| Basic Information | |
|---|---|
| Family ID | F074066 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VKDSPLGPIKFDANHQAWINMILIEMRDGQLRILEKLPTSPALLN |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 89.17 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (18.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02653 | BPD_transp_2 | 92.50 |
| PF00005 | ABC_tran | 2.50 |
| PF02371 | Transposase_20 | 0.83 |
| PF09723 | Zn-ribbon_8 | 0.83 |
| PF07969 | Amidohydro_3 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_103720404 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300000955|JGI1027J12803_106156669 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300002908|JGI25382J43887_10344870 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300004114|Ga0062593_100942694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 878 | Open in IMG/M |
| 3300004268|Ga0066398_10172387 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005093|Ga0062594_100690303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 918 | Open in IMG/M |
| 3300005366|Ga0070659_101333683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 637 | Open in IMG/M |
| 3300005450|Ga0066682_10388983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 895 | Open in IMG/M |
| 3300005451|Ga0066681_10162476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1319 | Open in IMG/M |
| 3300005467|Ga0070706_101974657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 529 | Open in IMG/M |
| 3300005536|Ga0070697_102052730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 512 | Open in IMG/M |
| 3300005536|Ga0070697_102085878 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005540|Ga0066697_10070058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 2011 | Open in IMG/M |
| 3300005540|Ga0066697_10071529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1992 | Open in IMG/M |
| 3300005554|Ga0066661_10540055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 699 | Open in IMG/M |
| 3300005555|Ga0066692_10480578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 792 | Open in IMG/M |
| 3300005568|Ga0066703_10768180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 552 | Open in IMG/M |
| 3300005569|Ga0066705_10940764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 512 | Open in IMG/M |
| 3300005576|Ga0066708_10082986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1872 | Open in IMG/M |
| 3300005617|Ga0068859_101175728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 845 | Open in IMG/M |
| 3300005719|Ga0068861_101655447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 632 | Open in IMG/M |
| 3300005843|Ga0068860_100668295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1047 | Open in IMG/M |
| 3300006031|Ga0066651_10643329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 566 | Open in IMG/M |
| 3300006034|Ga0066656_10279770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 1075 | Open in IMG/M |
| 3300006163|Ga0070715_10827137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 564 | Open in IMG/M |
| 3300006755|Ga0079222_10324483 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300006794|Ga0066658_10453175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 698 | Open in IMG/M |
| 3300006800|Ga0066660_10339937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 1215 | Open in IMG/M |
| 3300006804|Ga0079221_11651326 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006806|Ga0079220_10355744 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300006845|Ga0075421_100071467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 4379 | Open in IMG/M |
