Metagenome / Metatranscriptome Family F074052

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F074052
Family Type	Metagenome / Metatranscriptome
Number of Sequences	120
Average Sequence Length	40 residues
Representative Sequence	MRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS
Number of Associated Samples	104
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	83.33 %
% of genes near scaffold ends (potentially truncated)	21.67 %
% of genes from short scaffolds (< 2000 bps)	84.17 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (54.167 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.667 % of family members)
Environment Ontology (ENVO)	Unclassified (22.500 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (36.667 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF04392	ABC_sub_bind	8.33
PF02705	K_trans	2.50
PF07883	Cupin_2	2.50
PF06983	3-dmu-9_3-mt	1.67
PF13565	HTH_32	1.67
PF00005	ABC_tran	1.67
PF13557	Phenol_MetA_deg	1.67
PF00313	CSD	0.83
PF00561	Abhydrolase_1	0.83
PF08448	PAS_4	0.83
PF13460	NAD_binding_10	0.83
PF13546	DDE_5	0.83
PF00296	Bac_luciferase	0.83
PF14499	DUF4437	0.83
PF01266	DAO	0.83
PF00857	Isochorismatase	0.83
PF09351	DUF1993	0.83
PF01902	Diphthami_syn_2	0.83
PF00723	Glyco_hydro_15	0.83
PF03466	LysR_substrate	0.83
PF10417	1-cysPrx_C	0.83
PF10503	Esterase_PHB	0.83
PF04328	Sel_put	0.83
PF07045	DUF1330	0.83
PF16868	NMT1_3	0.83
PF13545	HTH_Crp_2	0.83
PF13602	ADH_zinc_N_2	0.83
PF01042	Ribonuc_L-PSP	0.83
PF00571	CBS	0.83
PF01242	PTPS	0.83
PF07369	DUF1488	0.83
PF05239	PRC	0.83
PF06186	DUF992	0.83
PF13458	Peripla_BP_6	0.83
PF11854	MtrB_PioB	0.83
PF00072	Response_reg	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	8.33
COG3158	K+ uptake protein Kup	Inorganic ion transport and metabolism [P]	2.50
COG2764	Zn-dependent glyoxalase, PhnB family	Energy production and conversion [C]	1.67
COG3865	Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase	General function prediction only [R]	1.67
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.83
COG0720	6-pyruvoyl-tetrahydropterin synthase	Coenzyme transport and metabolism [H]	0.83
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.83
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.83
COG2102	Diphthamide synthase (EF-2-diphthine--ammonia ligase)	Translation, ribosomal structure and biogenesis [J]	0.83
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.83
COG2879	Uncharacterized short protein YbdD, DUF466 family	Function unknown [S]	0.83
COG3387	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family	Carbohydrate transport and metabolism [G]	0.83
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
All Organisms	root	All Organisms	45.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
cellular organisms	root	All Organisms → cellular organisms	45.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	45.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	30.00 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.83 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	24.17 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.83 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.83 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	15.00 %
Kangiellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Kangiellales	0.83 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.83 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.83 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5.00 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	2.50 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	1.67 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1.67 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.83 %
Kangiellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Kangiellales → Kangiellaceae	0.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	5.00 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	2.50 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	1.67 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	1.67 %
