| Basic Information | |
|---|---|
| Family ID | F074061 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLIGVAVVAVGMHDYNGPDASAITLGIVVLIVLILVGVYARRNR |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.00 % |
| % of genes near scaffold ends (potentially truncated) | 20.83 % |
| % of genes from short scaffolds (< 2000 bps) | 85.83 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF01979 | Amidohydro_1 | 5.83 |
| PF13396 | PLDc_N | 5.00 |
| PF08241 | Methyltransf_11 | 5.00 |
| PF02861 | Clp_N | 5.00 |
| PF12680 | SnoaL_2 | 4.17 |
| PF13545 | HTH_Crp_2 | 2.50 |
| PF08044 | DUF1707 | 2.50 |
| PF01872 | RibD_C | 1.67 |
| PF14588 | YjgF_endoribonc | 1.67 |
| PF12867 | DinB_2 | 1.67 |
| PF13649 | Methyltransf_25 | 1.67 |
| PF01638 | HxlR | 1.67 |
| PF06742 | DUF1214 | 1.67 |
| PF13489 | Methyltransf_23 | 1.67 |
| PF12697 | Abhydrolase_6 | 0.83 |
| PF02687 | FtsX | 0.83 |
| PF00484 | Pro_CA | 0.83 |
| PF12900 | Pyridox_ox_2 | 0.83 |
| PF01061 | ABC2_membrane | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| PF05901 | Excalibur | 0.83 |
| PF00378 | ECH_1 | 0.83 |
| PF08327 | AHSA1 | 0.83 |
| PF07501 | G5 | 0.83 |
| PF01184 | Gpr1_Fun34_YaaH | 0.83 |
| PF00027 | cNMP_binding | 0.83 |
| PF00440 | TetR_N | 0.83 |
| PF09992 | NAGPA | 0.83 |
| PF13359 | DDE_Tnp_4 | 0.83 |
| PF13432 | TPR_16 | 0.83 |
| PF00196 | GerE | 0.83 |
| PF00106 | adh_short | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 5.00 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.67 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.67 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.67 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 1.67 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 1.67 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.83 |
| COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.00 % |
| Unclassified | root | N/A | 35.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_161500 | Not Available | 546 | Open in IMG/M |
| 3300000567|JGI12270J11330_10039907 | Not Available | 2638 | Open in IMG/M |
| 3300001356|JGI12269J14319_10048045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2580 | Open in IMG/M |
| 3300004091|Ga0062387_100143741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1363 | Open in IMG/M |
| 3300004479|Ga0062595_100402095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 982 | Open in IMG/M |
| 3300004479|Ga0062595_100511001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 906 | Open in IMG/M |
| 3300005334|Ga0068869_101860377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → unclassified Streptosporangiaceae → Streptosporangiaceae bacterium NEAU-GS5 | 539 | Open in IMG/M |
| 3300005338|Ga0068868_100319729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1322 | Open in IMG/M |
| 3300005434|Ga0070709_10567021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 870 | Open in IMG/M |
| 3300005435|Ga0070714_100009759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7564 | Open in IMG/M |
| 3300005435|Ga0070714_100248911 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300005435|Ga0070714_100877582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 870 | Open in IMG/M |
