NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074079

Metagenome / Metatranscriptome Family F074079

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074079
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 43 residues
Representative Sequence MSAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQNISATGAC
Number of Associated Samples 100
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 96.67 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(10.000 % of family members)
Environment Ontology (ENVO) Unclassified
(20.833 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.167 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 30.99%    Coil/Unstructured: 69.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF04794YdjC 49.17
PF02457DAC 0.83
PF02897Peptidase_S9_N 0.83
PF01594AI-2E_transport 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG3394Chitooligosaccharide deacetylase ChbG, YdjC/CelG familyCarbohydrate transport and metabolism [G] 49.17
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.83
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 0.83
COG1770Protease IIAmino acid transport and metabolism [E] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.00 %
UnclassifiedrootN/A10.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100699056Not Available892Open in IMG/M
3300003219|JGI26341J46601_10215603All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300004091|Ga0062387_100332985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae993Open in IMG/M
3300004152|Ga0062386_100404479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1099Open in IMG/M
3300005468|Ga0070707_102122090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300005534|Ga0070735_10365766All Organisms → cellular organisms → Bacteria → Acidobacteria865Open in IMG/M
3300005541|Ga0070733_10557775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae767Open in IMG/M
3300005542|Ga0070732_10337043All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005563|Ga0068855_100454205All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1398Open in IMG/M
3300005591|Ga0070761_10171625All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300005591|Ga0070761_10879141All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005888|Ga0075289_1016971All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1017Open in IMG/M
3300005994|Ga0066789_10378430All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300006028|Ga0070717_11340961All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300006162|Ga0075030_100468541All Organisms → cellular organisms → Bacteria → Acidobacteria1002Open in IMG/M
3300006162|Ga0075030_101480275All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300006163|Ga0070715_10511425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius689Open in IMG/M
3300006797|Ga0066659_10281404All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1260Open in IMG/M
3300006800|Ga0066660_11373365All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300006800|Ga0066660_11663331All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300006893|Ga0073928_10067152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3133Open in IMG/M
3300006893|Ga0073928_11197323All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300009522|Ga0116218_1070505Not Available1591Open in IMG/M
3300009525|Ga0116220_10270521All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300010379|Ga0136449_100896809Not Available1446Open in IMG/M
3300011269|Ga0137392_11565440All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300011270|Ga0137391_11321227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300012211|Ga0137377_11276507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300012683|Ga0137398_10519213All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300012929|Ga0137404_11020796All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300012971|Ga0126369_10874989All Organisms → cellular organisms → Bacteria → Acidobacteria983Open in IMG/M