Kangiella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Kangiellales → Kangiellaceae → Kangiella	0.83 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	1.67 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	1.67 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.83 %
Bradyrhizobium japonicum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum	0.83 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.83 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.83 %
Kangiella spongicola	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Kangiellales → Kangiellaceae → Kangiella → Kangiella spongicola	0.83 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.83 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1.67 %
Mesorhizobium sp. LSJC280B00	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC280B00	1.67 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	0.83 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.83 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.83 %
Bradyrhizobium japonicum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum	0.83 %
Kangiella spongicola	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Kangiellales → Kangiellaceae → Kangiella → Kangiella spongicola	0.83 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.83 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459010\|GIO7OMY02IN348	Not Available	507	Open in IMG/M
2170459012\|GOYVCMS02JFIVM	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
2170459023\|GZGNO2B02IQUTG	Not Available	513	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c0319456	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300000816\|AF_2010_repII_A10DRAFT_1005092	Not Available	1362	Open in IMG/M
3300003321\|soilH1_10376235	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Kangiellales → Kangiellaceae → Kangiella → Kangiella spongicola	1243	Open in IMG/M
3300004463\|Ga0063356_100579527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1510	Open in IMG/M
3300004479\|Ga0062595_100648759	Not Available	835	Open in IMG/M
3300004479\|Ga0062595_100807565	Not Available	774	Open in IMG/M
3300004479\|Ga0062595_101919071	Not Available	568	Open in IMG/M
3300004633\|Ga0066395_10755531	Not Available	581	Open in IMG/M
3300005330\|Ga0070690_100149629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1592	Open in IMG/M
3300005332\|Ga0066388_100895306	Not Available	1466	Open in IMG/M
3300005332\|Ga0066388_105910601	All Organisms → cellular organisms → Bacteria → Proteobacteria	618	Open in IMG/M
3300005366\|Ga0070659_100915370	All Organisms → cellular organisms → Bacteria	767	Open in IMG/M
3300005434\|Ga0070709_10307173	All Organisms → cellular organisms → Bacteria	1160	Open in IMG/M
3300005439\|Ga0070711_100451146	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1053	Open in IMG/M
3300005439\|Ga0070711_100658953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	878	Open in IMG/M
3300005440\|Ga0070705_101680521	Not Available	536	Open in IMG/M
3300005526\|Ga0073909_10561670	Not Available	559	Open in IMG/M
3300005713\|Ga0066905_100039195	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2788	Open in IMG/M
3300005764\|Ga0066903_100473861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2106	Open in IMG/M
3300005764\|Ga0066903_102308523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1039	Open in IMG/M
3300005764\|Ga0066903_102659119	All Organisms → cellular organisms → Bacteria → Proteobacteria	970	Open in IMG/M
3300005764\|Ga0066903_107184661	Not Available	576	Open in IMG/M
3300006028\|Ga0070717_10367442	All Organisms → cellular organisms → Bacteria	1289	Open in IMG/M
3300006047\|Ga0075024_100207758	Not Available	920	Open in IMG/M
3300006049\|Ga0075417_10203215	Not Available	938	Open in IMG/M
3300006049\|Ga0075417_10352218	Not Available	721	Open in IMG/M
3300006052\|Ga0075029_101019964	Not Available	572	Open in IMG/M
3300006163\|Ga0070715_10991207	Not Available	523	Open in IMG/M