| 3300005435|Ga0070714_101133593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 762 | Open in IMG/M |
| 3300005436|Ga0070713_101138733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
| 3300005436|Ga0070713_101565974 | Not Available | 639 | Open in IMG/M |
| 3300005437|Ga0070710_10095184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1763 | Open in IMG/M |
| 3300005437|Ga0070710_11389352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
| 3300005536|Ga0070697_102042587 | Not Available | 513 | Open in IMG/M |
| 3300005541|Ga0070733_10309048 | Not Available | 1045 | Open in IMG/M |
| 3300005548|Ga0070665_100792390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
| 3300005553|Ga0066695_10269146 | Not Available | 1076 | Open in IMG/M |
| 3300005615|Ga0070702_101528483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 550 | Open in IMG/M |
| 3300006028|Ga0070717_11114875 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300006032|Ga0066696_10648373 | Not Available | 682 | Open in IMG/M |
| 3300006046|Ga0066652_100462904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1170 | Open in IMG/M |
| 3300006163|Ga0070715_10893911 | Not Available | 546 | Open in IMG/M |
| 3300006174|Ga0075014_100186383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1038 | Open in IMG/M |
| 3300006354|Ga0075021_10336276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 940 | Open in IMG/M |
| 3300006358|Ga0068871_100888143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 826 | Open in IMG/M |
| 3300006573|Ga0074055_11848887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1211 | Open in IMG/M |
| 3300006804|Ga0079221_11589263 | Not Available | 529 | Open in IMG/M |
| 3300006806|Ga0079220_10204626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1143 | Open in IMG/M |
| 3300006914|Ga0075436_100546430 | Not Available | 850 | Open in IMG/M |
| 3300009101|Ga0105247_10395501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 983 | Open in IMG/M |
| 3300009137|Ga0066709_101712300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 890 | Open in IMG/M |
| 3300009551|Ga0105238_10470358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1255 | Open in IMG/M |
| 3300009553|Ga0105249_10868260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → unclassified Streptosporangiaceae → Streptosporangiaceae bacterium NEAU-GS5 | 968 | Open in IMG/M |
| 3300009553|Ga0105249_11183802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 835 | Open in IMG/M |
| 3300009824|Ga0116219_10215225 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300009839|Ga0116223_10445201 | Not Available | 758 | Open in IMG/M |
| 3300010376|Ga0126381_104292281 | Not Available | 552 | Open in IMG/M |
| 3300010379|Ga0136449_100104290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 5798 | Open in IMG/M |
| 3300011120|Ga0150983_13875407 | Not Available | 748 | Open in IMG/M |
| 3300012198|Ga0137364_10957695 | Not Available | 648 | Open in IMG/M |
| 3300012200|Ga0137382_10106478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1857 | Open in IMG/M |
