NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074073

Metagenome / Metatranscriptome Family F074073

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074073
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 64 residues
Representative Sequence AKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG
Number of Associated Samples 100
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.42 %
% of genes near scaffold ends (potentially truncated) 91.67 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.72

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.833 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(25.833 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.500 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.44%    β-sheet: 12.22%    Coil/Unstructured: 53.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.72
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
c.74.1.0: automated matchesd2irpa_2irp0.58354
c.74.1.1: AraD-like aldolase/epimerased1e48p_1e480.5819
c.62.1.1: Integrin A (or I) domaind1ijba_1ijb0.56794
c.74.1.1: AraD-like aldolase/epimerased1pvta_1pvt0.56699
d.17.4.0: automated matchesd6hnma_6hnm0.5667


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF04248NTP_transf_9 40.83
PF00196GerE 3.33
PF13560HTH_31 1.67
PF13193AMP-binding_C 1.67
PF08281Sigma70_r4_2 1.67
PF00248Aldo_ket_red 0.83
PF00072Response_reg 0.83
PF13374TPR_10 0.83
PF12697Abhydrolase_6 0.83
PF02720DUF222 0.83
PF02657SufE 0.83
PF02909TetR_C_1 0.83
PF01717Meth_synt_2 0.83
PF00723Glyco_hydro_15 0.83
PF05721PhyH 0.83
PF00144Beta-lactamase 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG2343Uncharacterized conserved protein, DUF427 familyFunction unknown [S] 40.83
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.83
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.83
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.83
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.83
COG2166Sulfur transfer protein SufE, Fe-S cluster assemblyPosttranslational modification, protein turnover, chaperones [O] 0.83
COG2367Beta-lactamase class ADefense mechanisms [V] 0.83
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 0.83
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.83 %
UnclassifiedrootN/A4.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig28385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
2189573004|GZGWRS402JTY5OAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis517Open in IMG/M
3300003505|JGIcombinedJ51221_10213968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica782Open in IMG/M
3300005337|Ga0070682_101898746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora522Open in IMG/M
3300005338|Ga0068868_100780548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis860Open in IMG/M
3300005341|Ga0070691_10321100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis852Open in IMG/M
3300005435|Ga0070714_102011533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica563Open in IMG/M
3300005435|Ga0070714_102173474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica540Open in IMG/M
3300005435|Ga0070714_102322601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis521Open in IMG/M
3300005436|Ga0070713_100588168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1056Open in IMG/M
3300005436|Ga0070713_100981318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica814Open in IMG/M
3300005436|Ga0070713_102317769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis520Open in IMG/M
3300005437|Ga0070710_10192438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica1283Open in IMG/M
3300005439|Ga0070711_100605386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium914Open in IMG/M
3300005439|Ga0070711_100809691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300005439|Ga0070711_101010865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis713Open in IMG/M
3300005454|Ga0066687_10721316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300005458|Ga0070681_10321656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1456Open in IMG/M