3300006173\|Ga0070716_100053491	Not Available	2302	Open in IMG/M
3300006175\|Ga0070712_100073364	Not Available	2454	Open in IMG/M
3300006797\|Ga0066659_11631763	Not Available	542	Open in IMG/M
3300006854\|Ga0075425_100375875	All Organisms → cellular organisms → Bacteria	1636	Open in IMG/M
3300006871\|Ga0075434_100026353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5694	Open in IMG/M
3300006903\|Ga0075426_10240562	Not Available	1317	Open in IMG/M
3300006914\|Ga0075436_100667713	Not Available	769	Open in IMG/M
3300007076\|Ga0075435_100902576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	770	Open in IMG/M
3300009036\|Ga0105244_10289746	Not Available	759	Open in IMG/M
3300009100\|Ga0075418_10943879	All Organisms → cellular organisms → Bacteria	933	Open in IMG/M
3300009553\|Ga0105249_10686384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum	1083	Open in IMG/M
3300010360\|Ga0126372_12440057	Not Available	574	Open in IMG/M
3300010366\|Ga0126379_11664992	Not Available	743	Open in IMG/M
3300012180\|Ga0153974_1097341	Not Available	666	Open in IMG/M
3300012198\|Ga0137364_11049936	Not Available	614	Open in IMG/M
3300012208\|Ga0137376_10189923	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC280B00	1775	Open in IMG/M
3300012210\|Ga0137378_10933089	Not Available	781	Open in IMG/M
3300012285\|Ga0137370_10833239	Not Available	572	Open in IMG/M
3300012508\|Ga0157315_1032331	Not Available	621	Open in IMG/M
3300012937\|Ga0162653_100087392	Not Available	515	Open in IMG/M
3300012948\|Ga0126375_11937253	Not Available	519	Open in IMG/M
3300012957\|Ga0164303_10276740	Not Available	976	Open in IMG/M
3300012958\|Ga0164299_10908055	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300012961\|Ga0164302_11399809	Not Available	571	Open in IMG/M
3300012984\|Ga0164309_11205354	Not Available	635	Open in IMG/M
3300013100\|Ga0157373_11432672	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300013296\|Ga0157374_10011048	All Organisms → cellular organisms → Bacteria	7800	Open in IMG/M
3300013307\|Ga0157372_11218056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	870	Open in IMG/M
3300013772\|Ga0120158_10470922	Not Available	561	Open in IMG/M
3300014325\|Ga0163163_11015293	Not Available	893	Open in IMG/M
3300015373\|Ga0132257_100481445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1520	Open in IMG/M
3300015373\|Ga0132257_101690089	Not Available	811	Open in IMG/M
3300015374\|Ga0132255_105269884	Not Available	547	Open in IMG/M
3300016422\|Ga0182039_10003216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8963	Open in IMG/M
3300017937\|Ga0187809_10027908	Not Available	1801	Open in IMG/M
3300017947\|Ga0187785_10000286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	19140	Open in IMG/M
3300018028\|Ga0184608_10522735	Not Available	506	Open in IMG/M
3300018053\|Ga0184626_10110621	Not Available	1165	Open in IMG/M
3300018054\|Ga0184621_10329364	Not Available	537	Open in IMG/M
3300018058\|Ga0187766_10250378	Not Available	1133	Open in IMG/M
3300018072\|Ga0184635_10030791	Not Available	2013	Open in IMG/M
3300018072\|Ga0184635_10203570	Not Available	789	Open in IMG/M
3300019867\|Ga0193704_1064922	Not Available	694	Open in IMG/M
3300019878\|Ga0193715_1033961	All Organisms → cellular organisms → Bacteria → Proteobacteria	1106	Open in IMG/M
3300019879\|Ga0193723_1102697	Not Available	806	Open in IMG/M
3300019888\|Ga0193751_1058574	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1621	Open in IMG/M
3300020069\|Ga0197907_10056841	All Organisms → cellular organisms → Bacteria	670	Open in IMG/M
3300021344\|Ga0193719_10061729	All Organisms → cellular organisms → Bacteria	1627	Open in IMG/M
3300021478\|Ga0210402_10234010	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1694	Open in IMG/M
3300021560\|Ga0126371_13133613	Not Available	559	Open in IMG/M
3300022756\|Ga0222622_10144656	All Organisms → cellular organisms → Bacteria	1526	Open in IMG/M
3300025915\|Ga0207693_10030311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4271	Open in IMG/M