| 3300006846|Ga0075430_100193202 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300006846|Ga0075430_101227946 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006847|Ga0075431_100321732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1559 | Open in IMG/M |
| 3300006854|Ga0075425_102925032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 524 | Open in IMG/M |
| 3300006871|Ga0075434_101065343 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300006894|Ga0079215_10159097 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300006914|Ga0075436_101136021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 589 | Open in IMG/M |
| 3300007258|Ga0099793_10023230 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300009090|Ga0099827_11184866 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300009094|Ga0111539_10080047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 3843 | Open in IMG/M |
| 3300009098|Ga0105245_10643309 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1090 | Open in IMG/M |
| 3300009137|Ga0066709_100328432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora pallida | 2091 | Open in IMG/M |
| 3300009137|Ga0066709_103102340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 608 | Open in IMG/M |
| 3300009147|Ga0114129_11284587 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300009147|Ga0114129_11996725 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300009147|Ga0114129_13113868 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300009156|Ga0111538_11233384 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300009792|Ga0126374_11677193 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300009811|Ga0105084_1099258 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300009837|Ga0105058_1154239 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010303|Ga0134082_10060409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora pallida | 1465 | Open in IMG/M |
| 3300010304|Ga0134088_10398482 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010326|Ga0134065_10459218 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010358|Ga0126370_12029684 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010359|Ga0126376_11122937 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300010398|Ga0126383_10163726 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2092 | Open in IMG/M |
| 3300010400|Ga0134122_10012832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 6247 | Open in IMG/M |
| 3300010401|Ga0134121_12228890 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012202|Ga0137363_10790227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 805 | Open in IMG/M |
| 3300012925|Ga0137419_11787958 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012944|Ga0137410_11855760 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012972|Ga0134077_10460162 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
| 3300012976|Ga0134076_10528329 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300014150|Ga0134081_10206291 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 670 | Open in IMG/M |
| 3300014269|Ga0075302_1108598 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300015358|Ga0134089_10022543 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300015373|Ga0132257_103110391 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300017654|Ga0134069_1062421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1183 | Open in IMG/M |
