| Basic Information | |
|---|---|
| Family ID | F074000 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 50 residues |
| Representative Sequence | IAPAFNYEPTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTPK |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.50 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.47% Coil/Unstructured: 67.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 44.17 |
| PF00158 | Sigma54_activat | 25.00 |
| PF02954 | HTH_8 | 6.67 |
| PF07238 | PilZ | 1.67 |
| PF01596 | Methyltransf_3 | 1.67 |
| PF05402 | PqqD | 0.83 |
| PF00496 | SBP_bac_5 | 0.83 |
| PF07920 | DUF1684 | 0.83 |
| PF13683 | rve_3 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.67 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.67 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 1.67 |
| COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.50 % |
| Unclassified | root | N/A | 22.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_10358522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1140 | Open in IMG/M |
| 3300001116|JGI12627J13344_100880 | All Organisms → cellular organisms → Bacteria | 4588 | Open in IMG/M |
| 3300001867|JGI12627J18819_10030038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2246 | Open in IMG/M |
| 3300004114|Ga0062593_101940371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8 | 652 | Open in IMG/M |
| 3300004643|Ga0062591_100587873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
| 3300005093|Ga0062594_103286543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300005354|Ga0070675_101633205 | Not Available | 595 | Open in IMG/M |
| 3300005355|Ga0070671_100943707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300005356|Ga0070674_100102444 | Not Available | 2088 | Open in IMG/M |
| 3300005366|Ga0070659_101171803 | Not Available | 679 | Open in IMG/M |
| 3300005440|Ga0070705_100949747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300005440|Ga0070705_101140845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300005444|Ga0070694_101902702 | Not Available | 508 | Open in IMG/M |
| 3300005458|Ga0070681_11734474 | Not Available | 551 | Open in IMG/M |
| 3300005458|Ga0070681_11833514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300005536|Ga0070697_101438526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300005545|Ga0070695_101491319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300005546|Ga0070696_101542339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300005615|Ga0070702_100591300 | Not Available | 830 | Open in IMG/M |
| 3300005615|Ga0070702_101388537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300005618|Ga0068864_101146878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300005842|Ga0068858_100728398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
| 3300005843|Ga0068860_101661992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 660 | Open in IMG/M |
| 3300005844|Ga0068862_100634029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1029 | Open in IMG/M |
| 3300006169|Ga0082029_1102945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300006237|Ga0097621_102208748 | Not Available | 526 | Open in IMG/M |
| 3300006358|Ga0068871_102000164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300006804|Ga0079221_10393155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300006852|Ga0075433_11660022 | Not Available | 551 | Open in IMG/M |
| 3300006854|Ga0075425_102282945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300006871|Ga0075434_102016128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300006876|Ga0079217_10677923 | Not Available | 688 | Open in IMG/M |
| 3300006914|Ga0075436_100018068 | All Organisms → cellular organisms → Bacteria | 4829 | Open in IMG/M |
| 3300006914|Ga0075436_100420474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
| 3300006954|Ga0079219_10117651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1346 | Open in IMG/M |
| 3300007004|Ga0079218_13783649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300009089|Ga0099828_10574887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300009090|Ga0099827_10382420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1201 | Open in IMG/M |
| 3300009137|Ga0066709_100254688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2353 | Open in IMG/M |
| 3300009147|Ga0114129_10983856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
| 3300009147|Ga0114129_11662365 | Not Available | 780 | Open in IMG/M |
| 3300009148|Ga0105243_12598860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300009174|Ga0105241_10769164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300009553|Ga0105249_10095242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2791 | Open in IMG/M |
| 3300009553|Ga0105249_10270928 | Not Available | 1691 | Open in IMG/M |
| 3300010042|Ga0126314_10046292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2804 | Open in IMG/M |
| 3300010046|Ga0126384_12148647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300010358|Ga0126370_11733451 | Not Available | 602 | Open in IMG/M |
| 3300010373|Ga0134128_11250980 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300010375|Ga0105239_13407761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300010397|Ga0134124_13164964 | Not Available | 504 | Open in IMG/M |
| 3300010399|Ga0134127_10571145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1155 | Open in IMG/M |
| 3300010400|Ga0134122_10265046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1458 | Open in IMG/M |
| 3300011271|Ga0137393_10550752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
| 3300011444|Ga0137463_1242957 | Not Available | 672 | Open in IMG/M |
| 3300012200|Ga0137382_11143261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300012201|Ga0137365_10497234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300012204|Ga0137374_10139966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2184 | Open in IMG/M |
| 3300012211|Ga0137377_10584818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1054 | Open in IMG/M |
| 3300012212|Ga0150985_114912959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300012354|Ga0137366_11182759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300012355|Ga0137369_10523211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300012358|Ga0137368_10428322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300012360|Ga0137375_11436081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300012362|Ga0137361_10487081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
| 3300012362|Ga0137361_10907470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300012509|Ga0157334_1081339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300012899|Ga0157299_10244213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300012906|Ga0157295_10317739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300012925|Ga0137419_11862203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300012930|Ga0137407_10872544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300012948|Ga0126375_10698262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300012960|Ga0164301_11825615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012985|Ga0164308_11965793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300013100|Ga0157373_10866886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300013102|Ga0157371_10725697 | Not Available | 745 | Open in IMG/M |
| 3300013294|Ga0120150_1030958 | Not Available | 1064 | Open in IMG/M |
| 3300013308|Ga0157375_10972409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 990 | Open in IMG/M |
| 3300014150|Ga0134081_10363518 | Not Available | 534 | Open in IMG/M |
| 3300014263|Ga0075324_1123362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300014326|Ga0157380_12941380 | Not Available | 542 | Open in IMG/M |
| 3300015197|Ga0167638_1107649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300015245|Ga0137409_11508866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300015262|Ga0182007_10203256 | Not Available | 693 | Open in IMG/M |
| 3300015374|Ga0132255_105982469 | Not Available | 515 | Open in IMG/M |
| 3300018054|Ga0184621_10121841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
| 3300018061|Ga0184619_10403620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300018476|Ga0190274_10053927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2927 | Open in IMG/M |
| 3300019360|Ga0187894_10519396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300019886|Ga0193727_1137954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300021090|Ga0210377_10342370 | Not Available | 904 | Open in IMG/M |
| 3300025885|Ga0207653_10107221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300025893|Ga0207682_10195913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300025910|Ga0207684_10968189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300025910|Ga0207684_11179877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300025918|Ga0207662_11342270 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 508 | Open in IMG/M |
| 3300025936|Ga0207670_10406861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
| 3300025936|Ga0207670_11395426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300025937|Ga0207669_11889888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300025942|Ga0207689_10749976 | Not Available | 824 | Open in IMG/M |
| 3300025949|Ga0207667_11411399 | Not Available | 670 | Open in IMG/M |
| 3300025971|Ga0210102_1038977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300026088|Ga0207641_11594152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300026095|Ga0207676_10468632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300026118|Ga0207675_101408837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300026142|Ga0207698_10142268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2069 | Open in IMG/M |
| 3300026377|Ga0257171_1057435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 677 | Open in IMG/M |
| 3300026538|Ga0209056_10215515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1391 | Open in IMG/M |
| 3300026806|Ga0207546_104948 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata | 512 | Open in IMG/M |
| 3300027840|Ga0209683_10329050 | Not Available | 703 | Open in IMG/M |
| 3300027907|Ga0207428_10138936 | Not Available | 1856 | Open in IMG/M |
| 3300027909|Ga0209382_11642669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300028381|Ga0268264_12540122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300031548|Ga0307408_102271662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300031847|Ga0310907_10312856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300031903|Ga0307407_10174104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1420 | Open in IMG/M |