3300025915\|Ga0207693_10174318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	1693	Open in IMG/M
3300025928\|Ga0207700_10101155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2299	Open in IMG/M
3300025933\|Ga0207706_11328745	Not Available	593	Open in IMG/M
3300026538\|Ga0209056_10212665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC280B00	1404	Open in IMG/M
3300027873\|Ga0209814_10083004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1352	Open in IMG/M
3300027874\|Ga0209465_10484627	Not Available	618	Open in IMG/M
3300027894\|Ga0209068_10223018	Not Available	1042	Open in IMG/M
3300028381\|Ga0268264_10622468	Not Available	1066	Open in IMG/M
3300028717\|Ga0307298_10169161	Not Available	638	Open in IMG/M
3300028720\|Ga0307317_10117650	Not Available	886	Open in IMG/M
3300028799\|Ga0307284_10076241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1223	Open in IMG/M
3300028799\|Ga0307284_10174214	Not Available	838	Open in IMG/M
3300028807\|Ga0307305_10065259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1679	Open in IMG/M
3300028811\|Ga0307292_10140789	Not Available	970	Open in IMG/M
3300028819\|Ga0307296_10151662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	1252	Open in IMG/M
3300028885\|Ga0307304_10217268	All Organisms → cellular organisms → Bacteria → Proteobacteria	823	Open in IMG/M
3300029636\|Ga0222749_10242689	All Organisms → cellular organisms → Bacteria → Proteobacteria	914	Open in IMG/M
3300030844\|Ga0075377_11659737	Not Available	1156	Open in IMG/M
3300031128\|Ga0170823_10659907	All Organisms → cellular organisms → Bacteria → Proteobacteria	771	Open in IMG/M
3300031170\|Ga0307498_10000026	All Organisms → cellular organisms → Bacteria	14498	Open in IMG/M
3300031170\|Ga0307498_10000343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5902	Open in IMG/M
3300031226\|Ga0307497_10423047	Not Available	641	Open in IMG/M
3300031249\|Ga0265339_10011089	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	5565	Open in IMG/M
3300031249\|Ga0265339_10042492	Not Available	2517	Open in IMG/M
3300031474\|Ga0170818_109755737	Not Available	1002	Open in IMG/M
3300031474\|Ga0170818_112142520	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300031546\|Ga0318538_10607726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	593	Open in IMG/M
3300031652\|Ga0315553_10043267	All Organisms → cellular organisms → Bacteria	2587	Open in IMG/M
3300031720\|Ga0307469_10203876	Not Available	1548	Open in IMG/M
3300031821\|Ga0318567_10633109	Not Available	607	Open in IMG/M
3300031858\|Ga0310892_11211559	Not Available	538	Open in IMG/M
3300032000\|Ga0310903_10543906	Not Available	612	Open in IMG/M
3300032076\|Ga0306924_10466044	All Organisms → cellular organisms → Bacteria	1442	Open in IMG/M
3300033433\|Ga0326726_10013268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	7220	Open in IMG/M
3300033433\|Ga0326726_10122896	Not Available	2345	Open in IMG/M
3300033758\|Ga0314868_004369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	1290	Open in IMG/M
3300034090\|Ga0326723_0021388	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2642	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	78.33%
Host-Associated	Host-Associated	21.67%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	69.17%
Plants	Host-Associated → Plants	20.83%
Aquatic	Environmental → Aquatic	9.17%
Fungi	Host-Associated → Fungi	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	65.83%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.00%
Sediment	Environmental → Aquatic → Sediment	7.50%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.00%
Peat	Environmental → Terrestrial → Peat	2.50%
Freshwater	Environmental → Aquatic → Freshwater	0.83%
Marine	Environmental → Aquatic → Marine	0.83%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.83%
Roots	Host-Associated → Plants → Roots	0.83%
Mycelium	Host-Associated → Fungi → Mycelium	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.83%