| 3300017656|Ga0134112_10465559 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300017959|Ga0187779_11097360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 556 | Open in IMG/M |
| 3300018058|Ga0187766_10844882 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300018431|Ga0066655_11060806 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300018468|Ga0066662_10211542 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300018468|Ga0066662_11610156 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300018469|Ga0190270_12734617 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018482|Ga0066669_12127228 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300020074|Ga0194113_10940265 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300020084|Ga0194110_10179382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 1626 | Open in IMG/M |
| 3300022694|Ga0222623_10107974 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1083 | Open in IMG/M |
| 3300025324|Ga0209640_10401697 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1130 | Open in IMG/M |
| 3300025580|Ga0210138_1103100 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300025904|Ga0207647_10689159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora echinospora | 558 | Open in IMG/M |
| 3300025921|Ga0207652_10464958 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300025932|Ga0207690_11123656 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300026032|Ga0208419_1033045 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300026296|Ga0209235_1203735 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300026298|Ga0209236_1021554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 3588 | Open in IMG/M |
| 3300026300|Ga0209027_1231517 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300026307|Ga0209469_1109404 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300026323|Ga0209472_1055344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1688 | Open in IMG/M |
| 3300026342|Ga0209057_1100860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1160 | Open in IMG/M |
| 3300026530|Ga0209807_1014124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 3924 | Open in IMG/M |
| 3300026537|Ga0209157_1100370 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300026537|Ga0209157_1353386 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300027277|Ga0209846_1058514 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027748|Ga0209689_1164326 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300027880|Ga0209481_10019449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 2995 | Open in IMG/M |
| 3300027909|Ga0209382_10186156 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
| 3300028381|Ga0268264_10525993 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1157 | Open in IMG/M |
| 3300028592|Ga0247822_10069462 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
| 3300028608|Ga0247819_10694699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 621 | Open in IMG/M |
| 3300028889|Ga0247827_10334439 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 897 | Open in IMG/M |
| 3300030006|Ga0299907_11071492 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031572|Ga0318515_10070051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora pallida | 1800 | Open in IMG/M |
| 3300031720|Ga0307469_12209204 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
| 3300031740|Ga0307468_100548317 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 930 | Open in IMG/M |