| 3300012200|Ga0137382_10369132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1008 | Open in IMG/M |
| 3300012208|Ga0137376_10342284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1298 | Open in IMG/M |
| 3300012929|Ga0137404_10136854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → unclassified Streptosporangiaceae → Streptosporangiaceae bacterium NEAU-GS5 | 2023 | Open in IMG/M |
| 3300013105|Ga0157369_10628693 | Not Available | 1108 | Open in IMG/M |
| 3300013297|Ga0157378_10857842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 937 | Open in IMG/M |
| 3300013307|Ga0157372_11418511 | Not Available | 800 | Open in IMG/M |
| 3300015264|Ga0137403_10385463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → unclassified Streptosporangiaceae → Streptosporangiaceae bacterium NEAU-GS5 | 1283 | Open in IMG/M |
| 3300016270|Ga0182036_10630536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 862 | Open in IMG/M |
| 3300017937|Ga0187809_10276842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
| 3300018433|Ga0066667_10676704 | Not Available | 864 | Open in IMG/M |
| 3300018482|Ga0066669_12301943 | Not Available | 514 | Open in IMG/M |
| 3300020581|Ga0210399_10138800 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300020582|Ga0210395_10530036 | Not Available | 886 | Open in IMG/M |
| 3300021170|Ga0210400_11303606 | Not Available | 582 | Open in IMG/M |
| 3300021180|Ga0210396_11751943 | Not Available | 503 | Open in IMG/M |
| 3300021478|Ga0210402_10029541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4734 | Open in IMG/M |
| 3300022467|Ga0224712_10233719 | Not Available | 845 | Open in IMG/M |
| 3300022525|Ga0242656_1072044 | Not Available | 635 | Open in IMG/M |
| 3300024176|Ga0224565_1034203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300024347|Ga0179591_1028812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1744 | Open in IMG/M |
| 3300025905|Ga0207685_10484252 | Not Available | 649 | Open in IMG/M |
| 3300025906|Ga0207699_10375181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1008 | Open in IMG/M |
| 3300025916|Ga0207663_10260141 | Not Available | 1281 | Open in IMG/M |
| 3300025924|Ga0207694_10302104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1318 | Open in IMG/M |
| 3300025927|Ga0207687_10306959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1280 | Open in IMG/M |
| 3300025927|Ga0207687_11703133 | Not Available | 540 | Open in IMG/M |
| 3300025929|Ga0207664_11226274 | Not Available | 668 | Open in IMG/M |
| 3300025961|Ga0207712_10926524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 771 | Open in IMG/M |
| 3300027497|Ga0208199_1065250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
| 3300027568|Ga0208042_1000512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13121 | Open in IMG/M |
| 3300027775|Ga0209177_10003592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3032 | Open in IMG/M |
| 3300027894|Ga0209068_10142681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1291 | Open in IMG/M |
| 3300028379|Ga0268266_11521309 | Not Available | 645 | Open in IMG/M |
| 3300028718|Ga0307307_10164940 | Not Available | 695 | Open in IMG/M |