Loam	Environmental → Terrestrial → Soil → Loam	17.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.50%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.33%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.50%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.50%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.50%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.83%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.83%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.83%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.83%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.83%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.67%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.00%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	10.00%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.50%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.50%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.17%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.33%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.50%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.50%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.67%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.83%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.83%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.83%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.83%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.83%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	16.67%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	9.17%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	7.50%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.50%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.17%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.33%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.33%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	3.33%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.50%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	2.50%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.50%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	1.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.67%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.67%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.83%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	0.83%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.83%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.83%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.83%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.83%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.83%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.83%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.83%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.83%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.83%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.83%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.83%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459010	Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)	Environmental	Open in IMG/M
2170459012	Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass	Environmental	Open in IMG/M
2170459023	Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)	Environmental	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000816	Forest soil microbial communities from Amazon forest - 2010 replicate II A10	Environmental	Open in IMG/M
3300003321	Sugarcane bulk soil Sample H1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300012180	Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG	Host-Associated	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012508	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510	Host-Associated	Open in IMG/M
3300012937	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017937	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300019867	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1	Environmental	Open in IMG/M
3300019878	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028717	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158	Environmental	Open in IMG/M
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental	Open in IMG/M
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental	Open in IMG/M
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030844	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Host-Associated	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental	Open in IMG/M
3300031652	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031821	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033758	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F62_08175150	2170459010	Grass Soil	MRKVLGFILIAFTFVAGTAAFVTVNPHQAFACEDGDKRGS
N56_07876840	2170459012	Grass Soil	KVLGFILIAFTFVAGTAAFVTVNPHQAFACEDGDKRGS
FA3_00058910	2170459023	Grass Soil	MRKVVGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS
ICChiseqgaiiDRAFT_03194562	3300000033	Soil	MRMRKVLGFILIAFSLVAGTGAFVTVNPHQAFACEDGDKRGS*
AF_2010_repII_A10DRAFT_10050924	3300000816	Forest Soil	MRKALRFIVIAFALVAGTAAFVTVNPHQAFACEDGDHKGS*
soilH1_103762351	3300003321	Sugarcane Root And Bulk Soil	MRKVLGFIVIALALVAGTAAAVTVSPQQAFACDGDHRGS*
Ga0063356_1005795271	3300004463	Arabidopsis Thaliana Rhizosphere	MRMRKVLGFIVIAFALVAGAAASVTVSQHQAFACEDGDHKGS*
Ga0062595_1006487591	3300004479	Soil	MRKVLGFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGS*
Ga0062595_1008075652	3300004479	Soil	MRKVLGFILIAFALVAGTGTFVTVNPHQAFACDDGDKRGS*
Ga0062595_1019190711	3300004479	Soil	MRMKKVLGFILIAFAVVAGTGAFVTVNPQQAFACEDGDKRGS*
Ga0066395_107555311	3300004633	Tropical Forest Soil	MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS*
Ga0070690_1001496291	3300005330	Switchgrass Rhizosphere	MRKVLGFILIAFTLVAGTAAFVTVNPHQAFGCEDGDKRGS*
Ga0066388_1008953062	3300005332	Tropical Forest Soil	MRKVLGYFLIAFALVAGTAAFVTVNPHQAFACEDGDKRGS*
Ga0066388_1059106012	3300005332	Tropical Forest Soil	MRKVLGFILIAFALVAGTAAFVTVNPHHAFACEDGDKRGS*
Ga0070659_1009153702	3300005366	Corn Rhizosphere	MRKVLGFIVIALALVAGSAAAVTVSPQQAFACDGDHRGS*
Ga0070709_103071731	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MRKVLGFILIAFTLVAGTAAFVTVNPHQAFSCEDGDKRSS*
Ga0070711_1004511461	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	RMRKVLGFILIAFALVAGTSAFVTVNSHQAFACEDGDKRGS*
Ga0070711_1006589531	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MRMRKALRFALIAFALAAGTAAFVTVNPHQAFACEDGDKRGS*
Ga0070705_1016805211	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MRMRKVLGFILIAFTLVAGTAAFVTVNPHQAFSCEDGDKRSA*
Ga0073909_105616701	3300005526	Surface Soil	DMRMRKVLGFILIALALVAGTGAFVTVNLHQAFACDGDKRGS*
Ga0066905_1000391952	3300005713	Tropical Forest Soil	MRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS*
Ga0066903_1004738611	3300005764	Tropical Forest Soil	MRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGHKRGS*
Ga0066903_1023085231	3300005764	Tropical Forest Soil	MRMRKVLGFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGS*
Ga0066903_1026591191	3300005764	Tropical Forest Soil	GFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGS*
Ga0066903_1071846612	3300005764	Tropical Forest Soil	LGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS*
Ga0070717_103674422	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MRKVLGFILIAFALVAGTAAFVTVNPHQAFSCEDGDKRSS*
Ga0075024_1002077583	3300006047	Watersheds	MRKVLGFILIAFALVAGTATFVTVNPHQAFACEDGDKRGS*
Ga0075417_102032151	3300006049	Populus Rhizosphere	MRKVLGFILIAFSLVAGTGAFVTVNPHQAFACEDGDKRGS*
Ga0075417_103522181	3300006049	Populus Rhizosphere	MRKVLGFILIAFALVAGMGAFVTVNPHQAFACDDGDKRGS*
Ga0075029_1010199643	3300006052	Watersheds	MQMRKVLGFIVIAFALVAGTAAFVTVNPHQAFACEDGDKRGS*
Ga0070715_109912071	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MRKVLGFILIAFTLVAGTAAFVTVNPHQAFACEDGDNRGS*
Ga0070716_1000534911	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MRMRKVLGFILIAFTLVAGTAAFVTVNPHQAFSCEDGDKRSS*
Ga0070712_1000733641	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDNRGS*
