489372 | 3300031128 | Forest Soil | MSRRNVMIAAVFGSVLLGLVALVGLAGHFATARQDDDDE |
| Ga0170824_1150351673 | 3300031231 | Forest Soil | MSRRNMVIAAVFGSVLLGLAALVGLAGHFATARQDDDDE |
| Ga0170818_1083069062 | 3300031474 | Forest Soil | MSRRKMMIAAVFGSVLIGLAALVGLVDHFATARQDDEDE |
| Ga0318511_103260782 | 3300031845 | Soil | MNRRKMMFAAVFGSILLGLAALVGLAGHFATARQDDDDDQ |
| Ga0306925_118848912 | 3300031890 | Soil | MNRRRMMFAAIFGSALLGLAALVGLAGHFATERQDDDDDQ |
| Ga0306926_129915021 | 3300031954 | Soil | MMFAAIIGSVLLGLAALVGLAGYFATEGKDDDDDR |
| Ga0306926_130181102 | 3300031954 | Soil | MNRRKMMFAAIFGSALLGLAALVGLAGHFATERQDDDGD |
| Ga0306924_102561163 | 3300032076 | Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGHFATERQDDDDDQ |
| Ga0307471_1015745551 | 3300032180 | Hardwood Forest Soil | MNRRKMMFAAVFGSVLLGLAALVGLAGHFATYRQDDDDDQ |
| ⦗Top⦘ |