3300005468|Ga0070707_101056644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis778Open in IMG/M
3300005536|Ga0070697_100566502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales997Open in IMG/M
3300005552|Ga0066701_10775447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora572Open in IMG/M
3300005563|Ga0068855_102397664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora527Open in IMG/M
3300005577|Ga0068857_101845600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora592Open in IMG/M
3300005615|Ga0070702_101226981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis606Open in IMG/M
3300005719|Ga0068861_101393433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis684Open in IMG/M
3300005843|Ga0068860_102626450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300006028|Ga0070717_10175123All Organisms → cellular organisms → Bacteria1867Open in IMG/M
3300006163|Ga0070715_10627119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis633Open in IMG/M
3300006173|Ga0070716_101225622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica604Open in IMG/M
3300006175|Ga0070712_100396217All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300006175|Ga0070712_101454771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium598Open in IMG/M
3300006175|Ga0070712_101580522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica573Open in IMG/M
3300006176|Ga0070765_100661022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica987Open in IMG/M
3300006755|Ga0079222_11331842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis657Open in IMG/M
3300006755|Ga0079222_12192893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora549Open in IMG/M
3300006755|Ga0079222_12362177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora532Open in IMG/M
3300006804|Ga0079221_10374408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis871Open in IMG/M
3300006804|Ga0079221_10543493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica767Open in IMG/M
3300006804|Ga0079221_11578338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis530Open in IMG/M
3300006804|Ga0079221_11621331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300006854|Ga0075425_100512712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1381Open in IMG/M
3300006954|Ga0079219_10181124All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300009098|Ga0105245_11039530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria864Open in IMG/M
3300009143|Ga0099792_10354069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica887Open in IMG/M
3300009553|Ga0105249_10556782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1198Open in IMG/M
3300009683|Ga0116224_10317721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica741Open in IMG/M
3300010359|Ga0126376_11645144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis675Open in IMG/M
3300010373|Ga0134128_12430371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300010376|Ga0126381_101949907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia847Open in IMG/M
3300010376|Ga0126381_104442891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora542Open in IMG/M
3300010396|Ga0134126_12987937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica511Open in IMG/M
3300010401|Ga0134121_11088619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis791Open in IMG/M
3300010876|Ga0126361_11075133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2145Open in IMG/M
3300012515|Ga0157338_1057288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis576Open in IMG/M
3300012924|Ga0137413_10321781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica1088Open in IMG/M
3300012986|Ga0164304_10066043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2035Open in IMG/M
3300012989|Ga0164305_10054878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2354Open in IMG/M
3300013105|Ga0157369_11289354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis745Open in IMG/M