Ga0066659_116317631	3300006797	Soil	MRKVLGFILIAFALVDGSAAFVTVNPHQAFACEDGDNRGS*
Ga0075425_1003758752	3300006854	Populus Rhizosphere	MRMRKVLGFILIAFALVAGTGAFITVNPHQAFACDDGDKRGS*
Ga0075434_1000263531	3300006871	Populus Rhizosphere	MRKVLGFILIAFALVAGMGTFVTVNPHQAFACDDGDKRGS*
Ga0075426_102405623	3300006903	Populus Rhizosphere	MRMRKVLGFILIAFAVVAGTGAFVTVNPQQAFACEDGDKRGS*
Ga0075436_1006677131	3300006914	Populus Rhizosphere	MRMRKVLGFILIAFTLVAGTAAFVTVNPHQAFGCEDGDKRGS*
Ga0075435_1009025761	3300007076	Populus Rhizosphere	MRKVLGFILIAFAVVAGTGAFVTVNPQQAFACEDGDK
Ga0105244_102897462	3300009036	Miscanthus Rhizosphere	MRKVLGFILIAFTLVAGTAAFVTVNPHQAFSCEDGDKRGS*
Ga0075418_109438793	3300009100	Populus Rhizosphere	MRMRKVLGFILIAFALVAGMGTFVTVNPHQAFACDDGDKRGS*
Ga0105249_106863843	3300009553	Switchgrass Rhizosphere	MRMRKVLGFILIAFALVAGTSAFVTVNSHQAFACEDGDKRGS*
Ga0126372_124400572	3300010360	Tropical Forest Soil	MRMRKVLGFILIAFALVAGTGAFVTVNSHQAFACED
Ga0126379_116649922	3300010366	Tropical Forest Soil	MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACE
Ga0153974_10973411	3300012180	Attine Ant Fungus Gardens	MRMRKVLGFILIAFALVVGTAAFVTVNPHQAFACEDGDNRGS*
Ga0137364_110499361	3300012198	Vadose Zone Soil	MRMRKILGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS*
Ga0137376_101899232	3300012208	Vadose Zone Soil	MRMRKVLGFILIAFALVAGTTAFVTVNPHQAFACEDGDNHGS*
Ga0137378_109330892	3300012210	Vadose Zone Soil	MRMRKVLGFILIAFALVAGTVAFVTVNPHQAFACEDGDNRGS*
Ga0137370_108332392	3300012285	Vadose Zone Soil	MRMRKILGFILIAFALVAGTAAFVTVNPHQAFACEDGDNRGS*
Ga0157315_10323311	3300012508	Arabidopsis Rhizosphere	MRKVLGFILIAFALVAATGAFLTVNSHQAFACEDGDKRGS*
Ga0162653_1000873921	3300012937	Soil	MRMRKVLGFILIAFALVAGTGAFVTVNPHQAFACEDGDKRGS*
Ga0126375_119372532	3300012948	Tropical Forest Soil	MRMRKVLGFILIAFALVAGTAAFVTVNPHHALACEDGDKRGS*
Ga0164303_102767402	3300012957	Soil	MRMRKVLGFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGA*
Ga0164299_109080552	3300012958	Soil	MRKVLGFIVIALALVAGTAAAVTVNPQQAFACDGDHRGS*
Ga0164302_113998092	3300012961	Soil	MRMRKVLGFILIAFTLVAGPAAFLTVNPHQAFSCEDGDKRGS*
Ga0164309_112053542	3300012984	Soil	MRMRKVFGFILIAFTLVAGTAAFVTANPHQAFGCEDGDKRGS*
Ga0157373_114326721	3300013100	Corn Rhizosphere	GFIVIALALVAGTAAAVTVNPQQAFACDGDHRGS*
Ga0157374_100110482	3300013296	Miscanthus Rhizosphere	MRKVLGFILIAFALVAGTSAFVTVNSHQAFACEDGDKRGS*
Ga0157372_112180561	3300013307	Corn Rhizosphere	GRRMRKVLGFIVIALALVAGTAAAVTVSPQQAFACDGDHRGS*
Ga0120158_104709222	3300013772	Permafrost	MQMRKVLGFIVIAFALVAGTAAFVTVNPHQAFACDGDHRGS*
Ga0163163_110152931	3300014325	Switchgrass Rhizosphere	KVLGFILIAFTLVAGTAAFVTVNPHQAFGCEDGDKRGS*
Ga0132257_1004814452	3300015373	Arabidopsis Rhizosphere	MRKVLGFILIASALVAGTATFVTVNPHQAAACEDGDKRGS*
Ga0132257_1016900892	3300015373	Arabidopsis Rhizosphere	MRMRKVLGFILIAFAVVAGTGAFLAANPQQAFACEDGDKRGS*
Ga0132255_1052698842	3300015374	Arabidopsis Rhizosphere	MRMRKVLGFILIAFALVAATGAFVTVNSHQAFACEDGDKRGS*
Ga0182039_1000321611	3300016422	Soil	MRKALRFIVIAFALVAGTAAFVTDHPDLGFAYEDGDHKGA
Ga0187809_100279083	3300017937	Freshwater Sediment	VGKVIGLIMITFALVVGAAAFVSVAPQQAFACDGNHQGS
Ga0187785_1000028614	3300017947	Tropical Peatland	MRKALGFIVIAFALVAGTATFMSVSPHQAFACEDGDKRGS
Ga0184608_105227352	3300018028	Groundwater Sediment	MRMRKVLGFILIAFAIVAGTTAFVTVNPHQAFACEDGDKRGS
Ga0184626_101106211	3300018053	Groundwater Sediment	MRKVLGFILIAFALVAGTGAFVTVNPHQAFACEDGDKRGS
Ga0184621_103293641	3300018054	Groundwater Sediment	MRMRKILGFILIAFAIVAGTTAFVTVNPHQAFACEDGDKRGS
Ga0187766_102503783	3300018058	Tropical Peatland	MRMRKALGFIVIAFALVAGTATFMSVSPHQAFACEDGDKRGS
Ga0184635_100307913	3300018072	Groundwater Sediment	MRKVLGFFLIAFALVAGTGAFVTVNPHQAFACEDGDKRGS
Ga0184635_102035701	3300018072	Groundwater Sediment	MRMRKIIGFILIAFAIVAGTAACVTVNPHQAFACEDGDKRGS
Ga0193704_10649221	3300019867	Soil	MRMRKVLGFILIAFALVAGTAVFVTVNPHQAFACEDGDKRGS
Ga0193715_10339612	3300019878	Soil	MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACENGDKRGS
Ga0193723_11026972	3300019879	Soil	MRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS
Ga0193751_10585742	3300019888	Soil	MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDNRGS
Ga0197907_100568411	3300020069	Corn, Switchgrass And Miscanthus Rhizosphere	MRKVLGFIVIALALVAGTAAAVTVSPQQAFACDGDHRGS
Ga0193719_100617292	3300021344	Soil	MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS
Ga0210402_102340103	3300021478	Soil	MRKVLGFILIAFTLVAGTAAFVTVNPHQAFACEDGDNRGS
Ga0126371_131336132	3300021560	Tropical Forest Soil	MRKALRFIVITFALVAAGTAAFVTVNPHQAFACEDGDH
Ga0222622_101446561	3300022756	Groundwater Sediment	MRKVLGFILIAFTLVAGTAAFVTVNPHQAFACEDGDKRGS
Ga0207693_100303113	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDNRGS
Ga0207693_101743183	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MRKVLGFILIAFALVAGTSAFVTVNSHQAFACEDGD
Ga0207700_101011551	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	RKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDNRGS
Ga0207706_113287451	3300025933	Corn Rhizosphere	MRKVLGFILIAFTLVAGTAAFVTVNPHQAFGCEDG
Ga0209056_102126651	3300026538	Soil	MRKVLGFILIAFALVAGTTAFVTVNPHQAFACEDGDNHGS
Ga0209814_100830041	3300027873	Populus Rhizosphere	MRKVLGFILIAFALVAGMGAFVTVNPHQAFACDDGDKRGS
Ga0209465_104846272	3300027874	Tropical Forest Soil	MRMRKVLGFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGS
Ga0209068_102230183	3300027894	Watersheds	MRMRKVLGFILIAFALVAGTATFVTVNPHQAFACEDGDKRGS
Ga0268264_106224684	3300028381	Switchgrass Rhizosphere	GFILIAFAVVAGSGAFVTVNPQQAFACEDGDKRGS
Ga0307298_101691612	3300028717	Soil	MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDIRGS
Ga0307317_101176504	3300028720	Soil	MRKVLGFILIAFALVAGTAAFVTVNPHQAFACENGD
Ga0307284_100762412	3300028799	Soil	MRMRKILGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS
Ga0307284_101742141	3300028799	Soil	VLGFILIAFALVAGTAAFVTVNPHQAFACENGDKRGS
Ga0307305_100652593	3300028807	Soil	MRMRKILGFILIAFALVAGTAVFVTVNPHQAFACEDGDKRGS
Ga0307292_101407891	3300028811	Soil	MRKVLGFILIAFALVAGTAAFVTVNPHQAFACENGDKRGS
Ga0307296_101516621	3300028819	Soil	VLGFILIAFALVAGTGAFVTVNPHQAFACEDGDKRGS
Ga0307304_102172683	3300028885	Soil	CSLGDMRMRKILGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS
Ga0222749_102426891	3300029636	Soil	MRMRKVLGFILIAFALVVGTAAFVTVNPHQAFACEDGDNRGS
Ga0075377_116597372	3300030844	Soil	MRMRKVLGFILIAFALVAGTAAFVTVNPHQVFACEDGDKRGS
Ga0170823_106599071	3300031128	Forest Soil	RMRKVLGFILIAFALVAGTVAFVTVNPHQAFACEDGDNHGS
Ga0307498_1000002617	3300031170	Soil	MRKVLGFILIAFALVGGTAALVTVNPHQVFACEDGDKRGS
Ga0307498_100003436	3300031170	Soil	MRKVLGFILIAFALVAGTTAFVTVNPHQAFACEDGDKRGS
Ga0307497_104230472	3300031226	Soil	MRMRKVLGFILIAFTFVAGTAAFVTVNPHQAFACEDGDKRGS
Ga0265339_100110891	3300031249	Rhizosphere	MRKVIGLIVITFALVAGAAAFVSATPQQAFACDGDHRGS
Ga0265339_100424923	3300031249	Rhizosphere	MRKVIGLIVITFALVAGAAAFVSVTPQQAFACDGDHRGS
Ga0170818_1097557371	3300031474	Forest Soil	MRMRKVLGFILIAFTFVAGTAAFVTVNPHQAFACEDGDNHGS
Ga0170818_1121425201	3300031474	Forest Soil	LRFALIAFALASGTAAFVTVNPHQAFACEDGDKRGS
Ga0318538_106077261	3300031546	Soil	MRKALRFIVIAFALVAGTAAFVTVNPHQAFACEDGDHK
Ga0315553_100432673	3300031652	Salt Marsh Sediment	MRKVLGFIVIAIALVAGTAAVVTVSPHQAFACEDGDYRGS
Ga0307469_102038763	3300031720	Hardwood Forest Soil	MRKVLGFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGS
Ga0318567_106331092	3300031821	Soil	MRKALRFIVIAFALVAGTAAFVTVNPHQAFACEDGDRAP
Ga0310892_112115591	3300031858	Soil	MRMRKVLGFILIAFALVAGMGAFVTVNSHQAFACEDGDKRGS
Ga0310903_105439061	3300032000	Soil	MRMRKVLGFILIAFTLVAGTAAFVTVNPHQAFGCEDGDKRGS
Ga0306924_104660441	3300032076	Soil	MRMRKALRFIVIAFALVAGTAAFVTVNPHQAFACEDGD
Ga0326726_100132688	3300033433	Peat Soil	MRKVLGFILVAFALFAGTAAFVTVNPHQVFACEDGDKRGS
Ga0326726_101228964	3300033433	Peat Soil	MRKVLGFILIAFALVAGTATFVTVNPHQAFACEDGDKRGS
Ga0314868_004369_413_535	3300033758	Peatland	MRKVVGFIVIACTLVAGAAAFVTVNPHQAFACEDGDKRGS
Ga0326723_0021388_188_316	3300034090	Peat Soil	MRMRKVLGFILVAFALFAGTAAFVTVNPHQVFACEDGDKRGS

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F074052

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences