NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F074000

Metagenome Family F074000

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074000
Family Type Metagenome
Number of Sequences 120
Average Sequence Length 50 residues
Representative Sequence IAPAFNYEPTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTPK
Number of Associated Samples 111
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.50 %
% of genes from short scaffolds (< 2000 bps) 91.67 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.333 % of family members)
Environment Ontology (ENVO) Unclassified
(45.833 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 32.47%    Coil/Unstructured: 67.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF00072Response_reg 44.17
PF00158Sigma54_activat 25.00
PF02954HTH_8 6.67
PF07238PilZ 1.67
PF01596Methyltransf_3 1.67
PF05402PqqD 0.83
PF00496SBP_bac_5 0.83
PF07920DUF1684 0.83
PF13683rve_3 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 1.67
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 1.67
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 1.67
COG3358Uncharacterized conserved protein, DUF1684 familyFunction unknown [S] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.50 %
UnclassifiedrootN/A22.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000953|JGI11615J12901_10358522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1140Open in IMG/M
3300001116|JGI12627J13344_100880All Organisms → cellular organisms → Bacteria4588Open in IMG/M
3300001867|JGI12627J18819_10030038All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2246Open in IMG/M
3300004114|Ga0062593_101940371All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8652Open in IMG/M
3300004643|Ga0062591_100587873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium980Open in IMG/M
3300005093|Ga0062594_103286543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300005354|Ga0070675_101633205Not Available595Open in IMG/M
3300005355|Ga0070671_100943707All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300005356|Ga0070674_100102444Not Available2088Open in IMG/M
3300005366|Ga0070659_101171803Not Available679Open in IMG/M
3300005440|Ga0070705_100949747All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300005440|Ga0070705_101140845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300005444|Ga0070694_101902702Not Available508Open in IMG/M
3300005458|Ga0070681_11734474Not Available551Open in IMG/M
3300005458|Ga0070681_11833514All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300005536|Ga0070697_101438526All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300005545|Ga0070695_101491319All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300005546|Ga0070696_101542339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300005615|Ga0070702_100591300Not Available830Open in IMG/M
3300005615|Ga0070702_101388537All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300005618|Ga0068864_101146878All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300005842|Ga0068858_100728398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium966Open in IMG/M
3300005843|Ga0068860_101661992All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium660Open in IMG/M
3300005844|Ga0068862_100634029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1029Open in IMG/M
3300006169|Ga0082029_1102945All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300006237|Ga0097621_102208748Not Available526Open in IMG/M