| 3300031913|Ga0310891_10246138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300032421|Ga0310812_10063721 | Not Available | 1451 | Open in IMG/M |
| 3300033412|Ga0310810_10376113 | Not Available | 1480 | Open in IMG/M |
| 3300034165|Ga0364942_0219963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.83% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.83% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001116 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026806 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_103585221 | 3300000953 | Soil | NGSGAPIINYESTGLNTDISMRENEPVIVGTLNVGPSGDAIILVMTARRSSR* |
| JGI12627J13344_1008804 | 3300001116 | Forest Soil | IAANGAVAPTFNYENTGVATDISMRESEPVIVGTLNVGPSGDAIILVVSAKRTQR* |
| JGI12627J18819_100300383 | 3300001867 | Forest Soil | AANGAVAPTFNYENTGVATDISMRESEPVIVGTLNVGPSGDAIILVVSAKRTQR* |
| Ga0062593_1019403712 | 3300004114 | Soil | NGAVAPTINYERTGVATDVSMHEGEPVIVGTLNIGPSGDAIILVVSAKRTPK* |
| Ga0062591_1005878731 | 3300004643 | Soil | GFPVINYDNTGLNTDISLREGEPVVVGTLNAGPSGDAIILVVSAKRTNR* |
| Ga0062594_1032865432 | 3300005093 | Soil | FNYEQTGVSTDISMREGEPVIVGTLNIGPSGDAIILVVSAKRTTK* |
| Ga0070675_1016332051 | 3300005354 | Miscanthus Rhizosphere | STGLNTDISMREAEPVVVGTLNIGPSGDAIILVMSVRTTAR* |
| Ga0070671_1009437072 | 3300005355 | Switchgrass Rhizosphere | SGGVPATNYEPTGLATDISIREGEPVIVGTLNVGPSGDAIILVVSAKRTSR* |
| Ga0070674_1001024442 | 3300005356 | Miscanthus Rhizosphere | TGLSTDISVREGEPVIVGTLNVGPSGDAIILVVAAKRTQR* |
| Ga0070659_1011718031 | 3300005366 | Corn Rhizosphere | PPIFNYEGASLSTDISMREGEPVIVGTLNVGPSGDAIILVLSAKRTAK* |
| Ga0070705_1009497472 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | NYEGTGLATDISMREGDPVVVGTLNVGPSGDAIILVVSAKRTQK* |
| Ga0070705_1011408452 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAANGEVRPSINYEQTGLGTDVSMREGEPVVVGTLNVGPSGDAIILVVSAKRAQK* |
| Ga0070694_1019027021 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | PAVNYENTGVATDISIREAEPVIVGTLNVGPSGDAIILVVSAKRTSR* |
| Ga0070681_117344742 | 3300005458 | Corn Rhizosphere | AQNGPQTAPIINYESTGLNTDISMREGEPVIVGTLNVGPSGDAIILVMTARRTPR* |
| Ga0070681_118335141 | 3300005458 | Corn Rhizosphere | GAVAPIINYENTGVSTDISMRESEPVIVGTLNIGPSNDAIILVVTAKRAK* |
| Ga0070697_1014385262 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ENTGISTDVSMREAEPVIVGTLNIGPSGDAIILVVSAKRTLK* |
| Ga0070695_1014913192 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | PSINYEQTGLGTDVSMREGEPVVVGTLNVGPSGDAIILVVSAKRAQR* |
| Ga0070696_1015423392 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | QTGAVASTSATAPVFNYESTGLNTDISMREGELVVVGTLHVGPSGDAIILVMSAKRSNK* |
| Ga0070702_1005913001 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | PVINYDNTGLNTDISLREGEPVVVGTLNAGPSGDAIILVVSAKRTNR* |
| Ga0070702_1013885372 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAANGEVRPSINYEQTGLGTDVSMREGEPVVVGTLNVGPSGDAIILVVSAKRAQR* |
| Ga0068864_1011468781 | 3300005618 | Switchgrass Rhizosphere | VNNPMAAAGAMPPAFNYEQTGVSTDISMHEGEPVIVGTLNIGPSGDAIILVVSAKRTSK* |
| Ga0068858_1007283981 | 3300005842 | Switchgrass Rhizosphere | APAFNYEPTGLSTDISMREAEPVIVGTLNVGPSGDAIILVVSARRTQK* |
| Ga0068860_1016619921 | 3300005843 | Switchgrass Rhizosphere | VTHENTGLATDISMRESDPVIVGTLNVGPSGDAIILVVAAKRAQR* |
| Ga0068862_1006340291 | 3300005844 | Switchgrass Rhizosphere | AAINYENTGLSTDISIREGEPVVVGTLNVGPSGDAIILVVAAKRTGR* |