| 3300031740|Ga0307468_101666236 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031771|Ga0318546_10445528 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300031782|Ga0318552_10410365 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 691 | Open in IMG/M |
| 3300031796|Ga0318576_10054423 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300031821|Ga0318567_10885434 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031995|Ga0307409_102312439 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300032002|Ga0307416_101637833 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300032042|Ga0318545_10342438 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300032063|Ga0318504_10417947 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300032180|Ga0307471_101697383 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 785 | Open in IMG/M |
| 3300032180|Ga0307471_103168273 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300033289|Ga0310914_10212495 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300033475|Ga0310811_10407931 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.50% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.67% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026032 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1037204042 | 3300000955 | Soil | KFDANHQAWINMILIEMRDGQLHILEKLPTSPALLN* |
| JGI1027J12803_1061566691 | 3300000955 | Soil | ASIRAALEEVDVKDSPLGPIKFDANHQAWINMILIEMRDGQLRILEKLPTSPALLN* |
| JGI25382J43887_103448701 | 3300002908 | Grasslands Soil | PVGPIKFDENHQAWINMILIEMRGGQLRVIEKLATSPAILR* |
| Ga0062593_1009426942 | 3300004114 | Soil | GPIKFDDHHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0066398_101723872 | 3300004268 | Tropical Forest Soil | LEEVDVKDSPLGPIKFDANHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0062594_1006903032 | 3300005093 | Soil | GPIKFDDHHQAWINMVLVEMKGGQLRLLEKIPTSPAILQ* |
| Ga0070659_1013336831 | 3300005366 | Corn Rhizosphere | DSPLGPIKFDANHQAWINMILLEMHDGKIQILEKLPTSPALLN* |
| Ga0066682_103889832 | 3300005450 | Soil | EVDVKDSPLGPIKFDDNHQAWINMILLEVRDGQLRILEKLPTSPALLN* |
| Ga0066681_101624763 | 3300005451 | Soil | RAALKEVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLRILEKLQTSPALLN* |
| Ga0070706_1019746571 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TIRAALKEVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLRILEKLQTSPALLN* |
| Ga0070697_1020527301 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0070697_1020858781 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PLGPIKFDANHQAWINMILIEMRDGQLHILEKLPTSPALLN* |
| Ga0066697_100700581 | 3300005540 | Soil | ADRQTIRAALKEVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLRILEKLQTSPALLN* |
| Ga0066697_100715293 | 3300005540 | Soil | IKFDDHHQAWINMILIEMRDGQLRILEKLPTSPALLN* |
| Ga0066661_105400551 | 3300005554 | Soil | DSQVGPIKFDENHQAWINMLLIEMRDGQLKLLEKLPTSPALLK* |
| Ga0066692_104805782 | 3300005555 | Soil | KEVDVKDSPLGPIKFDDNHQAWINMILLEMRDGQLRILEKLQTSPALLN* |
| Ga0066703_107681802 | 3300005568 | Soil | IRAALKEVDVKDSPLGPIKFDDHHQAWINMILLEMRDGQLRILEKLPTSPALLN* |
| Ga0066705_109407642 | 3300005569 | Soil | SPLGPIKFDDHHQAWINMILIEMRDGQLRILEKLQTSPALLN* |
| Ga0066708_100829861 | 3300005576 | Soil | IKFDEYHQAWINMILIEMRGGQLTIIEKITTSPALLQ* |
| Ga0068859_1011757282 | 3300005617 | Switchgrass Rhizosphere | QVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0068861_1016554472 | 3300005719 | Switchgrass Rhizosphere | ALTEVDVKDSPLGPIKFDANHQAWINMILLEMQDGKIRILEKLPTSPALLN* |
| Ga0068860_1006682952 | 3300005843 | Switchgrass Rhizosphere | EQIDVKDTPVGPIKFDDHHQAWINMVLVEMKGGQLRLLEKIPTSPAILQ* |
| Ga0066651_106433292 | 3300006031 | Soil | DTPVGPIKFDEYHQAWINMILLEMKGGQIRILERIPTSPAILQ* |
| Ga0066656_102797701 | 3300006034 | Soil | VKDTPVGPIKFDEYHQAWINMILLEMKGGQIRILERIPTSPAILQ* |
| Ga0070715_108271371 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TIRAALTEVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0079222_103244832 | 3300006755 | Agricultural Soil | VKDSPLGPIKFDANHQAWINMILIEMRDGQLHILEKLPTSPALLN* |
| Ga0066658_104531752 | 3300006794 | Soil | AALKEVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLRILEKLPTSPALLN* |
| Ga0066660_103399371 | 3300006800 | Soil | PIKFDDHHQAWINMILIEMRDGQLRILEKLPTSPALLN* |
| Ga0079221_116513262 | 3300006804 | Agricultural Soil | EVDVKESPLGPIKFDANHQAWINMILIEMRDGQLHILEKLPTSPALLN* |
| Ga0079220_103557441 | 3300006806 | Agricultural Soil | PIKFDANHQAWINMILIEMRDGQLHILEKLPTSPALLN* |
| Ga0075421_1000714676 | 3300006845 | Populus Rhizosphere | ADRQTIRAALKEVDVKDSPLGPIKFDENHQAWINMILLEMRDGQLRILEKLPTSPALLN* |
| Ga0075430_1001932022 | 3300006846 | Populus Rhizosphere | EVDVKDSPLGPIKFDDNHQAWINMILLEMQDGKLRILEKLPTSPALLN* |
| Ga0075430_1012279462 | 3300006846 | Populus Rhizosphere | EVDVKDSPLGPIKFDQNHQAWINMILVEMQDGKLRILEKLPTSPALLN* |
| Ga0075431_1003217321 | 3300006847 | Populus Rhizosphere | PLGPIKFDANHQAWINMILLEMQDGKIQILEKLPTSPALLN* |
| Ga0075425_1029250322 | 3300006854 | Populus Rhizosphere | DVKDSPLGPIKFDANHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0075434_1010653431 | 3300006871 | Populus Rhizosphere | FDDHHQAWINMVLVEMKGGQLRLLEKIPTSPAILQ* |
| Ga0079215_101590971 | 3300006894 | Agricultural Soil | GPIKFDANHQAWINMILLEMNDGKLRILEKLPTSPALLN* |
| Ga0075436_1011360212 | 3300006914 | Populus Rhizosphere | KDSPLGPIKFDANHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0099793_100232301 | 3300007258 | Vadose Zone Soil | PLGPIKFDDHHQAWINMILIEMRDGQLRILERLQTSPALLN* |
| Ga0099827_111848662 | 3300009090 | Vadose Zone Soil | LEQIDVKDSPVGPIKFDENHQAWINMILIEMRGGQLRVIEKLPTSPAILR* |
| Ga0111539_100800471 | 3300009094 | Populus Rhizosphere | RKSIRDALEQVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0105245_106433092 | 3300009098 | Miscanthus Rhizosphere | RAALEEVDVKDSPLGPIKFDDHHQAWINMILIEVRDGELKILEKVPTSPALLN* |
| Ga0066709_1003284323 | 3300009137 | Grasslands Soil | PLGPIKFDDHHQAWINMILIEMRDGQLRILEKLQTSPALLN* |
| Ga0066709_1031023402 | 3300009137 | Grasslands Soil | VKDTPIGPIKFDDHHQAWISMILVEMRDGQIKILEKLPTSPALLK* |
| Ga0114129_112845871 | 3300009147 | Populus Rhizosphere | KDSPLGPIKFDANHQAWINMILIEMRDGQLHILEKLPTSPALLN* |
| Ga0114129_119967251 | 3300009147 | Populus Rhizosphere | KFDDNHQAWINMILLEMQDGKLRILEKLPTSPALLN* |
| Ga0114129_131138682 | 3300009147 | Populus Rhizosphere | IKFDDHHQAWINMILLEMRDGQLRILEKLPTSPALLN* |
| Ga0111538_112333842 | 3300009156 | Populus Rhizosphere | RAALEEVDVKDSPLGPIKFDDNHQAWINMILIEMQDGKLRILEKLPTSPALLN* |
| Ga0126374_116771932 | 3300009792 | Tropical Forest Soil | GKADRKSIRDALEQVDVKDSPVGPIKFDEYHQAWINMILLEMKGGQLRILEKIPTSPAILQ* |
| Ga0105084_10992582 | 3300009811 | Groundwater Sand | AALTEVDVKDSPLGPIKFDANHQAWINMILVEMQDGKLRILEKLPTSAALLN* |
| Ga0105058_11542391 | 3300009837 | Groundwater Sand | SIRAALTEVDVKDSPLGPIKFDANHQAWINMILVEMQDGKLRILEKLPTSPALLN* |
| Ga0134082_100604091 | 3300010303 | Grasslands Soil | DRQTIRAALEEVDVKDSPLGPIKFDAHHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0134088_103984821 | 3300010304 | Grasslands Soil | DDNHQAWINMILLEMRDGQLRILEKLQTSPALLN* |
| Ga0134065_104592181 | 3300010326 | Grasslands Soil | KEVAVKDSPLGPIKFDDNHQAWIKLILLEVRDGQLRILEKLQTSPALLN* |
| Ga0126370_120296842 | 3300010358 | Tropical Forest Soil | TIRDALEQIDVKDTPLGPIKFDDHHQAWINMVLVEMKGGQLRLLEKIPTSPAILQ* |
| Ga0126376_111229372 | 3300010359 | Tropical Forest Soil | IKFDANHQAWINMILIEMRDGQLHILEKLPTSPALLN* |
| Ga0126383_101637261 | 3300010398 | Tropical Forest Soil | RKTIRDALEQIDVKDTPVGPIKFDDHHQAWINMVLIEMKGGHLRLLEKIPTSPAILQ* |
| Ga0134122_100128329 | 3300010400 | Terrestrial Soil | LEQVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0134121_122288902 | 3300010401 | Terrestrial Soil | DVKDSPLGPIKFDDHHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0137363_107902271 | 3300012202 | Vadose Zone Soil | GKADRKTIRDALEQLDVKDTPLGPIKFDDHHQAWINMVLIEMKGGQLRLLEKIPTSPAILQ* |
| Ga0137419_117879581 | 3300012925 | Vadose Zone Soil | TEVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLRILEKLQTSPALLN* |
| Ga0137410_118557601 | 3300012944 | Vadose Zone Soil | GPIKFDANHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0134077_104601621 | 3300012972 | Grasslands Soil | KTGKADRKSIRDALEQIDVKDTPIGPIKFDDHHQAWITMILVEMRDGQIKILEKLPTSPALLK* |
| Ga0134076_105283291 | 3300012976 | Grasslands Soil | PLGPIKFDDHHQAWINMILLEMRDGQLRILEKLPTSPALLN* |
| Ga0134081_102062911 | 3300014150 | Grasslands Soil | KKHGKADRATIRAALEEVDVKDSPLGPIKFDANHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0075302_11085982 | 3300014269 | Natural And Restored Wetlands | RKSIRDALEQIDVRDTPLGPIKFDDHHQAWINMVLIEMRGGQLRLLEKIPTSPAVLQ* |
| Ga0134089_100225431 | 3300015358 | Grasslands Soil | KADRQTIRAALEEVDVKDSPLGPIKFDANHQAWINMILIEMRDGQLKILEKLPTSPALLN |
| Ga0132257_1031103912 | 3300015373 | Arabidopsis Rhizosphere | TGKADRKSIRDALEQVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLKILEKLPTSPALLN* |
| Ga0134069_10624213 | 3300017654 | Grasslands Soil | ADRQTIRAALEEVDVKDSPLGPIKFDANHQAWINMILIEMRDGQLKILEKLPTSPALLN |
| Ga0134112_104655591 | 3300017656 | Grasslands Soil | KDSPLGPIKFDDNHQAWINMILLEMRDGQLRILEKLQTSPALLN |
| Ga0187779_110973601 | 3300017959 | Tropical Peatland | YGRADRRSIRDALEQIDVKDTPLGPIKFDEYHQAYINMVLVEMKGGQLRILEKLPTSAAILQ |
| Ga0187766_108448821 | 3300018058 | Tropical Peatland | IRDALEQIDVKDSPLGPIKFDDHHQAWINMVLLEMKGGQIRLLEKIPTSPAILQ |
| Ga0066655_110608061 | 3300018431 | Grasslands Soil | DSPLGPIKFDDNHQAWINMILLEMRDGQLRILEKLQTSPALLN |
| Ga0066662_102115423 | 3300018468 | Grasslands Soil | QTIRAALKEVDVKDSPLGPIKFDDNHQAWINMILLEMRDGQLRILEKLQTSPALLN |
| Ga0066662_116101562 | 3300018468 | Grasslands Soil | GKADRQTIRAALEEVDVKDSPLGPIKFDANHQAWINMILIEMRDGQLRILEKLQTSPALL |
| Ga0190270_127346171 | 3300018469 | Soil | KDSPLGPIKFDANHQAWINMILLEMQDGKIQILEKLPTSPALLN |
| Ga0066669_121272281 | 3300018482 | Grasslands Soil | DVKASPLGPIKFDDNHQAWINMILLEMRDGQLRILEKLQTSPALLN |
| Ga0194113_109402651 | 3300020074 | Freshwater Lake | VKDSPLGPIKFDANHQAWINMILLEMQDGKIRILEKLPTSPALLN |
| Ga0194110_101793823 | 3300020084 | Freshwater Lake | IKKGKVDRAGIRAALTEVDVKDSPLGPIKFDANHQAWINMILLEMQDGKIRILEKLPTSPALLN |
| Ga0222623_101079742 | 3300022694 | Groundwater Sediment | VKDSPLGPIKFDANHQAWINMILIEMRDGQLRILEKLPTSPALLN |
| Ga0209640_104016971 | 3300025324 | Soil | ALAQIDVKDTPIGPIKFDEYHQAWINMILIEMRGGQLKIIEKITTSPALLQ |
| Ga0210138_11031001 | 3300025580 | Natural And Restored Wetlands | QLDVKDTPLGPIKFDDHHQAWINMVLIEMKGGQLRLLEKIPTSPAILQ |
| Ga0207647_106891591 | 3300025904 | Corn Rhizosphere | DRATIRAALKEVDVKDSPLGPIKFDDNHQAWINMILIEMQDGKLRILEKLPTSPALLN |
| Ga0207652_104649582 | 3300025921 | Corn Rhizosphere | VKDSPLGPIKFDANHQAWINMILLEMQDGKIQILEKLPTSPALLN |
| Ga0207690_111236561 | 3300025932 | Corn Rhizosphere | TEVDVKDSPLGPIKFDANHQAWINMILLEMHDGKIQILEKLPTSPALLN |