3300006358|Ga0068871_102000164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300006804|Ga0079221_10393155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300006852|Ga0075433_11660022Not Available551Open in IMG/M
3300006854|Ga0075425_102282945All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300006871|Ga0075434_102016128All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300006876|Ga0079217_10677923Not Available688Open in IMG/M
3300006914|Ga0075436_100018068All Organisms → cellular organisms → Bacteria4829Open in IMG/M
3300006914|Ga0075436_100420474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium970Open in IMG/M
3300006954|Ga0079219_10117651All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1346Open in IMG/M
3300007004|Ga0079218_13783649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300009089|Ga0099828_10574887All Organisms → cellular organisms → Bacteria → Acidobacteria1015Open in IMG/M
3300009090|Ga0099827_10382420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1201Open in IMG/M
3300009137|Ga0066709_100254688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2353Open in IMG/M
3300009147|Ga0114129_10983856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1063Open in IMG/M
3300009147|Ga0114129_11662365Not Available780Open in IMG/M
3300009148|Ga0105243_12598860All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300009174|Ga0105241_10769164All Organisms → cellular organisms → Bacteria → Acidobacteria884Open in IMG/M
3300009553|Ga0105249_10095242All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2791Open in IMG/M
3300009553|Ga0105249_10270928Not Available1691Open in IMG/M
3300010042|Ga0126314_10046292All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2804Open in IMG/M
3300010046|Ga0126384_12148647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300010358|Ga0126370_11733451Not Available602Open in IMG/M
3300010373|Ga0134128_11250980All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300010375|Ga0105239_13407761All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300010397|Ga0134124_13164964Not Available504Open in IMG/M
3300010399|Ga0134127_10571145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1155Open in IMG/M
3300010400|Ga0134122_10265046All Organisms → cellular organisms → Bacteria → Acidobacteria1458Open in IMG/M
3300011271|Ga0137393_10550752All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300011444|Ga0137463_1242957Not Available672Open in IMG/M
3300012200|Ga0137382_11143261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300012201|Ga0137365_10497234All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium896Open in IMG/M
3300012204|Ga0137374_10139966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2184Open in IMG/M
3300012211|Ga0137377_10584818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1054Open in IMG/M
3300012212|Ga0150985_114912959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300012354|Ga0137366_11182759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300012355|Ga0137369_10523211All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300012358|Ga0137368_10428322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300012360|Ga0137375_11436081All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300012362|Ga0137361_10487081All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1132Open in IMG/M