| Ga0082029_11029451 | 3300006169 | Termite Nest | NYENTGLSTDISMRESEPVIVGTMNIGPSGDAIILVVAAKRTQK* |
| Ga0097621_1022087481 | 3300006237 | Miscanthus Rhizosphere | PAINYENTGLSTDISVREAEPVVVGTLNVGPSGDAIILVVAAKRTQR* |
| Ga0068871_1020001641 | 3300006358 | Miscanthus Rhizosphere | IAANGAVAPIINYENTGVSTDISMRESEPVIVGTLNIGPSNDAIILVVAAKRAK* |
| Ga0079221_103931551 | 3300006804 | Agricultural Soil | TIAPAFNYETTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTSK* |
| Ga0075433_116600222 | 3300006852 | Populus Rhizosphere | LSTDISMRESEPVIVGTLNVGPSGDAIILVVAAKRTQR* |
| Ga0075425_1022829451 | 3300006854 | Populus Rhizosphere | PTLAANGAIAPAFNYEPTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTGK* |
| Ga0075434_1020161281 | 3300006871 | Populus Rhizosphere | YESTGLNTDISMREGEPVVVGTLNIGPSGDAIILVVSAKRTPQ* |
| Ga0079217_106779232 | 3300006876 | Agricultural Soil | AVASNAPGPPPVFNYEGTSLSTDVSMREGEPAIVGTLNIGPSGDAVILVVSAKRTSK* |
| Ga0075436_1000180685 | 3300006914 | Populus Rhizosphere | IAANGAIAPTINYESTGVATDISMREAEPVIVGTLNVGPSGDAIILVVSAKRTSK* |
| Ga0075436_1004204741 | 3300006914 | Populus Rhizosphere | PLASNSPTPPVFNYENTGLNTDISMREGEPVVVGTLNIGPSGEAIILVVSAKRTMQ* |
| Ga0079219_101176511 | 3300006954 | Agricultural Soil | ETTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTPK* |
| Ga0079218_137836491 | 3300007004 | Agricultural Soil | GTNLSTDISMREGEPVVVGTLNVGPSGDAIILVVSAKRTTK* |
| Ga0099828_105748871 | 3300009089 | Vadose Zone Soil | AVASNGTPTPIINYENTGLTTDISMREGEPVVVGTLNVGPSGDAIILVMSAKRAQR* |
| Ga0099827_103824202 | 3300009090 | Vadose Zone Soil | VVASNAAAAPIFNYEPTGLNTDISMREGEPVVVGTLNVGPSGDAKILVISAKRTSK* |
| Ga0066709_1002546882 | 3300009137 | Grasslands Soil | ASAVASNAPAAPIFNYEPTGLNTDISMREGEPVVVGTLNVGPSGDAIILVMSARRTK* |
| Ga0114129_109838562 | 3300009147 | Populus Rhizosphere | ANGTVAPTVNYEPTGVSTDISLREAEPVIVGTLNIGPSGDAIILVVSAKRTQR* |
| Ga0114129_116623651 | 3300009147 | Populus Rhizosphere | GGEVRLTTSYEQTGLQTDISMREAEPVIVGTLNVGPSGDAIILVVSARRTQK* |
| Ga0105243_125988601 | 3300009148 | Miscanthus Rhizosphere | AGAMPPAFNYEQTGVSTDISMHEGEPVIVGTLNIGPSGDAIILVVSAKRTTK* |
| Ga0105241_107691641 | 3300009174 | Corn Rhizosphere | GAVASTSTTAPVFNYESTGLNTDISMREGEPVVVGTLHVGPSGDAIILVMSAKRSNK* |
| Ga0105249_100952421 | 3300009553 | Switchgrass Rhizosphere | FPATNYENTGLQTDISIREGEPVIVGTLNVGPSGDAIILVVSSKRTSR* |
| Ga0105249_102709282 | 3300009553 | Switchgrass Rhizosphere | YESTGLNTDISMRENEPVIVGTLNVGPSGDAIILVMTARRSSR* |
| Ga0126314_100462921 | 3300010042 | Serpentine Soil | TINYEPTGVSTDVSMREGEPVIVGTLNIGPSGDAIILVVSAKRTMK* |
| Ga0126384_121486471 | 3300010046 | Tropical Forest Soil | AFNYETTGLSTDISMREGEPVIVGTLNVGPSGDAIVLVVSAKRTQK* |
| Ga0126370_117334512 | 3300010358 | Tropical Forest Soil | LSTDISMREGEPVIVGTLNVGPSGDAIVLVVSAKRTQK* |
| Ga0134128_112509802 | 3300010373 | Terrestrial Soil | YESTGLNTDISMREGEAVVVGTLNAGPSGDAIILVVSARRSQK* |
| Ga0105239_134077611 | 3300010375 | Corn Rhizosphere | AAVASTSAAPVFNYENTGLATDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTQR* |
| Ga0134124_131649641 | 3300010397 | Terrestrial Soil | YENTGLSTDISMRESEPVIVGTMNIGPSGDAIILVVAAKRTLK* |
| Ga0134127_105711452 | 3300010399 | Terrestrial Soil | VNYESTGLNTDFSMREGEATIIGTLNIGPSGDAIILVMSAKTTK* |
| Ga0134122_102650463 | 3300010400 | Terrestrial Soil | PIINYESTGLNTDISMREGEPVIVGTLNIGPSGDAIILVMSAKRTAK* |
| Ga0137393_105507522 | 3300011271 | Vadose Zone Soil | SNGPAAPIINYEPTGLNTDISMREGEPVVVGTLNAGPSGDAIILVVSAKRSQR* |
| Ga0137463_12429571 | 3300011444 | Soil | IITASTVASNGPLAPIINYESTGLNSDISMREGEPVVVGTLNIGPSGDAIILVMSGRRTLK* |