| Ga0208419_10330452 | 3300026032 | Natural And Restored Wetlands | KKHGKADRATIRTALTEVDVKDSPLGPIKFDANHQAWINMILIEIRDGQLRILEKLPTSPALLN |
| Ga0209235_12037351 | 3300026296 | Grasslands Soil | VDVKDSPVGPIKFDENHQAWINMVLIEMRDGQLKILEKLPTSPALLK |
| Ga0209236_10215541 | 3300026298 | Grasslands Soil | FDANHQAWINMILIEMRDGQLKILEKLPTSPALLN |
| Ga0209027_12315171 | 3300026300 | Grasslands Soil | SPLGPIKFDDHHQAWINMILLEMRDGQLRILEKLPTSPALLN |
| Ga0209469_11094041 | 3300026307 | Soil | ALKEVDVKDSPLGPIKFDDHHQAWINMILLEMRDGQLRILEKLPTSPALLN |
| Ga0209472_10553441 | 3300026323 | Soil | KHGKADRQTIRAALKEVDVKDSPLGPIKFDDNHQAWINMILLEMRDGQLRILEKLQTSPALLN |
| Ga0209057_11008602 | 3300026342 | Soil | QTIRAALKEVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLRILEKLPTSPALLN |
| Ga0209807_10141241 | 3300026530 | Soil | VKDSPLGPIKFDDHHQAWINMILLEMRDGQLRILEKLPTSPALLN |
| Ga0209157_11003703 | 3300026537 | Soil | TIRAALKEVDVKDSPLGPIKFDDNHQAWINMILLEMRDGQLRILEKLQTSPALLN |
| Ga0209157_13533861 | 3300026537 | Soil | EIEVKDTPVGPIKFDEYHQAWINMILLEMKGGQIRILERIPTSPAILQ |
| Ga0209846_10585141 | 3300027277 | Groundwater Sand | RDALEEVDVKDSPLGPIKFDANHQAWINMILIEMRDGQLRILEKLQTSPALLN |
| Ga0209689_11643262 | 3300027748 | Soil | GPIKFDDHHQAWINMILIEMRDGQLRILEKLQTSPALLN |
| Ga0209481_100194495 | 3300027880 | Populus Rhizosphere | KKQGKADRQTIRAALKEVDVKDSPLGPIKFDENHQAWINMILLEMRDGQLRILEKLPTSPALLN |
| Ga0209382_101861561 | 3300027909 | Populus Rhizosphere | DSPLGPIKFDDNHQAWINMILLEMQDGKLRILEKLPTSPALLN |
| Ga0268264_105259933 | 3300028381 | Switchgrass Rhizosphere | DRKSIRDALEQVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLKILEKLPTSPALLN |
| Ga0247822_100694624 | 3300028592 | Soil | DSPLGPIKFDANHQAWINMILLEMQDGKIQILEKLPTSPALLN |
| Ga0247819_106946991 | 3300028608 | Soil | PLGPIKFDANHQAWINMILIEMRDGQLRILEKLPTSPALLN |
| Ga0247827_103344392 | 3300028889 | Soil | LKKHGKADRASIRAALEEVDVKDSPLGPIKFDANHQAWINMILIEMRDGQLRILEKLPTSPALLN |
| Ga0299907_110714922 | 3300030006 | Soil | KDSPLGPIKFDANHQAWINMILLQMQDGKIRVLEKLPTSPALLD |
| Ga0318515_100700511 | 3300031572 | Soil | FDANHQAWINMILIEIRDDQLHILEKLSTSPALLN |
| Ga0307469_122092041 | 3300031720 | Hardwood Forest Soil | IRDSLEQIDVKESPLGPIKFDEYHQAWINMILIEMKGGQLKILEKLPTSPALLQ |
| Ga0307468_1005483172 | 3300031740 | Hardwood Forest Soil | IRAALEEVDVKDSPLGPIKFDANHQAWINMILIEMRDGQLKILEKLPTSPALLN |
| Ga0307468_1016662361 | 3300031740 | Hardwood Forest Soil | QVDVKDSPLGPIKFDDHHQAWINMILIEMRDGQLKILEKLPTSPALLN |
| Ga0318546_104455281 | 3300031771 | Soil | DSPLGPIKFDTNHQAWINMILIEIRDGQLHILEKLPTSPALLN |
| Ga0318552_104103652 | 3300031782 | Soil | VKDSPLGPIKFDANHQAWINMILIEIRDDQLHILEKLSTSPALLN |
| Ga0318576_100544233 | 3300031796 | Soil | IRTALEEVDVKDSPLGPIKFDANHQAWINMILIEIRDDQLHILEKLSTSPALLN |
| Ga0318567_108854341 | 3300031821 | Soil | KHGKADRQTIRAALEEVDVKDSPLGPIKFDANHQAWINMILIEIRDGQLHILEKLPTSPALLN |
| Ga0307409_1023124392 | 3300031995 | Rhizosphere | KFDANHQAWINMILIEIRDGQLRILEKLPTSPALLN |
| Ga0307416_1016378332 | 3300032002 | Rhizosphere | SPLGPIKFDQNHQAWINMILLEMQDGKIRILEKLPTSPALLN |
| Ga0318545_103424382 | 3300032042 | Soil | LEEVDVKDSPLGPIKFDANHQAWINMILIEIRDDQLHILEKLSTSPALLN |
| Ga0318504_104179471 | 3300032063 | Soil | KKHGKADRQTIRAALEEVDVKDSPLGPIKFDANHQAWINMILIEIRDGQLHILEKLPTSPALLN |
| Ga0307471_1016973832 | 3300032180 | Hardwood Forest Soil | PLGPIKFDANHQAWINMILIEMRDGQLKILEKLPTSPALLN |
| Ga0307471_1031682731 | 3300032180 | Hardwood Forest Soil | GPIKFDANHQAWINMILIEMRDGQLRILEKLPTSPALLN |
| Ga0310914_102124953 | 3300033289 | Soil | QTIRTALEEVDVKDSPLGPIKFDANHQAWINMILIEIRDDQLHILEKLSTSPALLN |
| Ga0310811_104079311 | 3300033475 | Soil | KFDANHQAWINMILIEIHDGQLRVLEKLPTSPALLN |
| ⦗Top⦘ |