3300012362|Ga0137361_10907470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300012509|Ga0157334_1081339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300012899|Ga0157299_10244213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300012906|Ga0157295_10317739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300012925|Ga0137419_11862203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300012930|Ga0137407_10872544All Organisms → cellular organisms → Bacteria → Acidobacteria851Open in IMG/M
3300012948|Ga0126375_10698262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium789Open in IMG/M
3300012960|Ga0164301_11825615All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300012985|Ga0164308_11965793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300013100|Ga0157373_10866886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300013102|Ga0157371_10725697Not Available745Open in IMG/M
3300013294|Ga0120150_1030958Not Available1064Open in IMG/M
3300013308|Ga0157375_10972409All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium990Open in IMG/M
3300014150|Ga0134081_10363518Not Available534Open in IMG/M
3300014263|Ga0075324_1123362All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300014326|Ga0157380_12941380Not Available542Open in IMG/M
3300015197|Ga0167638_1107649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300015245|Ga0137409_11508866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300015262|Ga0182007_10203256Not Available693Open in IMG/M
3300015374|Ga0132255_105982469Not Available515Open in IMG/M
3300018054|Ga0184621_10121841All Organisms → cellular organisms → Bacteria → Proteobacteria932Open in IMG/M
3300018061|Ga0184619_10403620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300018476|Ga0190274_10053927All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2927Open in IMG/M
3300019360|Ga0187894_10519396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300019886|Ga0193727_1137954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300021090|Ga0210377_10342370Not Available904Open in IMG/M
3300025885|Ga0207653_10107221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium994Open in IMG/M
3300025893|Ga0207682_10195913All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium927Open in IMG/M
3300025910|Ga0207684_10968189All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300025910|Ga0207684_11179877All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300025918|Ga0207662_11342270All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia508Open in IMG/M
3300025936|Ga0207670_10406861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1089Open in IMG/M
3300025936|Ga0207670_11395426All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300025937|Ga0207669_11889888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300025942|Ga0207689_10749976Not Available824Open in IMG/M
3300025949|Ga0207667_11411399Not Available670Open in IMG/M
3300025971|Ga0210102_1038977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1027Open in IMG/M
3300026088|Ga0207641_11594152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300026095|Ga0207676_10468632All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1191Open in IMG/M
3300026118|Ga0207675_101408837All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300026142|Ga0207698_10142268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2069Open in IMG/M
3300026377|Ga0257171_1057435All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia677Open in IMG/M
3300026538|Ga0209056_10215515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1391Open in IMG/M