| Ga0137382_111432611 | 3300012200 | Vadose Zone Soil | IINYENTGLNTDISMREGEPVVVGTLNAGPSGDAIILVVSAKRTQK* |
| Ga0137365_104972342 | 3300012201 | Vadose Zone Soil | GPAAPIINYEPTGLNTDISMREGEPVVVGTLNAGPSGDAIILVVSAKRSQR* |
| Ga0137374_101399661 | 3300012204 | Vadose Zone Soil | ATAPIISYEATGLTTDISMREGEPVVVGTLHVGPSGDAIILVMTAKRAQR* |
| Ga0137377_105848182 | 3300012211 | Vadose Zone Soil | STGSPTPIINYESTGLTTDISMREGEAVVVGTLNVGPSGDAIILVVSAKRAMK* |
| Ga0150985_1149129591 | 3300012212 | Avena Fatua Rhizosphere | AYEPTGVSTDISMREGEPVIVGTLNIGPSGDAIILVVSAKRTMR* |
| Ga0137366_111827591 | 3300012354 | Vadose Zone Soil | NSPATAPIISYEATGLTTDISMREGEPVVVGTLHVGPSGDAIILVMTAKRAQR* |
| Ga0137369_105232111 | 3300012355 | Vadose Zone Soil | TAPIISYEATGLTTDISMREGEPVVVGTLHVGPSGDAIILVMTAKRAQR* |
| Ga0137368_104283221 | 3300012358 | Vadose Zone Soil | IQTGTALASNSPATAPIISYEATGLTTDISMREGEPVVVGTLHVGPSGDAIILVMTAKRAQR* |
| Ga0137375_114360811 | 3300012360 | Vadose Zone Soil | PATAPIISYEATGLTTDISMREGEPVVVGTLHVGPSGDAIILVMTAKRTQR* |
| Ga0137361_104870811 | 3300012362 | Vadose Zone Soil | NAPAAPIFNYESTGLNTDISMREGEPVVVGTLNIGPSGDAIILVVSAKRTGQ* |
| Ga0137361_109074701 | 3300012362 | Vadose Zone Soil | TGLSTDISMREGEPVVVGTLHVGPSGDAIILVMSAKKSNK* |
| Ga0157334_10813391 | 3300012509 | Soil | AVAPVISYESTGVATDISMREGEPVIVGTLNVSPSGDAIILVVSAKRTSK* |
| Ga0157299_102442131 | 3300012899 | Soil | EPTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTGK* |
| Ga0157295_103177391 | 3300012906 | Soil | NGAVAPAVNYEQTGVSTDISMRESEPVIVGTLNVGPSGDAIILVVSAKRTTR* |
| Ga0137419_118622032 | 3300012925 | Vadose Zone Soil | IINYESTGLNTDISMREGEPVVVGTLNIGPSGDAIILVMSAKRTAK* |
| Ga0137407_108725442 | 3300012930 | Vadose Zone Soil | QTGAVASTSATAPVFNYETTGLNTDISMREGEPVVVGTLHVGPSGDAIILVMSAKRSRQ* |
| Ga0126375_106982621 | 3300012948 | Tropical Forest Soil | VINYENTGLNTDISMREGEPVVVGTLNAGPSGDAIVLVVSAKRSSK* |
| Ga0164301_118256152 | 3300012960 | Soil | GAIAANGAVAPIINYENTGVSTDISIRESEPVIVGTLNIGPSNDAIILVVTAKRAK* |
| Ga0164308_119657932 | 3300012985 | Soil | GPMAPIINYESTGLNTDISMREGEAVVVGTLNIGPSGDAIILVMSAKSTNR* |
| Ga0157373_108668862 | 3300013100 | Corn Rhizosphere | AANGAVAPVINYEHTGVATDVSMREGEPVIVGTLNIGPSGDAIILVVSAKRTLK* |
| Ga0157371_107256971 | 3300013102 | Corn Rhizosphere | MPPAFNYEQTGVSTDISMREGEPVIVGTLNIGPSGDAIILVVSAKRTTK* |
| Ga0120150_10309582 | 3300013294 | Permafrost | STVASNGPMAPIINYESTGLNTDISMREAEPVVVGTLNIGPSGEAIILVMSARRTLK* |
| Ga0157375_109724092 | 3300013308 | Miscanthus Rhizosphere | TSMSTATINYETTGLNTDISMREGEPVIVGTLNVGPSGDATILVIVARRTSK* |
| Ga0134081_103635181 | 3300014150 | Grasslands Soil | GTVTPSISYENTGLNTDISMHEGEPVIVGTLNVSPSGDAIILVVSARRALK* |
| Ga0075324_11233621 | 3300014263 | Natural And Restored Wetlands | YENTGLATDISMRESEPVIVGTLNVGPSGDAIILVVSAKRTNK* |
| Ga0157380_129413802 | 3300014326 | Switchgrass Rhizosphere | AYENTGVSTDISLRESEPVIVGTLNIGPSGDAIILVVSAKRTTK* |
| Ga0167638_11076492 | 3300015197 | Glacier Forefield Soil | INYENTGLNTDISMREGEPVVVGTLNLGPSGDAIILVMSAKRAMK* |
| Ga0137409_115088661 | 3300015245 | Vadose Zone Soil | PAAPIFNYESTGLSTDISMREGEPVVVGTLNIGPSGDAIILVVSAKRTGP* |
| Ga0182007_102032561 | 3300015262 | Rhizosphere | GVFTDISMREAEPVIVGTLNIGPSGDAVILVVAAKRTDKSGSWHATR* |
| Ga0132255_1059824691 | 3300015374 | Arabidopsis Rhizosphere | VNGGIPAINYENTGLSTDISVREAEPVVVGTLNVGPSGDAIILVVAAKRTQR* |
| Ga0184621_101218411 | 3300018054 | Groundwater Sediment | PPPAPIINYEATGLSTDISMREGEPVVVGTLNVGPSGDAIILVISAKRTNK |
| Ga0184619_104036201 | 3300018061 | Groundwater Sediment | STVASNGPMAPIINYESTGLNTDISMREGEAVVVGTLNVGPSGDAIILVMSAKRTNK |
| Ga0190274_100539271 | 3300018476 | Soil | TGAGFPVINYEPTGLSTDISIREGEPAIVGTLYVRPSGDAIILVITARRTIK |