3300014638|Ga0181536_10349789All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300014658|Ga0181519_10515110All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300017946|Ga0187879_10698192All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300017946|Ga0187879_10880866All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300017955|Ga0187817_10754253All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300017959|Ga0187779_10717052All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300017975|Ga0187782_10918994All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300018006|Ga0187804_10080573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1316Open in IMG/M
3300018009|Ga0187884_10363987All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300018035|Ga0187875_10477414All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300018044|Ga0187890_10828823All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300018046|Ga0187851_10456848All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300018057|Ga0187858_10070837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2436Open in IMG/M
3300018062|Ga0187784_10745649All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300018085|Ga0187772_10199340Not Available1344Open in IMG/M
3300018085|Ga0187772_11281528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300018085|Ga0187772_11392121All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300018086|Ga0187769_10365941All Organisms → cellular organisms → Bacteria → Acidobacteria1082Open in IMG/M
3300018086|Ga0187769_11546220All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300018090|Ga0187770_10720628All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300020582|Ga0210395_10818148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300021088|Ga0210404_10030658All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2403Open in IMG/M
3300021088|Ga0210404_10384328All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300021180|Ga0210396_10939319All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300021181|Ga0210388_11489407All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300021406|Ga0210386_10450210All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1112Open in IMG/M
3300021406|Ga0210386_11401598All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300021445|Ga0182009_10275843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300021474|Ga0210390_11508155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5532Open in IMG/M
3300021477|Ga0210398_10616648All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300025906|Ga0207699_10657054All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300025906|Ga0207699_11312026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300025916|Ga0207663_10848322All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300025928|Ga0207700_11743691All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300025939|Ga0207665_11191630All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300026023|Ga0207677_10763299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium863Open in IMG/M
3300026215|Ga0209849_1062245All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300026316|Ga0209155_1110963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium971Open in IMG/M
3300026481|Ga0257155_1065704All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300026515|Ga0257158_1090426All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300027567|Ga0209115_1043148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1026Open in IMG/M
3300027590|Ga0209116_1128102All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300027635|Ga0209625_1127257All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300027660|Ga0209736_1124610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300027678|Ga0209011_1137252All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300027701|Ga0209447_10121333All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300027824|Ga0209040_10104381Not Available1598Open in IMG/M
3300027824|Ga0209040_10221357Not Available967Open in IMG/M
3300027842|Ga0209580_10427963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium660Open in IMG/M
3300027855|Ga0209693_10538594All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300027869|Ga0209579_10082676All Organisms → cellular organisms → Bacteria1700Open in IMG/M
3300027869|Ga0209579_10436684All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300027889|Ga0209380_10383307All Organisms → cellular organisms → Bacteria → Acidobacteria825Open in IMG/M
3300027905|Ga0209415_10304874Not Available1369Open in IMG/M
3300027908|Ga0209006_10443056Not Available1089Open in IMG/M
3300027911|Ga0209698_10084529All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2685Open in IMG/M
3300027911|Ga0209698_10320015All Organisms → cellular organisms → Bacteria → Acidobacteria1225Open in IMG/M
3300027986|Ga0209168_10430965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300028731|Ga0302301_1076762All Organisms → cellular organisms → Bacteria → Acidobacteria877Open in IMG/M
3300028747|Ga0302219_10084732All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300028747|Ga0302219_10098236Not Available1105Open in IMG/M
3300028788|Ga0302189_10325701All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300028871|Ga0302230_10396100All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300028906|Ga0308309_10244735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1498Open in IMG/M
3300028906|Ga0308309_10564678All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300028906|Ga0308309_10661482All Organisms → cellular organisms → Bacteria → Acidobacteria907Open in IMG/M
3300029951|Ga0311371_10927118Not Available1048Open in IMG/M
3300029951|Ga0311371_12207901All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300030007|Ga0311338_10440571Not Available1385Open in IMG/M
3300030049|Ga0302191_10359925All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300030506|Ga0302194_10186996All Organisms → cellular organisms → Bacteria → Acidobacteria858Open in IMG/M
3300030507|Ga0302192_10220710All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300030580|Ga0311355_11032065All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300030940|Ga0265740_1008095Not Available910Open in IMG/M
3300031128|Ga0170823_13571039All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300031233|Ga0302307_10511160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300031715|Ga0307476_10205876All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1429Open in IMG/M
3300031715|Ga0307476_10268099All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1249Open in IMG/M
3300031718|Ga0307474_10201216All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1516Open in IMG/M
3300031718|Ga0307474_11521634All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300031947|Ga0310909_11383792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300031962|Ga0307479_11754745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300032160|Ga0311301_12388398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300032180|Ga0307471_102590582All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300032805|Ga0335078_12433863All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300032892|Ga0335081_11436451All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300033134|Ga0335073_11679992All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300033412|Ga0310810_10832460All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300033818|Ga0334804_155790All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland7.50%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.67%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.83%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.17%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.17%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.33%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.50%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.67%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.83%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.83%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028731Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10069905623300002245Forest SoilMSAGPATAPRATLDLKVKVWGMGSNDRPFFQNAVAQNISATGACIF
JGI26341J46601_1021560313300003219Bog Forest SoilMSASGAAPRATLDLRVRVWGMGADNQPFHQNANAQNVSVTGACIYG
Ga0062387_10033298513300004091Bog Forest SoilMSAGPAAAPRTTLDLKVRVWGMGSNDRPFFQNAVAQNISATGACIYGIEQQ
Ga0062386_10040447913300004152Bog Forest SoilMSAQGSAPRATLDLKVRVWGMGSNNQPFFQNAVAQNISAT
Ga0070707_10212209023300005468Corn, Switchgrass And Miscanthus RhizosphereMSAQGSAPRTTLDLKVRVWGMGSNNQPFFQNAIAQNISATGACIFGIEP
Ga0070735_1036576613300005534Surface SoilMATSGAAPRMVSDLRVRVWGMGANDQPFHQQAIANNATVTGAAITGLEQSL
Ga0070733_1055777523300005541Surface SoilMSAQGSAPRATLELKVKVWGMGASGQPFFQNAMAQNISATGACLYGIE
Ga0070732_1033704313300005542Surface SoilMAAQGAAPRATLDLKVRVWGMGANNQPFFQNAMAQNISATGAC
Ga0068855_10045420533300005563Corn RhizosphereMSAQGSAPRATMELKVKVWGMGANGQPFFQSAMAQNVSATGACLYGV
Ga0070761_1017162513300005591SoilMSASGAAPRATLDLRVRVWGMGGNDQPFHQNATAQNVSATGAC
Ga0070761_1087914113300005591SoilMSASGAAPRAILDLRVRVWGMGADNQPFHQNANAQNISVNGAC
Ga0075289_101697123300005888Rice Paddy SoilMAAQGSAPRATLELKVKVWGMGANGPFFQNAMAQNVSATGACLYGVEPELK
Ga0066789_1037843023300005994SoilMSAQGSAPRATLDLKVRVWGMGSNNQPFFQNAVAQN
Ga0070717_1134096113300006028Corn, Switchgrass And Miscanthus RhizosphereMSAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQNIS
Ga0075030_10046854123300006162WatershedsMSAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQNISSTGACIY
Ga0075030_10148027513300006162WatershedsMPAQGSAPRATLDLKVRVWGMGANNQPFFQNAMAQNVSAT
Ga0070715_1051142513300006163Corn, Switchgrass And Miscanthus RhizosphereMSAQGSAPRATLDLKVKVWGMGSNNQPFFQNAIAQNISATGACVYGIE
Ga0066659_1028140413300006797SoilMSAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQNISATGACIYGIE
Ga0066660_1137336513300006800SoilMSASGAAPRATLDLRIRVWGMGADNQAFHQNAVAQNVSATGAC
Ga0066660_1166333113300006800SoilMSAQGAAPRAVLDLRVRVWGMGANDQPFFQSAVAQ
Ga0073928_1006715243300006893Iron-Sulfur Acid SpringMPAQGTAPRATLDLKVRVWGMGANNQPFFQNAMAQNVSAT
Ga0073928_1119732313300006893Iron-Sulfur Acid SpringMSASTAAPRATLDLRIRVWGMGANNHPFNQNAIAQNASVTGACIS
Ga0116218_107050513300009522Peatlands SoilMSAQGSAPRATLDLKVRVWGMGANNQPFFQHAMAQNVSATGAC
Ga0116220_1027052123300009525Peatlands SoilMSVQEPAPRATLDLKVRVWGMGANNQPFFQSGVAQNVSATGAA
Ga0136449_10089680933300010379Peatlands SoilMSATGAAPRATLDLRVRVWGMGANGQPFHQNATAQNVSITGACI
Ga0137392_1156544023300011269Vadose Zone SoilMSASGAAARAILDLRLRVWGMGSNNQPFHQNATAQNISR
Ga0137391_1132122723300011270Vadose Zone SoilMSAQGAAPRAALDLRVRVWGMGKNDQPFFQFAVAQNISS
Ga0137377_1127650723300012211Vadose Zone SoilMSAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQNISATG
Ga0137398_1051921323300012683Vadose Zone SoilMSASAPAPHSTLDLTVSVWGMGAEDHPFFQNATAQNISAT
Ga0137404_1102079613300012929Vadose Zone SoilMSAQGSAPRATLDLKVRVWGMGANNQPFFQNAIAQNISATGACIYG
Ga0126369_1087498923300012971Tropical Forest SoilMAAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQN
Ga0181536_1034978923300014638BogMSAQGSAPRATLDLKVRVWGMGANNQPFFQNAVAQNVSA
Ga0181519_1051511013300014658BogMSAQGSAPRATLDLKVRVWGMGSNNQPFFQNAVAQNVSAT
Ga0187879_1069819213300017946PeatlandMSASGAAPRATLDLRIRVWGMGANNQPFHQNAIAHNVS
Ga0187879_1088086613300017946PeatlandMSAQGSAPRATLDLKVRVWGMGANDQPFFQNANAQNISATGACLYGIEPELK
Ga0187817_1075425313300017955Freshwater SedimentMSAQGSASRATLDLKVRVWGMGSNNQPFFQNAVAQNISATGA
Ga0187779_1071705223300017959Tropical PeatlandMSAQGSAPRATLDLKVKVWGMGSNGQPFFQPATAQN
Ga0187782_1091899413300017975Tropical PeatlandMSAQGAAPRATLDLKVRVWGMGSNNQPFFQNANAQNIS
Ga0187804_1008057333300018006Freshwater SedimentMSAQGSAPRATLDLKVRVWGMGSNNQPFFQNAFAQNVSA
Ga0187884_1036398723300018009PeatlandMSATGAAPRATLDLRVRVWGMGANGQPFHQNATAQNVSVTGACISGIEQE
Ga0187875_1047741423300018035PeatlandMSAPAGAPRATLDQRIRVWGMGANDQPFHQNAVAQNVSLSG
Ga0187890_1082882323300018044PeatlandMSAFGAAPRTTLDLRIRVWGMGANDHPFNQNAVAQNVSVTGACISGLD
Ga0187851_1045684813300018046PeatlandMSAQGSAPRATLDLKVRVWGMGSNNQPFFQNAMAQNVSA
Ga0187858_1007083743300018057PeatlandMSASGAAPRATLDLRIRVWGMGADNQPFHQNATAHNVSVTGACIYGL
Ga0187784_1074564913300018062Tropical PeatlandMSAQGSAPRATLDLRVRVWGMGANGQPFFQNAMAQNISSTGACIY
Ga0187772_1019934033300018085Tropical PeatlandMSPQASAPRVTLDLKVRVWGMGANNQPFFQNATAQNVSVTGACIYGIE
Ga0187772_1128152813300018085Tropical PeatlandVPAQGSAPRVTLDLKVRVWGMGAGDQPFFQNATAQNISATGACI
Ga0187772_1139212123300018085Tropical PeatlandMSASGAAPRATLDLRIRVWGMGANDQPFHQSATAQNASITGACISGL
Ga0187769_1036594123300018086Tropical PeatlandMPAPGPAPRATLDLKVRVWGMGANNQAFFQHATAQNVSATGACI
Ga0187769_1154622013300018086Tropical PeatlandMSATGAAPRATLDLRIRVWGMGANDQPFHQSATAQN
Ga0187770_1072062823300018090Tropical PeatlandMSPQTPAPRATLDLKVKVWGMGANNQPFFQQAVAQN
Ga0210395_1081814823300020582SoilMPAQGTAPRATLDLKVRVWGMGANDQPFFQNAMAQNVSATGACIYG
Ga0210404_1003065813300021088SoilMSAQGSAPRTTLDLKVKVWGMGSNNQAFFQSAVAQNVSATGACIYGIEQEL
Ga0210404_1038432823300021088SoilMSATGAAPRATLDLRLRVWGMGANGQPFHQNATAQNV
Ga0210396_1093931913300021180SoilMSAQGSAPRATLDIKVRVWGMGSNNQPFFQNAMAQNISATGA
Ga0210388_1148940713300021181SoilMSATGAAPRATMDLRVRVWGMGANGQPFHQNATAQNVSVTGACISGIEQELKV
Ga0210386_1045021013300021406SoilMSAQGAAPRATLDLKVRVWGMGSNNQPFFQNAMAQNVSATG
Ga0210386_1140159813300021406SoilMSAAAAPRATLDLRLRVWGMGADNQPFHQNANAQNVSRTGACI
Ga0182009_1027584323300021445SoilMSAQGSAPRATMELKVKVWGMGANGSPFFQSAMAQNVSATGACLYGVEPE
Ga0210390_1150815523300021474SoilMSAQGSAPRATLDLKVRVWGMGANNQPFFQNAMAQNVSATGACLYA
Ga0210398_1061664813300021477SoilMSAQGAAPRATLDLKVRVWGMGSNNQPFFQNAMAQNVSATGACIYGIEP
Ga0207699_1065705423300025906Corn, Switchgrass And Miscanthus RhizosphereMSAQGSAPRAALDLKVKVWGMGANNQPFFQNAMAQNISATGACIYGIE
Ga0207699_1131202623300025906Corn, Switchgrass And Miscanthus RhizosphereMSAQGSAPRTTLDLKVKVWGMGANGQPFFQNAMAQNISATGACL
Ga0207663_1084832213300025916Corn, Switchgrass And Miscanthus RhizosphereMAAQGSAPRATLDLKVRVWGMGANNQPFFQNAMAQNVSATG
Ga0207700_1174369113300025928Corn, Switchgrass And Miscanthus RhizosphereMAAQGAAPRATLDLKVRVWGMGVNNQPFFQSAMAQNIS
Ga0207665_1119163023300025939Corn, Switchgrass And Miscanthus RhizosphereMSAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQNI
Ga0207677_1076329913300026023Miscanthus RhizosphereMAAQGSAPRATLELKVKVWGMGANGQPFFQNAMPQNVSATGACLYGI
Ga0209849_106224523300026215SoilMSGQGSAPRSTLDLRVRVWGMSAHGQPFFQNCSAQNVSSSGACL
Ga0209155_111096323300026316SoilMSAQGSAPRATMELKVKVWGMGANGSPFFQSAMAQNVSATGACLYGVEP
Ga0257155_106570423300026481SoilMSAQGSAPRATLDLKVRVWGMGANDQPFFQNATAQNISATGACVYG
Ga0257158_109042613300026515SoilMSASGAAPRATLDLRVRVWGMGADNQPFHQNANAQNV
Ga0209115_104314813300027567Forest SoilMSAQGAAPRATLDLKVRVWGMGSNNQPFFQNAMAQNVSAT
Ga0209116_112810223300027590Forest SoilMSAQGSAPRATLDLKVRVWGMGSNNQPFFQNAMAQNVSIT
Ga0209625_112725713300027635Forest SoilMSASGAAPRATLDLRVRVWGMGSNNQPFHQNAVAQNVSATGACISGL
Ga0209736_112461013300027660Forest SoilMPAQGIAPRATLDLKVRVWGMGANNQPFFQNAMAQNVSATGACIYGIEPEL
Ga0209011_113725213300027678Forest SoilMSASAPAPRSTLDLTVRVWGMGADDHPFFQNATAQNVSATGA
Ga0209447_1012133313300027701Bog Forest SoilMSVAGAAPRASLDLRVRVWGMGANDQPFHQNAVAQNVSC
Ga0209040_1010438133300027824Bog Forest SoilMSATGAAPRATLDLRVRVWGMGANNLPFHQNATAQNVSTTGACIGGLEHQ
Ga0209040_1022135723300027824Bog Forest SoilMSASGAAPRATLDLRVRVWGMGADNQPFHQNANAQNVSVTGACIYGL
Ga0209580_1042796323300027842Surface SoilMPAQGSAPRATLDLKVRVWGMGANNQPFFQNAMAQNV
Ga0209693_1053859413300027855SoilMSASGAAPRATLDLRVRVWGMGGNDQPFHQNATAQNVSATGACINGLE
Ga0209579_1008267643300027869Surface SoilMSAQGSAPRATLELKVKVWGMGANGQPFFQNAVAQNVSATGACIYGIEPEL
Ga0209579_1043668413300027869Surface SoilMATSGAAPRMVSDLRVRVWGMGANDQPFHQQAIANNATVTG
Ga0209380_1038330713300027889SoilMSAQGSAPRATLDLKVRVWGMGANNQPFFQNANAQNISAT
Ga0209415_1030487433300027905Peatlands SoilMSAQGSAPRATLDLKVRVWGMGANNQPFFQNAMAQ
Ga0209006_1044305613300027908Forest SoilMSASGAAPRATLDLRVRVWGMGADNQPFHQNANAQNI
Ga0209698_1008452913300027911WatershedsMSAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQ
Ga0209698_1032001513300027911WatershedsMSAQGSAPRATLDLKVRVWGMGSNNQPFFQNAVAQNISATGACLYGIEPELK
Ga0209168_1043096513300027986Surface SoilMPAQGSAPRATLELKVKVWGMGANNQPFFQSATAQNISITGACIYGIEPD
Ga0302301_107676223300028731PalsaMSATGAAPRATLDLRVRVWGMGANNQPFHQNATAQNVSSSGACICGL
Ga0302219_1008473213300028747PalsaMSAFGAAPRTTLDLRIRVWGMGANDHPFNQNAVAQNVSVT
Ga0302219_1009823623300028747PalsaMSGSGAAPRATLDLRIRVWGMGANDLPFHQNVTAKNASLTGACITGL
Ga0302189_1032570123300028788BogMSAFGAAPRTTLDLRIRVWGMGANDHPFNQNAVAQNVSVTGACISG
Ga0302230_1039610013300028871PalsaMSAFGAAPRTTLDLRIRVWGMGANDHPFNQHAVAQNVSVTGACISGLE
Ga0308309_1024473513300028906SoilMSAQGSAPRATLDLRVRVWGMGSNNQPFFQNAMAQNVSATG
Ga0308309_1056467813300028906SoilMSAQGSAPRATLDLKVRVWGMGANDQPFFQNATAQNISATGACV
Ga0308309_1066148213300028906SoilMSAQGSAPRATLDIKVRVWGMGSNNQPFFQNAMAQNISATGACLF
Ga0311371_1092711813300029951PalsaMSGPGAAPRTKLDLRIRVWGMGANDQPFHQNAVAQNVSSTGACIGGL
Ga0311371_1220790123300029951PalsaMSVVGAAPRATLDLRIRVWGMGANNQPFHQNATAQNVSITGACISGLE
Ga0311338_1044057113300030007PalsaMSAPGAAPRATLDLRLRVWGMGANNQPFHQNAVAQNVSVTGAC
Ga0302191_1035992513300030049BogMSAFGAAPRTTLDLRIRVWGMGANDHPFNQNAVAQNVSVTGA
Ga0302194_1018699613300030506BogMTTASGAAPRATLDLRIRVWGMGANNQPFHQNAIA
Ga0302192_1022071023300030507BogMSASGAAPRATLDLRIRVWGMGSNNLPFHQNATAQNASLTGACLS
Ga0311355_1103206523300030580PalsaMSGSGAAPRATLDLRIRVWGMGANDQPFHQNVTAKN
Ga0265740_100809523300030940SoilMSAGSAIAPRATLDLKVRVWGMGSNDRPFFQNAMAQNISATGACIYGIE
Ga0170823_1357103923300031128Forest SoilMSASGAAPRATLDLRVRVWEMGSNDQPFHQNAVAQNVSATGAK
Ga0302307_1051116023300031233PalsaMSATGSAPRASLDLKVRVWGMGSNDQPFFQSAIAQNISSTGA
Ga0307476_1020587613300031715Hardwood Forest SoilMSAAGAAPRSNLELRLRVWGMGANNQPFNQTATAQ
Ga0307476_1026809923300031715Hardwood Forest SoilMSAQGSAPRTTLDLKVRVWGMGANNQPFFQNAIAQNVSSTG
Ga0307474_1020121613300031718Hardwood Forest SoilMSAQGAAPRATLDLKVRVWGMGSNNQPFFQNAMAQN
Ga0307474_1152163423300031718Hardwood Forest SoilMSAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQNISATGAC
Ga0310909_1138379223300031947SoilMAAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQ
Ga0307479_1175474523300031962Hardwood Forest SoilMFVSAPAPRSTLDLTVRVWGMGADDRPFFQNATAQNVSATGACIYGIEH
Ga0311301_1238839823300032160Peatlands SoilMSAQGSAPRATLDLKVRVWGMGSNNQPFHQHAVAQNIS
Ga0307471_10259058213300032180Hardwood Forest SoilMSAQGSAPRATLDLKVKVWGMGANNQPFFQNAMAQNISE
Ga0335078_1243386323300032805SoilMSAQGSAPRATLELKVKVWGMGANNQPFFQNAMAQNISATGA
Ga0335081_1143645123300032892SoilMSAQGSAPRATLDLKVKVWGMGASGQPFFQNAMAQNISATGACIY
Ga0335073_1167999223300033134SoilMSAQGSAPRATLDLKVKVWGMGANGQPFFQSAMAQNISATGACIYGIEPELK
Ga0310810_1083246013300033412SoilMSAQGSAPRATMELKVKVWGMGANGSPFFQSAMAQN
Ga0334804_155790_421_5643300033818SoilMSASGAAPRATLDLRIRVWGMGSNNLPFHQNATAQNASLTGACLSGLE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.