| 3300028881|Ga0307277_10105010 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300029999|Ga0311339_10280426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1808 | Open in IMG/M |
| 3300030494|Ga0310037_10029826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2623 | Open in IMG/M |
| 3300030740|Ga0265460_13004458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300030741|Ga0265459_14096391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300031543|Ga0318516_10720596 | Not Available | 566 | Open in IMG/M |
| 3300031544|Ga0318534_10559717 | Not Available | 651 | Open in IMG/M |
| 3300031561|Ga0318528_10231670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 990 | Open in IMG/M |
| 3300031564|Ga0318573_10116150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1385 | Open in IMG/M |
| 3300031708|Ga0310686_117529515 | Not Available | 549 | Open in IMG/M |
| 3300031718|Ga0307474_10753801 | Not Available | 770 | Open in IMG/M |
| 3300031747|Ga0318502_10975387 | Not Available | 516 | Open in IMG/M |
| 3300031778|Ga0318498_10358998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300031910|Ga0306923_10432451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1495 | Open in IMG/M |
| 3300031910|Ga0306923_10910292 | Not Available | 963 | Open in IMG/M |
| 3300031910|Ga0306923_11089769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
| 3300032009|Ga0318563_10126384 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300032043|Ga0318556_10165678 | Not Available | 1144 | Open in IMG/M |
| 3300032055|Ga0318575_10407770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 690 | Open in IMG/M |
| 3300032068|Ga0318553_10126523 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300032068|Ga0318553_10462731 | Not Available | 664 | Open in IMG/M |
| 3300032089|Ga0318525_10091000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1549 | Open in IMG/M |
| 3300032090|Ga0318518_10337229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
| 3300032091|Ga0318577_10167573 | Not Available | 1048 | Open in IMG/M |
| 3300032160|Ga0311301_10062098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8130 | Open in IMG/M |
| 3300032180|Ga0307471_100575711 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300032261|Ga0306920_102834803 | Not Available | 659 | Open in IMG/M |
| 3300032770|Ga0335085_10084674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4149 | Open in IMG/M |
| 3300032770|Ga0335085_10526458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1344 | Open in IMG/M |
| 3300032770|Ga0335085_10885681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 974 | Open in IMG/M |
| 3300032770|Ga0335085_11617291 | Not Available | 670 | Open in IMG/M |
| 3300032783|Ga0335079_10282736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1815 | Open in IMG/M |
| 3300032829|Ga0335070_10322680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1491 | Open in IMG/M |
| 3300032954|Ga0335083_10031688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5874 | Open in IMG/M |
| 3300032954|Ga0335083_10041315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4997 | Open in IMG/M |