| Ga0187894_105193961 | 3300019360 | Microbial Mat On Rocks | TYENTGLATDISVRENEPVIVGTLNIGPSGDAIILVVSAKRTGR |
| Ga0193727_11379542 | 3300019886 | Soil | GTAIASNGPAAPIINYEPTGLNTDISMREGEPVVVGTLNAGPSGDAIILVVSAKRSQR |
| Ga0210377_103423701 | 3300021090 | Groundwater Sediment | APVISYEATGLTTDISMHLGEPVVVGTLHVGPSGDAIILVMTAKRAQK |
| Ga0207653_101072211 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | FNYESTGLNTDISMREGEPVVVGTLHVGLSGDAIILVMSAKRSKQ |
| Ga0207682_101959132 | 3300025893 | Miscanthus Rhizosphere | TGVSTDISMRESEPVIVGTLNIGPSGDAIILVVSAKRTQK |
| Ga0207684_109681891 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KAFPQINYEGTGLATDISMREGDPVVVGTLNVGPSGDAIILVVSAKRTQK |
| Ga0207684_111798772 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SNGPAAPIINYEPTGLNTDISMREGEPVVVGTLNAGPSGDAIILVVSAKRSQR |
| Ga0207662_113422703 | 3300025918 | Switchgrass Rhizosphere | VNYEQTGVSTDISMRESEPVIVGTLNIGPSGDAIILVV |
| Ga0207670_104068611 | 3300025936 | Switchgrass Rhizosphere | TVAYENTGVSTDISMRESEPVIVGTLNIGPSGDAIILVVSAKRTPR |
| Ga0207670_113954261 | 3300025936 | Switchgrass Rhizosphere | VGAVAVSGGVPATNYEPTGLATDISIREGEPVIVGTLNVGPSGDAIILVVSAKRTSR |
| Ga0207669_118898882 | 3300025937 | Miscanthus Rhizosphere | ENTGLQTDISMREGEPVIVGTLNVGPSGGALILVVSAKRTTR |
| Ga0207689_107499761 | 3300025942 | Miscanthus Rhizosphere | MPPAFNYEQTGVSTDISMREGEPVIVGTLNIGPSGDAIILVVSAKRTNK |
| Ga0207667_114113992 | 3300025949 | Corn Rhizosphere | IAYENTGVFTDISMREAEPVIVGTLNIGPSGDAIILVVSAKRTPK |
| Ga0210102_10389771 | 3300025971 | Natural And Restored Wetlands | VPAFNYENTGLATDISMRESEPVIVGTLNVGPSGEAIILVVSAKRTER |
| Ga0207641_115941521 | 3300026088 | Switchgrass Rhizosphere | VAPNFNYQNTGLATDISMRETEPVIVGTLNVGPSGDAIILVVSAKRTAK |
| Ga0207676_104686322 | 3300026095 | Switchgrass Rhizosphere | ASAPVFNYESTGLNTDISMREGEPVVVGTLHVGPSGDAIILVVSAKRSKQ |
| Ga0207675_1014088371 | 3300026118 | Switchgrass Rhizosphere | AFPTINYENTGLQTDISIREGEPVIVGTLNVGPSGDAIILVVSSKRTNR |
| Ga0207698_101422681 | 3300026142 | Corn Rhizosphere | VPATNYEPTGLATDISIREGEPVIVGTLNVGPSGDAIILVVSAKRTSR |
| Ga0257171_10574351 | 3300026377 | Soil | SNGPMAPIINYESTGLNTDISMREGEPVIVGTLNIGPSGDAIILVMSARRTLK |
| Ga0209056_102155152 | 3300026538 | Soil | APAAPIFNYEPTGLNTDISMREGEPVVVGTLNVGPSGDAIILVMSARRTK |
| Ga0207546_1049481 | 3300026806 | Soil | VAPVINYESTGVSTDVSMREGEAVIVGTLNIGPSGDALILVVSAKRTQK |
| Ga0209683_103290501 | 3300027840 | Wetland Sediment | TGTGFPVINYEATGLGTDISIREGEPAIVGTLTVGPSGDAIILVIAARRTLK |
| Ga0207428_101389361 | 3300027907 | Populus Rhizosphere | GAVAPAFNYENTGLATDISMRESEPVIVGTMNIGPSGDAIILVVAAKRTQK |
| Ga0209382_116426692 | 3300027909 | Populus Rhizosphere | IAPAFNYEPTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTPK |
| Ga0268264_125401221 | 3300028381 | Switchgrass Rhizosphere | SPASAAVFNYESTGLNTDISMREGEPVVVGTLQVGPSGDAIILVMSAKRSKQ |
| Ga0307408_1022716622 | 3300031548 | Rhizosphere | APTFNYETTGLATDISMRESEPVIVGTLNVGPSGDAIILVVSAKRTQK |
| Ga0310907_103128561 | 3300031847 | Soil | PQINYEGTGLATDISMREGDPVVVGTLNVGPSGDAIILVVSAKRTQK |
| Ga0307407_101741042 | 3300031903 | Rhizosphere | SLAANGAIAPAFNYEPTGLSTDISMREGEPVIVGTLNVGPSGDAIILVVSAKRTPK |
| Ga0310891_102461382 | 3300031913 | Soil | AFPQINYEGTGLATDISMREGDPVVVGTLNVGPSGDAIILVVSAKRTQK |
| Ga0310812_100637211 | 3300032421 | Soil | GAVTPAINYERTGVATDVSMREGEPVIVGTLNIGPSGDAIILVVSAKRTSR |
| Ga0310810_103761131 | 3300033412 | Soil | PAFNYEPTGLSTDISMREAEPVIVGTLNVGPSGDAIILVVSARRTQK |
| Ga0364942_0219963_422_571 | 3300034165 | Sediment | MAPIINYESTGLNTDISMREGEPVVVGTLNIGPSGDAIILVMSARRTLK |
| ⦗Top⦘ |