3300013306|Ga0163162_11261931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis839Open in IMG/M
3300015374|Ga0132255_105487909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis537Open in IMG/M
3300017926|Ga0187807_1054008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1246Open in IMG/M
3300017973|Ga0187780_10184499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica1452Open in IMG/M
3300018037|Ga0187883_10464630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300021171|Ga0210405_10277100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1326Open in IMG/M
3300021403|Ga0210397_10218635All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300021404|Ga0210389_11331874All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300021475|Ga0210392_11066081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300021478|Ga0210402_11863827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei527Open in IMG/M
3300021479|Ga0210410_11601773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis544Open in IMG/M
3300021858|Ga0213852_1225397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300021861|Ga0213853_11300179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300024254|Ga0247661_1084718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M
3300024283|Ga0247670_1006690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2169Open in IMG/M
3300025898|Ga0207692_10199593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1175Open in IMG/M
3300025905|Ga0207685_10461533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica662Open in IMG/M
3300025911|Ga0207654_10019266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3599Open in IMG/M
3300025911|Ga0207654_11057576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica591Open in IMG/M
3300025916|Ga0207663_10680170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis814Open in IMG/M
3300025916|Ga0207663_10925076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis698Open in IMG/M
3300025916|Ga0207663_11063163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis650Open in IMG/M
3300025920|Ga0207649_11046072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300025928|Ga0207700_10033719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3666Open in IMG/M
3300025939|Ga0207665_10637465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium834Open in IMG/M
3300026078|Ga0207702_10147836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2134Open in IMG/M
3300026078|Ga0207702_10669449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis1021Open in IMG/M
3300026078|Ga0207702_12514711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis501Open in IMG/M
3300026864|Ga0209621_1008309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis697Open in IMG/M
3300027174|Ga0207948_1045557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300027846|Ga0209180_10064082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2049Open in IMG/M
3300027903|Ga0209488_10175547All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300029701|Ga0222748_1087229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica590Open in IMG/M
3300029999|Ga0311339_10831436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium885Open in IMG/M
3300030399|Ga0311353_11191787Not Available629Open in IMG/M
3300030580|Ga0311355_10323406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1540Open in IMG/M
3300030677|Ga0302317_10368067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia637Open in IMG/M
3300031231|Ga0170824_113506724Not Available633Open in IMG/M
3300031469|Ga0170819_16314528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora551Open in IMG/M
3300031572|Ga0318515_10710895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica531Open in IMG/M
3300031640|Ga0318555_10701090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300031751|Ga0318494_10298407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium929Open in IMG/M
3300031771|Ga0318546_10336013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1050Open in IMG/M
3300031780|Ga0318508_1223215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica541Open in IMG/M
3300031823|Ga0307478_11818196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis501Open in IMG/M
3300031860|Ga0318495_10293932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300031896|Ga0318551_10667210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300031912|Ga0306921_11270103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria816Open in IMG/M
3300031954|Ga0306926_10262239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2141Open in IMG/M
3300032052|Ga0318506_10073148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1427Open in IMG/M
3300032060|Ga0318505_10447852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300032068|Ga0318553_10210350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300032770|Ga0335085_10398410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1598Open in IMG/M
3300032892|Ga0335081_10806121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1121Open in IMG/M
3300032898|Ga0335072_11244173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium657Open in IMG/M
3300032954|Ga0335083_10326967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1336Open in IMG/M
3300032954|Ga0335083_10937196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica685Open in IMG/M
3300032955|Ga0335076_10184545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1992Open in IMG/M
3300033134|Ga0335073_11580413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora627Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere20.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.50%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil6.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.67%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.17%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.33%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.50%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.50%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.67%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.67%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.83%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.83%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.83%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026864Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027174Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_001136702166559006Grass SoilMLREQIAIAERYPDLRACLTDNVIFLAGGSRVLPMSTLRRGLTLEQADAVVAQLRNG
FG2_058564702189573004Grass SoilVPTVAAKQEAMLREQIAIAERHPDLRACLTDNVIFLAGGSRVLPMSTLRRGLTLEQADAAVAQLRNG
JGIcombinedJ51221_1021396813300003505Forest SoilAARQQAMAGRQEAMLRDQIAIAERYPELRACLTDQVIFLAGGSRVLPMSSVTGGITLEQADALVAQLRNG*
Ga0070682_10189874613300005337Corn RhizosphereAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0068868_10078054823300005338Miscanthus RhizosphereSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070691_1032110023300005341Corn, Switchgrass And Miscanthus RhizosphereVVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADAVVAQLRNG*
Ga0070714_10201153313300005435Agricultural SoilEAMARQEGMLREQIAIAERYPDLRACLSDKLVFLAGGRRTVPMPRDLSGLTMAHADAIVAQLRNG*
Ga0070714_10217347423300005435Agricultural SoilMLREQIAIAERYPDLRACLSDKLVFLAGGRRTVPMPRDLSGLTMAHADAIVAQLRNG*
Ga0070714_10232260113300005435Agricultural SoilPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070713_10058816833300005436Corn, Switchgrass And Miscanthus RhizosphereVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070713_10098131823300005436Corn, Switchgrass And Miscanthus RhizosphereAERYPDLRACLSDKLVFLAGGRRTVPMPRDLSGLTMAHADAIVAQLRNG*
Ga0070713_10231776913300005436Corn, Switchgrass And Miscanthus RhizosphereAAKQDAMLREQIAIAERYPDLRACLTDDVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070710_1019243823300005437Corn, Switchgrass And Miscanthus RhizosphereDAMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070711_10060538623300005439Corn, Switchgrass And Miscanthus RhizosphereAKQDAMLREQIAIAERYPELRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070711_10080969113300005439Corn, Switchgrass And Miscanthus RhizosphereQEGMLREQIEIAERYPDLRACMNDNVAFLAGGSRAVPMANLTGGFTMEQADALVAQLRNG
Ga0070711_10101086523300005439Corn, Switchgrass And Miscanthus RhizosphereAMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0066687_1072131623300005454SoilMPVAAKQEAAMREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070681_1032165633300005458Corn RhizosphereVVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADTVVAQLRNG*
Ga0070707_10105664413300005468Corn, Switchgrass And Miscanthus RhizosphereVPAVSAKQDAMLREQIAIAERYPELRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070697_10056650213300005536Corn, Switchgrass And Miscanthus RhizosphereAMLREQIAIAERYPDLRACLTDDVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0066701_1077544713300005552SoilAMAAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0068855_10239766413300005563Corn RhizosphereAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0068857_10184560023300005577Corn RhizosphereGPAMAARQEAMARQEGVLREQIAIAERYPDLRACLSDKLVFLAGGRRTVPMPRDLSGLTMAHADAIVAQLRNG*
Ga0070702_10122698113300005615Corn, Switchgrass And Miscanthus RhizosphereYEERVVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADTVVAQLRNG*
Ga0068861_10139343313300005719Switchgrass RhizosphereSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADAVVAQLRNG*
Ga0068860_10262645023300005843Switchgrass RhizosphereAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070717_1017512313300006028Corn, Switchgrass And Miscanthus RhizosphereKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGTRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070715_1062711923300006163Corn, Switchgrass And Miscanthus RhizosphereDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADAVVAQLRNG*
Ga0070716_10122562213300006173Corn, Switchgrass And Miscanthus RhizosphereQEGMLREQIAIAERYPDLRACLSDKLVFLAGGRRTVPMPRDLSGLTMAHADAIVAQLRNG
Ga0070712_10039621713300006175Corn, Switchgrass And Miscanthus RhizosphereEQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0070712_10145477113300006175Corn, Switchgrass And Miscanthus RhizosphereRLGQMAAGQEGMLREQIEIAERYPDLRACMNDNVAFLAGGSRAVPMANLTGGFTMEQADALVAQLRNG*
Ga0070712_10158052213300006175Corn, Switchgrass And Miscanthus RhizosphereGMLREQIAIAERYPDLRACLSDQVVFLAGGRRMLPMPRDLSGLTMAQADAIVAQLRAG*
Ga0070765_10066102213300006176SoilQEAMLREQIAIAERHPDLRACLTDQVIFLANGSRVLPMSSLSRGLTLEQADAMVAQLRNG
Ga0079222_1133184223300006755Agricultural SoilAVSAKQDAMLREQIAIAERYPELRACLTDNVVFLAGGNRVVPMSSLTRGFTLEQADAVVAQLRNG*
Ga0079222_1219289313300006755Agricultural SoilQEAMARQEGMLREQIAIAERYPDLRACLSDRLVFLAGGRRTLPMPSDLSGITMAHADAIVAQLRNG*
Ga0079222_1236217713300006755Agricultural SoilMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0079221_1037440823300006804Agricultural SoilREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0079221_1054349323300006804Agricultural SoilGPAMAARQEAMARQEGMLREQIAIAERYPDLRACLSDGLVFLAGGRRTVPIPRDLSGITMAQADAIVAQLRNG*
Ga0079221_1157833813300006804Agricultural SoilMARQEGMLREQIAIAERHPDLRACLSDKLVFLAGGGRTVPMPSDLTGLTMAQADAIVAQLRNG*
Ga0079221_1162133123300006804Agricultural SoilLREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAELRNG*
Ga0075425_10051271213300006854Populus RhizosphereQEAMARQEGMLREQIAIAERYPDLRACLSDKLVFLAGGGRTVPMPSDLTGLTMAQADAIVAQLRNG*
Ga0079219_1018112413300006954Agricultural SoilMAARQEAMARQEGMLREQIAIAERYPDLRACLSDRLVFLAGGRRTLPMPSDLSGITMAHADAIVAQLRNG*
Ga0105245_1103953023300009098Miscanthus RhizosphereAVDAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0099792_1035406923300009143Vadose Zone SoilAAKQETMLREQIAIAERHPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0105249_1055678233300009553Switchgrass RhizosphereAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADAVVAQLRNG*
Ga0116224_1031772113300009683Peatlands SoilAMAAKQEAMLREQIAIAERHPDLRACLTDQVVFLDGGSRVLPMAGLIGRLTLEQSDALVAQLRDG*
Ga0126376_1164514423300010359Tropical Forest SoilEERVVPAVAAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0134128_1243037113300010373Terrestrial SoilKIAIAARYPDLRACLSDQVVFLAGGRQTVPMPRDLMGLTMAQADAIVAQLRNG*
Ga0126381_10194990723300010376Tropical Forest SoilAAKQEAMLREQIAIAERHPDLRACLTDQVVFLESGSRALPMPNLATVTLDQADALVARLRDG*
Ga0126381_10444289113300010376Tropical Forest SoilEAMLREQIAIAERYPDLRACLNDHVVFLAGGHRVVPMSTLAKGFTLEQADAVVARLRQS*
Ga0134126_1298793723300010396Terrestrial SoilYPELRACLVDKLVFLAGGRRTVPMPSDLSWITMAHADAIVAQLRNG*
Ga0134121_1108861923300010401Terrestrial SoilREQIAIAERYPELRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0126361_1107513343300010876Boreal Forest SoilMASRQDAMLREQIAIAERHPDLRACLTDKVVFLAGGNRVLPMPSLGGSFTVEQADALVARLRGS*
Ga0157338_105728823300012515Arabidopsis RhizosphereVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADAVVAQLRNG*
Ga0137413_1032178123300012924Vadose Zone SoilVVPAVAAKQEAMLREQIAIAERYPDLRACLTDDVIFLAGGSRVLPMSSLSRGFTLEQADAVVAQLRNG*
Ga0164304_1006604343300012986SoilAVSAKQDAMLREQIAIAERYPELRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0164305_1005487813300012989SoilLREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0157369_1128935413300013105Corn RhizosphereMLREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0163162_1126193123300013306Switchgrass RhizosphereEQIAIAERYPDLRACLTDNVVFLAGGLRVVPMSSLSRGFTLEQADAVVAQLRNG*
Ga0132255_10548790923300015374Arabidopsis RhizosphereACEERVVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADAVVAQLRNG*
Ga0187807_105400813300017926Freshwater SedimentPTLAARQETMLREQIAIAEQHPDLRACLTDKVIFLAGGSRVMPMPNLAGITLQQAGALVAQLRAG
Ga0187780_1018449933300017973Tropical PeatlandERVAPAMAARQEAMLREQIAIAERHPDLRACLADQVIFLAGGDRVLPMASVTRGITLEQADALVARLRDG
Ga0187883_1046463023300018037PeatlandEQIAIAERYPDLRACLSDQAVFLAGGSRVVSVPMANLTGGFTLAQADAVVAQLRNG
Ga0210405_1027710033300021171SoilVGAKQEAMLREQIAIAERYPDLRACLTDNVIFLAGGSRVLPMSILRRGLTLEQADAAVAQLRNG
Ga0210397_1021863513300021403SoilPAMAVKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0210389_1133187413300021404SoilVVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0210383_1004280363300021407SoilSRKIGRKVQDRLDQAMSTVAAKQQDTLQQQITIAERHPDLRACLNDQVVFLAGGSRVLPMPNLSTVTVDQADALVAQLRNG
Ga0210394_1029045833300021420SoilIAIAERYPDLRACLTDNVIFLAGGSRVLPMSILRRGLTLEQADAAVAQLRNG
Ga0210392_1106608113300021475SoilQDGMLREQIAIAERYPDLRACMNDQVVFLAGGSRTVPVPLSGLADGFTLAQADAIVAQLRSG
Ga0210402_1186382723300021478SoilQALPAMMAKQEAMLREQIAIAERHPDLRACLTDQVIFLAGGSRTMPMKGVMTNLTVEQADAVVAQLRG
Ga0210410_1160177313300021479SoilVPAVGAKQEAMLREQIAIAERYPDLRACLTDNVIFLAGGSRVLPMSILRRGLTLEQADAAVAQLRNG
Ga0213852_122539713300021858WatershedsMAARQQAMAGSQEAMLREQIAIAERYPELRACLTDQVIFLAGGSRVLPMASVTGGLTVEQSDAVVAQLRDG
Ga0213853_1130017913300021861WatershedsTMANKVMPAMANRGQEMLRTQVAIADRHPDLRACITDKVVFLHGGNRFEPMPNLSGPLSIEDADALVARLRNG
Ga0247661_108471813300024254SoilERVVPAVPAKQDAMLREQIAIAERYPELRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0247670_100669043300024283SoilVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADAVVAQLRNG
Ga0207692_1019959313300025898Corn, Switchgrass And Miscanthus RhizosphereREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0207685_1046153313300025905Corn, Switchgrass And Miscanthus RhizosphereKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRN
Ga0207654_1001926613300025911Corn RhizosphereKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADAVVAQLRN
Ga0207654_1105757613300025911Corn RhizosphereMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0207663_1068017023300025916Corn, Switchgrass And Miscanthus RhizosphereIAIAARYPDLRACLSDQVVFLAGGRQTVPMPRDLMGLTMAQADAIVAQLRNG
Ga0207663_1092507623300025916Corn, Switchgrass And Miscanthus RhizosphereAMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0207663_1106316323300025916Corn, Switchgrass And Miscanthus RhizosphereEERVVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0207649_1104607213300025920Corn RhizosphereERVVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADAVVAQLRNG
Ga0207700_1003371943300025928Corn, Switchgrass And Miscanthus RhizosphereAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADAVVAQLRNG
Ga0207665_1063746513300025939Corn, Switchgrass And Miscanthus RhizosphereQDAMLREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0207702_1014783633300026078Corn RhizosphereDERVGPAMAARQEAMARQEGMLREQIAIAERHPDLRACLSDKLVFLAGGRRTVPMPRDLSGLTMAHADAIVAQLRNG
Ga0207702_1066944913300026078Corn RhizosphereAIAERHPDLRACLSDRLVFLAGGGRTVPMPSDLTGLTMAQADAIVAQLRNG
Ga0207702_1251471123300026078Corn RhizosphereEGRVVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADTVVAQLRNG
Ga0209621_100830923300026864Forest SoilAYEERVVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGRRVVPMSSLTRGFTLEQADTVVAQLRNG
Ga0207948_104555723300027174Forest SoilMAARQQAMAGRQEAMLRDQIAIAERYPELRACLTDQVIFLAGGSRVLPMSSVTGGITLEQADALVAQLRNG
Ga0209180_1006408223300027846Vadose Zone SoilMQRTYDQPVRATLAAKQEEMLRTQIAIAERHPDLRACLTDQVIFLAGGSRVLPMAGVIGTLTLEQSDALVARLRDA
Ga0209488_1017554733300027903Vadose Zone SoilAAKQETMLREQIAIAERHPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0222748_108722923300029701SoilQIAIAERHPDLRACLTDQVVFLAGGSRVLPMSGITRGITLEQADAVVAQLRNG
Ga0311339_1083143613300029999PalsaLAARQETMLREQIAIAERHPGLRACLTDQVIFLAGGSRVLPMASVTGGLTVQQSDALVAQLSEG
Ga0311353_1119178723300030399PalsaSERVLPALAVKHEAIMREQIAIAERHPDLRACLTDKVIFLAGGDRVLPMPSLTGGFTVEQSDAVVARLRDG
Ga0311355_1032340623300030580PalsaAVKHEAIMREQIAIAERHPDLRACLTDKVIFLAGGDRVLPMPSLTGGFTVEQSDAVVARLRDG
Ga0302317_1036806713300030677PalsaVKHEAIMREQIAIAERHPDLRACLTDKVIFLAGGHRVLPMPSLTSGFTVEQSDAVVARLRDG
Ga0170824_11350672423300031231Forest SoilEERVVPAVAAKQDAMLREQIAIAERYPELRACLTDKVIFLAGGSRVLPMTGANLMITLQQADVLVEQLREG
Ga0170819_1631452823300031469Forest SoilVVPAMTARQEAMAGRKEALLREQIAIAERHPDLRACLTDQVIFLAGGSRVLPLSSVTGGITIEQADTLVAQLRGG
Ga0318515_1071089513300031572SoilREQIAIAERYPDLRACLTDNVIFLAGGNRVVPMSSLRRGITLEQADAVVAQLRNG
Ga0318555_1070109013300031640SoilPAMMAKQEAMLREQIAIAERHPDLRACLTDQVIFLAGGSRTIPMKGVMTNLTVEQADAVVAQLRD
Ga0318494_1029840713300031751SoilVQDKLAQQVVPALAAKQEAMLREQIAIAERHPDLRACLTDQVVFLDGGSRALPMPNLATVTLDQADALVARLRDG
Ga0318546_1033601323300031771SoilQEAMLREQIAIAERHPDLRACLTDQVVFLEGGSRALPIPNLATVTLDQADALVASLRDG
Ga0318508_122321513300031780SoilQQETVLREQIAIAERYPDLRACLTDQVVFLAGGSRVVPMSSLSRGITLEQADAVVAQLRS
Ga0307478_1181819623300031823Hardwood Forest SoilMAAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGSRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0318495_1029393213300031860SoilVVPAMAARQEAVLREQIAIAERHPDLRACLTDQVVFLAGGSRVMPMPNLANVTLEQADVLVARLRDG
Ga0318551_1066721013300031896SoilLPAMMAKQEAMLREQIAIAERHPDLRACLTDQVIFLAGGSRTMPMKGVMTNLTVEQADAVVAQLRG
Ga0306921_1127010313300031912SoilVSEQVLPALAARQEATLRAQIEIAERHPGLRACLTDQVVFLADGSRALPMPSLTGLTVEQADALVARLRDG
Ga0306926_1026223913300031954SoilAARQEATLRAQIEIAERHPGLRACLTDQVVFLADGSRALPMPSLTGLTVEQADALVARLRDG
Ga0318506_1007314833300032052SoilKQETVLREQIAIAERYPDLRACLTDQVVFLAGGSRVVPMSSLSRGITLEQADAVVAQLRS
Ga0318505_1044785213300032060SoilAMLREQIAIAERHPDLRACLTDQVVFLEGGSRALPIPNLATVTLDQADALVASLRDG
Ga0318553_1021035013300032068SoilYEERVVPAMAAKQETVLREQIAIAERYPDLRACLTDQVVFLAGGSRVVPMSSLSRGITLEQADAVVAQLRSG
Ga0335085_1039841033300032770SoilVVPAVAAKQEAMLREQIAIAERYPDLRACLTDNVIFLAGGRRVVPMSSLSRGLTLEQADAVVAQLRNG
Ga0335081_1080612113300032892SoilGMSAAAAKQQDVLRQQIAIAERHPELRACLTDSVVFLAGGSRIQPMPNLSTITVEQSDALVTALRGG
Ga0335072_1124417313300032898SoilEKVVPTIMAKRQEMLQQQIAIAERHPDLRACLTDHVVFLAGGSRVQPMPNLAGPFTVEQSDALVASLRDG
Ga0335083_1032696733300032954SoilIAIAERYPDLRACLTDNVIFLAGGSRVVPMSSLSRGITLEQADAIVAQLRNG
Ga0335083_1093719613300032954SoilVPAVSAKQDAMLREQIAIAERYPELRACLTDNVVFLAGGNRVVPMSSLSRGFTLEQADAVVAQLRNG
Ga0335076_1018454533300032955SoilAKRQEVLQQQIAIAERHPDLRACLTDNVVFLAGGSRVQPMPNLAGPLTVEQSDALVASLRDG
Ga0335073_1158041313300033134SoilERVVPAVSAKQDAMLREQIAIAERYPDLRACLTDNVVFLAGGNRVVPMSSLRGFTLEQADAVVAQLRNG
Ga0335077_1007793113300033158SoilDQVLPTLAARRDTMLRQQIAIAERHPDLRACLTDKVIFLAGGSRVLPMPNLGGNLTVEQADALVAQLRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.