3300026806|Ga0207546_104948All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata512Open in IMG/M
3300027840|Ga0209683_10329050Not Available703Open in IMG/M
3300027907|Ga0207428_10138936Not Available1856Open in IMG/M
3300027909|Ga0209382_11642669All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300028381|Ga0268264_12540122All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300031548|Ga0307408_102271662All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300031847|Ga0310907_10312856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M
3300031903|Ga0307407_10174104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1420Open in IMG/M
3300031913|Ga0310891_10246138All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300032421|Ga0310812_10063721Not Available1451Open in IMG/M
3300033412|Ga0310810_10376113Not Available1480Open in IMG/M
3300034165|Ga0364942_0219963All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia620Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.50%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.67%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.67%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.83%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.83%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.83%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.83%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.83%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.83%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.83%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001116Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013294Permafrost microbial communities from Nunavut, Canada - A3_65cm_0MEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025971Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026806Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11615J12901_1035852213300000953SoilNGSGAPIINYESTGLNTDISMRENEPVIVGTLNVGPSGDAIILVMTARRSSR*
JGI12627J13344_10088043300001116Forest SoilIAANGAVAPTFNYENTGVATDISMRESEPVIVGTLNVGPSGDAIILVVSAKRTQR*
JGI12627J18819_1003003833300001867Forest SoilAANGAVAPTFNYENTGVATDISMRESEPVIVGTLNVGPSGDAIILVVSAKRTQR*
Ga0062593_10194037123300004114SoilNGAVAPTINYERTGVATDVSMHEGEPVIVGTLNIGPSGDAIILVVSAKRTPK*
Ga0062591_10058787313300004643SoilGFPVINYDNTGLNTDISLREGEPVVVGTLNAGPSGDAIILVVSAKRTNR*
Ga0062594_10328654323300005093SoilFNYEQTGVSTDISMREGEPVIVGTLNIGPSGDAIILVVSAKRTTK*
Ga0070675_10163320513300005354Miscanthus RhizosphereSTGLNTDISMREAEPVVVGTLNIGPSGDAIILVMSVRTTAR*
Ga0070671_10094370723300005355Switchgrass RhizosphereSGGVPATNYEPTGLATDISIREGEPVIVGTLNVGPSGDAIILVVSAKRTSR*
Ga0070674_10010244423300005356Miscanthus RhizosphereTGLSTDISVREGEPVIVGTLNVGPSGDAIILVVAAKRTQR*
Ga0070659_10117180313300005366Corn RhizospherePPIFNYEGASLSTDISMREGEPVIVGTLNVGPSGDAIILVLSAKRTAK*
Ga0070705_10094974723300005440Corn, Switchgrass And Miscanthus RhizosphereNYEGTGLATDISMREGDPVVVGTLNVGPSGDAIILVVSAKRTQK*
Ga0070705_10114084523300005440Corn, Switchgrass And Miscanthus RhizosphereAVAANGEVRPSINYEQTGLGTDVSMREGEPVVVGTLNVGPSGDAIILVVSAKRAQK*
Ga0070694_10190270213300005444Corn, Switchgrass And Miscanthus RhizospherePAVNYENTGVATDISIREAEPVIVGTLNVGPSGDAIILVVSAKRTSR*
Ga0070681_1173447423300005458Corn RhizosphereAQNGPQTAPIINYESTGLNTDISMREGEPVIVGTLNVGPSGDAIILVMTARRTPR*
Ga0070681_1183351413300005458Corn RhizosphereGAVAPIINYENTGVSTDISMRESEPVIVGTLNIGPSNDAIILVVTAKRAK*
Ga0070697_10143852623300005536Corn, Switchgrass And Miscanthus RhizosphereENTGISTDVSMREAEPVIVGTLNIGPSGDAIILVVSAKRTLK*
Ga0070695_10149131923300005545Corn, Switchgrass And Miscanthus RhizospherePSINYEQTGLGTDVSMREGEPVVVGTLNVGPSGDAIILVVSAKRAQR*
Ga0070696_10154233923300005546Corn, Switchgrass And Miscanthus RhizosphereQTGAVASTSATAPVFNYESTGLNTDISMREGELVVVGTLHVGPSGDAIILVMSAKRSNK*
Ga0070702_10059130013300005615Corn, Switchgrass And Miscanthus RhizospherePVINYDNTGLNTDISLREGEPVVVGTLNAGPSGDAIILVVSAKRTNR*
Ga0070702_10138853723300005615Corn, Switchgrass And Miscanthus RhizosphereAVAANGEVRPSINYEQTGLGTDVSMREGEPVVVGTLNVGPSGDAIILVVSAKRAQR*
Ga0068864_10114687813300005618Switchgrass RhizosphereVNNPMAAAGAMPPAFNYEQTGVSTDISMHEGEPVIVGTLNIGPSGDAIILVVSAKRTSK*
Ga0068858_10072839813300005842Switchgrass RhizosphereAPAFNYEPTGLSTDISMREAEPVIVGTLNVGPSGDAIILVVSARRTQK*
Ga0068860_10166199213300005843Switchgrass RhizosphereVTHENTGLATDISMRESDPVIVGTLNVGPSGDAIILVVAAKRAQR*
Ga0068862_10063402913300005844Switchgrass RhizosphereAAINYENTGLSTDISIREGEPVVVGTLNVGPSGDAIILVVAAKRTGR*
Ga0082029_110294513300006169Termite NestNYENTGLSTDISMRESEPVIVGTMNIGPSGDAIILVVAAKRTQK*
Ga0097621_10220874813300006237Miscanthus RhizospherePAINYENTGLSTDISVREAEPVVVGTLNVGPSGDAIILVVAAKRTQR*
Ga0068871_10200016413300006358Miscanthus RhizosphereIAANGAVAPIINYENTGVSTDISMRESEPVIVGTLNIGPSNDAIILVVAAKRAK*
Ga0079221_1039315513300006804Agricultural SoilTIAPAFNYETTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTSK*
Ga0075433_1166002223300006852Populus RhizosphereLSTDISMRESEPVIVGTLNVGPSGDAIILVVAAKRTQR*
Ga0075425_10228294513300006854Populus RhizospherePTLAANGAIAPAFNYEPTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTGK*
Ga0075434_10201612813300006871Populus RhizosphereYESTGLNTDISMREGEPVVVGTLNIGPSGDAIILVVSAKRTPQ*
Ga0079217_1067792323300006876Agricultural SoilAVASNAPGPPPVFNYEGTSLSTDVSMREGEPAIVGTLNIGPSGDAVILVVSAKRTSK*
Ga0075436_10001806853300006914Populus RhizosphereIAANGAIAPTINYESTGVATDISMREAEPVIVGTLNVGPSGDAIILVVSAKRTSK*
Ga0075436_10042047413300006914Populus RhizospherePLASNSPTPPVFNYENTGLNTDISMREGEPVVVGTLNIGPSGEAIILVVSAKRTMQ*
Ga0079219_1011765113300006954Agricultural SoilETTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTPK*
Ga0079218_1378364913300007004Agricultural SoilGTNLSTDISMREGEPVVVGTLNVGPSGDAIILVVSAKRTTK*
Ga0099828_1057488713300009089Vadose Zone SoilAVASNGTPTPIINYENTGLTTDISMREGEPVVVGTLNVGPSGDAIILVMSAKRAQR*
Ga0099827_1038242023300009090Vadose Zone SoilVVASNAAAAPIFNYEPTGLNTDISMREGEPVVVGTLNVGPSGDAKILVISAKRTSK*
Ga0066709_10025468823300009137Grasslands SoilASAVASNAPAAPIFNYEPTGLNTDISMREGEPVVVGTLNVGPSGDAIILVMSARRTK*
Ga0114129_1098385623300009147Populus RhizosphereANGTVAPTVNYEPTGVSTDISLREAEPVIVGTLNIGPSGDAIILVVSAKRTQR*
Ga0114129_1166236513300009147Populus RhizosphereGGEVRLTTSYEQTGLQTDISMREAEPVIVGTLNVGPSGDAIILVVSARRTQK*
Ga0105243_1259886013300009148Miscanthus RhizosphereAGAMPPAFNYEQTGVSTDISMHEGEPVIVGTLNIGPSGDAIILVVSAKRTTK*
Ga0105241_1076916413300009174Corn RhizosphereGAVASTSTTAPVFNYESTGLNTDISMREGEPVVVGTLHVGPSGDAIILVMSAKRSNK*
Ga0105249_1009524213300009553Switchgrass RhizosphereFPATNYENTGLQTDISIREGEPVIVGTLNVGPSGDAIILVVSSKRTSR*
Ga0105249_1027092823300009553Switchgrass RhizosphereYESTGLNTDISMRENEPVIVGTLNVGPSGDAIILVMTARRSSR*
Ga0126314_1004629213300010042Serpentine SoilTINYEPTGVSTDVSMREGEPVIVGTLNIGPSGDAIILVVSAKRTMK*
Ga0126384_1214864713300010046Tropical Forest SoilAFNYETTGLSTDISMREGEPVIVGTLNVGPSGDAIVLVVSAKRTQK*
Ga0126370_1173345123300010358Tropical Forest SoilLSTDISMREGEPVIVGTLNVGPSGDAIVLVVSAKRTQK*
Ga0134128_1125098023300010373Terrestrial SoilYESTGLNTDISMREGEAVVVGTLNAGPSGDAIILVVSARRSQK*
Ga0105239_1340776113300010375Corn RhizosphereAAVASTSAAPVFNYENTGLATDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTQR*
Ga0134124_1316496413300010397Terrestrial SoilYENTGLSTDISMRESEPVIVGTMNIGPSGDAIILVVAAKRTLK*
Ga0134127_1057114523300010399Terrestrial SoilVNYESTGLNTDFSMREGEATIIGTLNIGPSGDAIILVMSAKTTK*
Ga0134122_1026504633300010400Terrestrial SoilPIINYESTGLNTDISMREGEPVIVGTLNIGPSGDAIILVMSAKRTAK*
Ga0137393_1055075223300011271Vadose Zone SoilSNGPAAPIINYEPTGLNTDISMREGEPVVVGTLNAGPSGDAIILVVSAKRSQR*
Ga0137463_124295713300011444SoilIITASTVASNGPLAPIINYESTGLNSDISMREGEPVVVGTLNIGPSGDAIILVMSGRRTLK*
Ga0137382_1114326113300012200Vadose Zone SoilIINYENTGLNTDISMREGEPVVVGTLNAGPSGDAIILVVSAKRTQK*
Ga0137365_1049723423300012201Vadose Zone SoilGPAAPIINYEPTGLNTDISMREGEPVVVGTLNAGPSGDAIILVVSAKRSQR*
Ga0137374_1013996613300012204Vadose Zone SoilATAPIISYEATGLTTDISMREGEPVVVGTLHVGPSGDAIILVMTAKRAQR*
Ga0137377_1058481823300012211Vadose Zone SoilSTGSPTPIINYESTGLTTDISMREGEAVVVGTLNVGPSGDAIILVVSAKRAMK*
Ga0150985_11491295913300012212Avena Fatua RhizosphereAYEPTGVSTDISMREGEPVIVGTLNIGPSGDAIILVVSAKRTMR*
Ga0137366_1118275913300012354Vadose Zone SoilNSPATAPIISYEATGLTTDISMREGEPVVVGTLHVGPSGDAIILVMTAKRAQR*
Ga0137369_1052321113300012355Vadose Zone SoilTAPIISYEATGLTTDISMREGEPVVVGTLHVGPSGDAIILVMTAKRAQR*
Ga0137368_1042832213300012358Vadose Zone SoilIQTGTALASNSPATAPIISYEATGLTTDISMREGEPVVVGTLHVGPSGDAIILVMTAKRAQR*
Ga0137375_1143608113300012360Vadose Zone SoilPATAPIISYEATGLTTDISMREGEPVVVGTLHVGPSGDAIILVMTAKRTQR*
Ga0137361_1048708113300012362Vadose Zone SoilNAPAAPIFNYESTGLNTDISMREGEPVVVGTLNIGPSGDAIILVVSAKRTGQ*
Ga0137361_1090747013300012362Vadose Zone SoilTGLSTDISMREGEPVVVGTLHVGPSGDAIILVMSAKKSNK*
Ga0157334_108133913300012509SoilAVAPVISYESTGVATDISMREGEPVIVGTLNVSPSGDAIILVVSAKRTSK*
Ga0157299_1024421313300012899SoilEPTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTGK*
Ga0157295_1031773913300012906SoilNGAVAPAVNYEQTGVSTDISMRESEPVIVGTLNVGPSGDAIILVVSAKRTTR*
Ga0137419_1186220323300012925Vadose Zone SoilIINYESTGLNTDISMREGEPVVVGTLNIGPSGDAIILVMSAKRTAK*
Ga0137407_1087254423300012930Vadose Zone SoilQTGAVASTSATAPVFNYETTGLNTDISMREGEPVVVGTLHVGPSGDAIILVMSAKRSRQ*
Ga0126375_1069826213300012948Tropical Forest SoilVINYENTGLNTDISMREGEPVVVGTLNAGPSGDAIVLVVSAKRSSK*
Ga0164301_1182561523300012960SoilGAIAANGAVAPIINYENTGVSTDISIRESEPVIVGTLNIGPSNDAIILVVTAKRAK*
Ga0164308_1196579323300012985SoilGPMAPIINYESTGLNTDISMREGEAVVVGTLNIGPSGDAIILVMSAKSTNR*
Ga0157373_1086688623300013100Corn RhizosphereAANGAVAPVINYEHTGVATDVSMREGEPVIVGTLNIGPSGDAIILVVSAKRTLK*
Ga0157371_1072569713300013102Corn RhizosphereMPPAFNYEQTGVSTDISMREGEPVIVGTLNIGPSGDAIILVVSAKRTTK*
Ga0120150_103095823300013294PermafrostSTVASNGPMAPIINYESTGLNTDISMREAEPVVVGTLNIGPSGEAIILVMSARRTLK*
Ga0157375_1097240923300013308Miscanthus RhizosphereTSMSTATINYETTGLNTDISMREGEPVIVGTLNVGPSGDATILVIVARRTSK*
Ga0134081_1036351813300014150Grasslands SoilGTVTPSISYENTGLNTDISMHEGEPVIVGTLNVSPSGDAIILVVSARRALK*
Ga0075324_112336213300014263Natural And Restored WetlandsYENTGLATDISMRESEPVIVGTLNVGPSGDAIILVVSAKRTNK*
Ga0157380_1294138023300014326Switchgrass RhizosphereAYENTGVSTDISLRESEPVIVGTLNIGPSGDAIILVVSAKRTTK*
Ga0167638_110764923300015197Glacier Forefield SoilINYENTGLNTDISMREGEPVVVGTLNLGPSGDAIILVMSAKRAMK*
Ga0137409_1150886613300015245Vadose Zone SoilPAAPIFNYESTGLSTDISMREGEPVVVGTLNIGPSGDAIILVVSAKRTGP*
Ga0182007_1020325613300015262RhizosphereGVFTDISMREAEPVIVGTLNIGPSGDAVILVVAAKRTDKSGSWHATR*
Ga0132255_10598246913300015374Arabidopsis RhizosphereVNGGIPAINYENTGLSTDISVREAEPVVVGTLNVGPSGDAIILVVAAKRTQR*
Ga0184621_1012184113300018054Groundwater SedimentPPPAPIINYEATGLSTDISMREGEPVVVGTLNVGPSGDAIILVISAKRTNK
Ga0184619_1040362013300018061Groundwater SedimentSTVASNGPMAPIINYESTGLNTDISMREGEAVVVGTLNVGPSGDAIILVMSAKRTNK
Ga0190274_1005392713300018476SoilTGAGFPVINYEPTGLSTDISIREGEPAIVGTLYVRPSGDAIILVITARRTIK
Ga0187894_1051939613300019360Microbial Mat On RocksTYENTGLATDISVRENEPVIVGTLNIGPSGDAIILVVSAKRTGR
Ga0193727_113795423300019886SoilGTAIASNGPAAPIINYEPTGLNTDISMREGEPVVVGTLNAGPSGDAIILVVSAKRSQR
Ga0210377_1034237013300021090Groundwater SedimentAPVISYEATGLTTDISMHLGEPVVVGTLHVGPSGDAIILVMTAKRAQK
Ga0207653_1010722113300025885Corn, Switchgrass And Miscanthus RhizosphereFNYESTGLNTDISMREGEPVVVGTLHVGLSGDAIILVMSAKRSKQ
Ga0207682_1019591323300025893Miscanthus RhizosphereTGVSTDISMRESEPVIVGTLNIGPSGDAIILVVSAKRTQK
Ga0207684_1096818913300025910Corn, Switchgrass And Miscanthus RhizosphereKAFPQINYEGTGLATDISMREGDPVVVGTLNVGPSGDAIILVVSAKRTQK
Ga0207684_1117987723300025910Corn, Switchgrass And Miscanthus RhizosphereSNGPAAPIINYEPTGLNTDISMREGEPVVVGTLNAGPSGDAIILVVSAKRSQR
Ga0207662_1134227033300025918Switchgrass RhizosphereVNYEQTGVSTDISMRESEPVIVGTLNIGPSGDAIILVV
Ga0207670_1040686113300025936Switchgrass RhizosphereTVAYENTGVSTDISMRESEPVIVGTLNIGPSGDAIILVVSAKRTPR
Ga0207670_1139542613300025936Switchgrass RhizosphereVGAVAVSGGVPATNYEPTGLATDISIREGEPVIVGTLNVGPSGDAIILVVSAKRTSR
Ga0207669_1188988823300025937Miscanthus RhizosphereENTGLQTDISMREGEPVIVGTLNVGPSGGALILVVSAKRTTR
Ga0207689_1074997613300025942Miscanthus RhizosphereMPPAFNYEQTGVSTDISMREGEPVIVGTLNIGPSGDAIILVVSAKRTNK
Ga0207667_1141139923300025949Corn RhizosphereIAYENTGVFTDISMREAEPVIVGTLNIGPSGDAIILVVSAKRTPK
Ga0210102_103897713300025971Natural And Restored WetlandsVPAFNYENTGLATDISMRESEPVIVGTLNVGPSGEAIILVVSAKRTER
Ga0207641_1159415213300026088Switchgrass RhizosphereVAPNFNYQNTGLATDISMRETEPVIVGTLNVGPSGDAIILVVSAKRTAK
Ga0207676_1046863223300026095Switchgrass RhizosphereASAPVFNYESTGLNTDISMREGEPVVVGTLHVGPSGDAIILVVSAKRSKQ
Ga0207675_10140883713300026118Switchgrass RhizosphereAFPTINYENTGLQTDISIREGEPVIVGTLNVGPSGDAIILVVSSKRTNR
Ga0207698_1014226813300026142Corn RhizosphereVPATNYEPTGLATDISIREGEPVIVGTLNVGPSGDAIILVVSAKRTSR
Ga0257171_105743513300026377SoilSNGPMAPIINYESTGLNTDISMREGEPVIVGTLNIGPSGDAIILVMSARRTLK
Ga0209056_1021551523300026538SoilAPAAPIFNYEPTGLNTDISMREGEPVVVGTLNVGPSGDAIILVMSARRTK
Ga0207546_10494813300026806SoilVAPVINYESTGVSTDVSMREGEAVIVGTLNIGPSGDALILVVSAKRTQK
Ga0209683_1032905013300027840Wetland SedimentTGTGFPVINYEATGLGTDISIREGEPAIVGTLTVGPSGDAIILVIAARRTLK
Ga0207428_1013893613300027907Populus RhizosphereGAVAPAFNYENTGLATDISMRESEPVIVGTMNIGPSGDAIILVVAAKRTQK
Ga0209382_1164266923300027909Populus RhizosphereIAPAFNYEPTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTPK
Ga0268264_1254012213300028381Switchgrass RhizosphereSPASAAVFNYESTGLNTDISMREGEPVVVGTLQVGPSGDAIILVMSAKRSKQ
Ga0307408_10227166223300031548RhizosphereAPTFNYETTGLATDISMRESEPVIVGTLNVGPSGDAIILVVSAKRTQK
Ga0310907_1031285613300031847SoilPQINYEGTGLATDISMREGDPVVVGTLNVGPSGDAIILVVSAKRTQK
Ga0307407_1017410423300031903RhizosphereSLAANGAIAPAFNYEPTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTPK
Ga0310891_1024613823300031913SoilAFPQINYEGTGLATDISMREGDPVVVGTLNVGPSGDAIILVVSAKRTQK
Ga0310812_1006372113300032421SoilGAVTPAINYERTGVATDVSMREGEPVIVGTLNIGPSGDAIILVVSAKRTSR
Ga0310810_1037611313300033412SoilPAFNYEPTGLSTDISMREAEPVIVGTLNVGPSGDAIILVVSARRTQK
Ga0364942_0219963_422_5713300034165SedimentMAPIINYESTGLNTDISMREGEPVVVGTLNIGPSGDAIILVMSARRTLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.