| 3300032955|Ga0335076_10178391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2032 | Open in IMG/M |
| 3300033134|Ga0335073_10219225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2346 | Open in IMG/M |
| 3300033134|Ga0335073_11167204 | Not Available | 777 | Open in IMG/M |
| 3300033158|Ga0335077_10121467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3037 | Open in IMG/M |
| 3300033158|Ga0335077_11277349 | Not Available | 714 | Open in IMG/M |
| 3300034163|Ga0370515_0132713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1070 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 4.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.83% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02974030 | 2199352024 | Soil | MLIGVTVVAVRMHDYNGPYASAITLGIIALIVLILVGVYSRKSR |
| JGI12270J11330_100399072 | 3300000567 | Peatlands Soil | MLTGIAVVAVGMHGYNGPGAFVITLAVPALIVLILVGVYGRRKR* |
| JGI12269J14319_100480453 | 3300001356 | Peatlands Soil | MLTGIAVVAVGMHGYNGPGASVITLAVPALIVLILVGVYGRRKR* |
| Ga0062387_1001437412 | 3300004091 | Bog Forest Soil | MLIGVAVVAVGMHGYNGPGAMVITLAVPALIVLILVGVYGRRKR* |
| Ga0062595_1004020952 | 3300004479 | Soil | MLIGVAVVAVGMHDYNGPDASVITFGIVALIVLILAGVYGRRNR* |
| Ga0062595_1005110011 | 3300004479 | Soil | MLIGVAVVAVGMHDYNGPEASAITLGIVVLIVLILVGVYARRNR* |
| Ga0068869_1018603771 | 3300005334 | Miscanthus Rhizosphere | GVDVVAVGMHDYNGPDASAITLGIVVLIVLILVGVYARRNR* |
| Ga0068868_1003197291 | 3300005338 | Miscanthus Rhizosphere | MLIGVDVVAVGMHDYNGPDASAITLGIVVLIVLILVGVYARRNR* |
| Ga0070709_105670211 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGVDVVAVGMHDYNGPDASAITLGIVALIVLILIGVYGRRNR* |
| Ga0070714_1000097592 | 3300005435 | Agricultural Soil | MLIGIAVVAMGHDYNGPGASAITLGIVALIVLILAGVYGRKSR* |
| Ga0070714_1002489112 | 3300005435 | Agricultural Soil | MLIGVAVGIHGYNGPGASVFVFGTVALIVLILVAVYRPRKRR* |
| Ga0070714_1008775821 | 3300005435 | Agricultural Soil | MLIGVAVGIHGYDGPGASVFVFGTVALIVLILVAVYRPRKRR* |
| Ga0070714_1011335932 | 3300005435 | Agricultural Soil | MLIGVAVVAVGMHDYNSPDASAITLGIVALIVLILIGVYGRRNR* |
| Ga0070713_1011387331 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGGVVAMGHDYNGPGASAITLGIVALIVLILAGVYGRKNR* |
| Ga0070713_1015659743 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGWSTVMLIGVAVGIHGYDGPGASVFVFGTVALIVLILVAVYRPRRRR* |
| Ga0070710_100951844 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGTAVVAVGMHDYNGPDASAITLGIVALIVLILIGVYGRRNR* |
| Ga0070710_113893522 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGVAVGIHGYDGPGASVFVFGTVALIVLILVAVYRPRRRR* |
| Ga0070697_1020425872 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGVAVVAVGMHDYNGPYASAITLGIIALIVLILVRVYARKNR* |
| Ga0070733_103090481 | 3300005541 | Surface Soil | MLIGVAVGMHGYNGPGAVVITLGVPVLLVLILVAVYGRRKR* |
| Ga0070665_1007923902 | 3300005548 | Switchgrass Rhizosphere | MLIGVDVVAVGMHDYNGPDASAITLGIVVLIALILVGVYARRNR* |
| Ga0066695_102691463 | 3300005553 | Soil | MLIGVPVVAVGMHDYNGPYASAITFGIIALIVLILVGVYGRKNR* |
| Ga0070702_1015284832 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGVDVVAVGMHDYNGPDASAITLGIVVLIVLILVGVYARR |
| Ga0070717_111148751 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGIAVVAMGHEYNGPGASAIALGIVALIVLILAGVYGRKSR* |
| Ga0066696_106483731 | 3300006032 | Soil | VAMGHDYNGLGASAVTLGIVGLIVLILAGVYGRKNR* |
| Ga0066652_1004629041 | 3300006046 | Soil | IAVVAMGHDYNGLGASAVTLGIVGLIVLILAGVYGRKNR* |
| Ga0070715_108939111 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGTAVVAGGMHDYNGPDASAITLGIVALIVLILIGVYGRRNR* |
| Ga0075014_1001863833 | 3300006174 | Watersheds | VMLIGVAVVAVGMHGYNGPGAMVITLAVPALIVLILVGVYGRRKR* |
| Ga0075021_103362762 | 3300006354 | Watersheds | MLIGVAVGIHDYTGPGASAITLGIIALIVLILVGVFARGKR* |
| Ga0068871_1008881431 | 3300006358 | Miscanthus Rhizosphere | GMHDYNGPDASAITLGIVALIVLILIGVYGRRNR* |
| Ga0074055_118488872 | 3300006573 | Soil | MLIGVTAVAMGMHDYNGPYASAITLGIIALIVLILMGVYGRKTGNQPRS* |
| Ga0079221_115892632 | 3300006804 | Agricultural Soil | MPIGVAVVASRMHDYTGPYASAITLGIIALIVLILVGVYGRKSR* |
| Ga0079220_102046262 | 3300006806 | Agricultural Soil | MPIGMAVVAMGHDYNGPGASAITLGIVALIVLILAGVYGRKSR* |
| Ga0075436_1005464301 | 3300006914 | Populus Rhizosphere | MLIGVAVEYMAYNGPGASVFVFGTVALIVLILVAVYRPRKRR* |
| Ga0105247_103955012 | 3300009101 | Switchgrass Rhizosphere | MLIGVAVVAVGMHDYNGPDASAITLGIVVLIVLILVGVYARRNR* |
| Ga0066709_1017123001 | 3300009137 | Grasslands Soil | MLIGVGVVAVGMHDYNGPGASVITLGIIALIVLILVAVYRPRKR* |
| Ga0105238_104703581 | 3300009551 | Corn Rhizosphere | MPIGTAVVAVGMHDYNGPDASAITLGIVVLIVLILVGVYARRNR* |
| Ga0105249_108682602 | 3300009553 | Switchgrass Rhizosphere | MLIGTAVVAVGMHDYNGPDASAITLGIVVLIVLILVGVYARRNR* |
| Ga0105249_111838021 | 3300009553 | Switchgrass Rhizosphere | MLIGVDVVAVGTHAYNGPDASAITLGIVVLIVLILVGVYARRNR* |
| Ga0116219_102152251 | 3300009824 | Peatlands Soil | MLIGVAVVAVGMHGYNGPGAMVITLAVPALIVLILVTVYGRRKR* |
| Ga0116223_104452011 | 3300009839 | Peatlands Soil | AVVAVGMHGYNGPGASVITLAVPALIVLILVGVYGRRKR* |
| Ga0126381_1042922812 | 3300010376 | Tropical Forest Soil | MLIGVAVGMRGYNGPGALVITLGVPVPLVLILLAVYGRRNRRSR* |
| Ga0136449_1001042903 | 3300010379 | Peatlands Soil | MLVGVAVGMHGYNGPGAMVITLAVPALIVLILVTVYGRRKR* |
| Ga0150983_138754072 | 3300011120 | Forest Soil | MLIGVAVGIHSYNGPGASVFVFGTVALIVLILVAVYRPRKRR* |
| Ga0137364_109576952 | 3300012198 | Vadose Zone Soil | MLIGIAVVAMGHDYNGLGASAVTLGIVGLIVLILAGVYGRKNR* |
| Ga0137382_101064782 | 3300012200 | Vadose Zone Soil | MLIGVAVVAGRMHDYNGPYASAITLGIIALIVLILIGVYGRKSR* |
| Ga0137382_103691322 | 3300012200 | Vadose Zone Soil | MLIGVGVVAVGMHDYNGPGASVITLGIIALIVLILVAVYRPGKR* |
| Ga0137376_103422843 | 3300012208 | Vadose Zone Soil | MLIGVAVVAVRMHDYNGPYDSAITLGIIALIVLILIGVYGRKSR* |
| Ga0137404_101368543 | 3300012929 | Vadose Zone Soil | MLIGVAVVAVGMHDYNGPYASAITVGITALIVLILVGVYARKNR* |
| Ga0157369_106286932 | 3300013105 | Corn Rhizosphere | MLIGTAVVAVGIHDYNGPDASAITLGIVALIVLILIGVYGRRNR* |
| Ga0157378_108578421 | 3300013297 | Miscanthus Rhizosphere | MLIGVAVVAVGMHDYNGPDASAITLGIVVLIVLILVGVYARRNR |
| Ga0157372_114185111 | 3300013307 | Corn Rhizosphere | MLIGTAVVAVGMHDYNSPDASAITLGIVALIVLILIGVYGRRNR* |
| Ga0137403_103854632 | 3300015264 | Vadose Zone Soil | MLIGVAVVAVGMHDYNGPYASAITLGIIALIVLILVGVYARKNR* |
| Ga0182036_106305363 | 3300016270 | Soil | MLIGVAVGVHDYTGPGASAITLGIIALIVLILIGAYARGNR |
| Ga0187809_102768422 | 3300017937 | Freshwater Sediment | MLIGVSVGIHDYTGPGASAITLGIIALIVLILVGVFARGKR |
| Ga0066667_106767041 | 3300018433 | Grasslands Soil | MLIGIAVVAMGHDYNGLGASAVTLGIVGLIVLILAGVYGRKNR |
| Ga0066669_123019432 | 3300018482 | Grasslands Soil | MLIGIAVVAMGYDYNGLGASAVTLGIVGLIVLILAEVYGRKNG |
| Ga0210399_101388002 | 3300020581 | Soil | MLIGVAVGIHSYNGPGASVFVFGTVALIVLILVAVYRPRKRR |
| Ga0210395_105300363 | 3300020582 | Soil | MLIGVAVGIHGYDGPGASVFVFGTVALIVLILVVVYRPRKRR |
| Ga0210400_113036062 | 3300021170 | Soil | MLIGVPVGIHGYNGPGASVFVFGTVALIVLILVAVYRPRKRR |
| Ga0210396_117519431 | 3300021180 | Soil | WVAGGIHGYNGPGASVFVFGTVALIVLILVAVYRPRKRR |
| Ga0210402_100295413 | 3300021478 | Soil | MLIGVAVGIHDYTGPGVSAITLGIIALIVLILVGVFARGKR |
| Ga0224712_102337192 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGVDVVAVGMHDYNGPDASAITLGIVVLIALILVGVYARRNR |
| Ga0242656_10720441 | 3300022525 | Soil | MLIGVAVGIHSYNGPGASVFVFGTVALIVLILVAGYRPRKRR |
| Ga0224565_10342032 | 3300024176 | Plant Litter | MLTGVVVLAVGMHGYNGPGALGITIAIPVILVLILVAMYGRKKR |
| Ga0179591_10288122 | 3300024347 | Vadose Zone Soil | MLIGVPVVAVGMHDYNGRYASAITLGIIALIVLILIGVYGRKSR |
| Ga0207685_104842522 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGIAVVAMGHDYNGPGASAITLGIVALIVLILIGVYGRRNR |
| Ga0207699_103751812 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGTAVVAVGMHDYNGPDASAITLGIVALIVLILIGVYGRRNR |
| Ga0207663_102601412 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGTAVVAVGMHDYNSPDASAITLGIVALIVLILIGVYGRRNR |
| Ga0207694_103021042 | 3300025924 | Corn Rhizosphere | MLIGVDVVAVGMHDYNGPDASAITLGIVVLIVLILVGVYARRNR |
| Ga0207687_103069592 | 3300025927 | Miscanthus Rhizosphere | MLIGVDVVAVGMHDYNGPDASAITLGIVVLIVLILVGMYARRNR |
| Ga0207687_117031331 | 3300025927 | Miscanthus Rhizosphere | MLIGGVVAMGHDYNGPGASAITLGIVALIVLILAGVYGRKNR |
| Ga0207664_112262741 | 3300025929 | Agricultural Soil | MLIGIAVVAMGHEYNGPGASAIALGIVALIVLILAGVYGRKSR |
| Ga0207712_109265241 | 3300025961 | Switchgrass Rhizosphere | MPIGTAVVAVGMHDYNGPDASAITLGIVVLIVLILVGVYARRNR |
| Ga0208199_10652502 | 3300027497 | Peatlands Soil | MLTGIAVVAVGMHGYNGPGAFVITLAVPALIVLILVGVYGRRKR |
| Ga0208042_10005126 | 3300027568 | Peatlands Soil | MLTGIAVVAVGMHGYNGPGASVITLAVPALIVLILVGVYGRRKR |
| Ga0209177_100035922 | 3300027775 | Agricultural Soil | MPIGMAVVAMGHDYNGPGASAITLGIVALIVLILAGVYGRKSR |
| Ga0209068_101426812 | 3300027894 | Watersheds | MLIGVAVGIHDYTGPGASAITLGIIALIVLILVGVFARGKR |
| Ga0268266_115213091 | 3300028379 | Switchgrass Rhizosphere | MLIGTAVVAVGIHDYNGPDASAITLGIVALIVLILIGVYGRRNR |
| Ga0307307_101649402 | 3300028718 | Soil | MLIGVAVVAVGMHDYTGPGASAITLGIVGLIVLILVGVYGRKTGNQPRY |
| Ga0307277_101050103 | 3300028881 | Soil | MLIGVAVVAVGMHDYNGPFASATTLGIIALIVLILIGVYGWKSR |
| Ga0311339_102804262 | 3300029999 | Palsa | MLIGVAVGMHGYSGPGAMVITLAVPALIVLILVGVYGRRKR |
| Ga0310037_100298264 | 3300030494 | Peatlands Soil | MLIGVAVVAVGMHGYNGPGAMVITLAVPALIVLILVGVYGRRKR |
| Ga0265460_130044582 | 3300030740 | Soil | VLAVGMHGYNGPGALGITIAIPVILVLILVAMYGRKKR |
| Ga0265459_140963911 | 3300030741 | Soil | MGVAVVAMMGHGYNGPGAMVITIAVPVLLVLILVAVYGRKKR |
| Ga0318516_107205961 | 3300031543 | Soil | MLIGVAVGVHDYTGPGASVITLGIIVLIVLILIGAYARGNR |
| Ga0318534_105597172 | 3300031544 | Soil | MLIGVAVGVHDYTGPGASAITLGIIVLIVLILIGAYARGNR |
| Ga0318528_102316703 | 3300031561 | Soil | MLIGVAVGIHDYTGPGASAITLGIIVLIVLILIGAYAR |
| Ga0318573_101161502 | 3300031564 | Soil | MLIGVAVGIHDYTGPGASAITLGIIVLIVLILIGAYARGNR |
| Ga0310686_1175295151 | 3300031708 | Soil | MLIGVAVVALGHGYNGPGALVITLAVPALIVLILVAVYGRRKR |
| Ga0307474_107538012 | 3300031718 | Hardwood Forest Soil | MLIGIAVVAMGHDYNGPGASAITLGIVALIVLILAGMYGRKSR |
| Ga0318502_109753871 | 3300031747 | Soil | SKVMLIGVAVGIHDYTGPGAPAITLGIIVLIVLILIGAYARGNR |
| Ga0318498_103589981 | 3300031778 | Soil | MLIGVAVGIHDYTGPGAPAITLGIIVLIVLILIGAYARGNR |
| Ga0306923_104324511 | 3300031910 | Soil | AVGVHDYTGPGASAITLGIIVLIVLILIGAYARGNR |
| Ga0306923_109102921 | 3300031910 | Soil | MLIGVAVGVHDYTGPGASAITLGIIALIVLILIGAYVRGNR |
| Ga0306923_110897691 | 3300031910 | Soil | MLNGVAVGVHDYTGPGASAITLGIIALIVLILVTAYVRGNR |
| Ga0318563_101263841 | 3300032009 | Soil | MLIGVAVGIHDYTGPGASAITLGIIVLIVLILIGAYA |
| Ga0318556_101656782 | 3300032043 | Soil | HLGRSKVMLIGVAVGVHDYTGPGASAITLGIIVLIVLILIGAYARGNR |
| Ga0318575_104077702 | 3300032055 | Soil | MLIGVAVGVHDYTGPGASAITLGIIALIVLILIGAFRRGNR |
| Ga0318553_101265231 | 3300032068 | Soil | MLIGVAVGIHDYTGPGASAITLGIIVLIVLILIGAY |
| Ga0318553_104627311 | 3300032068 | Soil | GRSKVMLIGVAVGVHDYTGPGASAITLGIIVLIVLILIGAYARGNR |
| Ga0318525_100910001 | 3300032089 | Soil | GVAVGVHDYTGPGASAITLGIIVLIVLILIGAYARGNR |
| Ga0318518_103372291 | 3300032090 | Soil | MLIGVAVGVHDYTGPGASAITLGIIVLIVLILIGA |
| Ga0318577_101675731 | 3300032091 | Soil | VAVGIHDYTGPGASAITLGIIVLIVLILIGAYARGNR |
| Ga0311301_1006209810 | 3300032160 | Peatlands Soil | MLVGVAVGMHGYNGPGAMVITLAVPALIVLILVTVYGRRKR |
| Ga0307471_1005757113 | 3300032180 | Hardwood Forest Soil | MLIGVAVGIHSYNGPGASVFVFGTVALIVLILVVVYRPRKRR |
| Ga0306920_1028348032 | 3300032261 | Soil | RSTVMLNGVAVGVHDYTGPGASAITFGIIALIVLILITAYVRGKGLSA |
| Ga0335085_100846744 | 3300032770 | Soil | MLIGVAVGVHDYTGPGASAITLGIIALIVLILIGVYARGNR |
| Ga0335085_105264582 | 3300032770 | Soil | MPKADRTGPGASAITLGIIALIVLILIGVYARGNR |
| Ga0335085_108856812 | 3300032770 | Soil | MLIGVPVVAVRMHDYTGPYASAITLGIIVLIVLILVGVYSRKNQ |
| Ga0335085_116172911 | 3300032770 | Soil | MLIGVAVGVHDYTGPGASAITLGIIALIVLILIGVYAR |
| Ga0335079_102827363 | 3300032783 | Soil | MPIGAAVVAVGMHGYNGPGAIVITLGVPVLLVLILVGVYGRRSRR |
| Ga0335070_103226801 | 3300032829 | Soil | MLFGVAVGVHDYTGPGASAITIGIIAIVVVILVGAYARGKR |
| Ga0335083_100316886 | 3300032954 | Soil | MLIAAAVVAVGMHGYNGPGAIVITLGVPVLLVLILVGVYGRRNRR |
| Ga0335083_100413155 | 3300032954 | Soil | RSTVMLIGVAVGVHDYTGPGASAITLGIIALIVLILIGVYARGNR |
| Ga0335076_101783913 | 3300032955 | Soil | MQIGAAVVAVGMHGYNGPGAVVITLGVPVLLVLILVGVYSRRSRR |
| Ga0335073_102192253 | 3300033134 | Soil | MLTGTAIVAMGHDYNGPGASAITLGIVGLIVLILAGVYGRKNR |
| Ga0335073_111672042 | 3300033134 | Soil | MLIGNAVVALGHDYNGPGASAITLGIVALIVLILAGVYGRKNR |
| Ga0335077_101214671 | 3300033158 | Soil | MLIGVPVVAVRMHDYTGPYASAITLGIIVLIVLILVGVYSRKN |
| Ga0335077_112773491 | 3300033158 | Soil | MPIGVPVVAVRMHDYTGPYASAITFGIIALIVLILVGVYGRKNR |
| Ga0370515_0132713_825_950 | 3300034163 | Untreated Peat Soil | MLIGVAVGMHGYNGPGALVITIAVPVLIVLILVGVYGRRRR |
| ⦗Top⦘ |