NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073988

Metagenome / Metatranscriptome Family F073988

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073988
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 45 residues
Representative Sequence METVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA
Number of Associated Samples 110
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.83 %
% of genes near scaffold ends (potentially truncated) 26.67 %
% of genes from short scaffolds (< 2000 bps) 84.17 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.667 % of family members)
Environment Ontology (ENVO) Unclassified
(36.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.833 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 37.78%    β-sheet: 4.44%    Coil/Unstructured: 57.78%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF01262AlaDh_PNT_C 45.00
PF05222AlaDh_PNT_N 13.33
PF01676Metalloenzyme 6.67
PF12982DUF3866 3.33
PF01546Peptidase_M20 2.50
PF00756Esterase 1.67
PF02885Glycos_trans_3N 0.83
PF02617ClpS 0.83
PF13376OmdA 0.83
PF02254TrkA_N 0.83
PF07831PYNP_C 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0213Thymidine phosphorylaseNucleotide transport and metabolism [F] 0.83
COG2127ATP-dependent Clp protease adapter protein ClpSPosttranslational modification, protein turnover, chaperones [O] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.00 %
UnclassifiedrootN/A25.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_102287776All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300001686|C688J18823_10004111All Organisms → cellular organisms → Bacteria9233Open in IMG/M
3300002568|C688J35102_120359081All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300002568|C688J35102_120494107All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300002568|C688J35102_120976389All Organisms → cellular organisms → Bacteria4229Open in IMG/M
3300003267|soilL1_10049410All Organisms → cellular organisms → Bacteria4176Open in IMG/M
3300003321|soilH1_10017222All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300003987|Ga0055471_10003721All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300003998|Ga0055472_10043846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1104Open in IMG/M
3300004114|Ga0062593_101037075All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300004157|Ga0062590_101994513Not Available602Open in IMG/M
3300004463|Ga0063356_100792217All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300004479|Ga0062595_101876472All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005328|Ga0070676_10118896All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300005332|Ga0066388_101358184All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300005332|Ga0066388_104080083Not Available745Open in IMG/M
3300005334|Ga0068869_101748130Not Available555Open in IMG/M
3300005336|Ga0070680_100673552All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300005340|Ga0070689_100190165All Organisms → cellular organisms → Bacteria1671Open in IMG/M
3300005341|Ga0070691_10146725All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300005345|Ga0070692_10194682All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300005353|Ga0070669_102031411Not Available502Open in IMG/M
3300005444|Ga0070694_100454437All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300005526|Ga0073909_10128557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1034Open in IMG/M
3300005535|Ga0070684_100485610All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300005558|Ga0066698_11057650All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005718|Ga0068866_10566200All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300005843|Ga0068860_101488135All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005844|Ga0068862_100497607All Organisms → cellular organisms → Bacteria → Proteobacteria1156Open in IMG/M
3300005874|Ga0075288_1021993All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300005887|Ga0075292_1040141All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300005937|Ga0081455_10018077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6731Open in IMG/M
3300005937|Ga0081455_10435764All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300006058|Ga0075432_10053017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1434Open in IMG/M
3300006169|Ga0082029_1785480Not Available765Open in IMG/M
3300009100|Ga0075418_11227909Not Available812Open in IMG/M
3300009148|Ga0105243_10189611All Organisms → cellular organisms → Bacteria1795Open in IMG/M
3300009551|Ga0105238_11638422Not Available674Open in IMG/M
3300009553|Ga0105249_10319992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1562Open in IMG/M
3300009789|Ga0126307_10000121All Organisms → cellular organisms → Bacteria46482Open in IMG/M
3300009840|Ga0126313_10400513All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300010041|Ga0126312_11256735Not Available547Open in IMG/M
3300010042|Ga0126314_10289148Not Available1168Open in IMG/M
3300010044|Ga0126310_10644170Not Available796Open in IMG/M
3300010147|Ga0126319_1183301All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300010304|Ga0134088_10722893Not Available501Open in IMG/M
3300010362|Ga0126377_13574073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales503Open in IMG/M
3300010371|Ga0134125_11961885Not Available636Open in IMG/M
3300010396|Ga0134126_12538176Not Available557Open in IMG/M
3300010397|Ga0134124_12666042Not Available543Open in IMG/M
3300010399|Ga0134127_11176678All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300011000|Ga0138513_100002494All Organisms → cellular organisms → Bacteria1828Open in IMG/M
3300012186|Ga0136620_10001890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9954Open in IMG/M
3300012212|Ga0150985_100507112All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300012469|Ga0150984_104499095All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300012892|Ga0157294_10260227Not Available538Open in IMG/M
3300012895|Ga0157309_10248037Not Available579Open in IMG/M
3300012897|Ga0157285_10353106Not Available516Open in IMG/M
3300012901|Ga0157288_10287106All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria569Open in IMG/M
3300012903|Ga0157289_10240613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes612Open in IMG/M
3300012910|Ga0157308_10289516Not Available595Open in IMG/M
3300012913|Ga0157298_10201509All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300013096|Ga0157307_1079359All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300013100|Ga0157373_10346741All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300014497|Ga0182008_10015761All Organisms → cellular organisms → Bacteria3937Open in IMG/M
3300014968|Ga0157379_10051133All Organisms → cellular organisms → Bacteria3691Open in IMG/M
3300015077|Ga0173483_10481831Not Available657Open in IMG/M
3300015200|Ga0173480_10756571Not Available615Open in IMG/M
3300015371|Ga0132258_10359928All Organisms → cellular organisms → Bacteria3601Open in IMG/M
3300015373|Ga0132257_100873198All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300017789|Ga0136617_10053835All Organisms → cellular organisms → Bacteria3549Open in IMG/M
3300018028|Ga0184608_10075599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales1372Open in IMG/M
3300018028|Ga0184608_10127925All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300018054|Ga0184621_10120015All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300018067|Ga0184611_1128556All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300018072|Ga0184635_10069243All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300018073|Ga0184624_10047042All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300018074|Ga0184640_10304986Not Available723Open in IMG/M
3300018465|Ga0190269_10081094All Organisms → cellular organisms → Bacteria1552Open in IMG/M
3300018469|Ga0190270_10002018All Organisms → cellular organisms → Bacteria9717Open in IMG/M
3300019356|Ga0173481_10007106All Organisms → cellular organisms → Bacteria3047Open in IMG/M
3300019356|Ga0173481_10634735All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300019356|Ga0173481_10684927Not Available551Open in IMG/M
3300019361|Ga0173482_10195874Not Available824Open in IMG/M
3300019361|Ga0173482_10350545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes669Open in IMG/M
3300019362|Ga0173479_10086811All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300019767|Ga0190267_10017261All Organisms → cellular organisms → Bacteria2068Open in IMG/M
3300021445|Ga0182009_10422488All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300021445|Ga0182009_10485102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacterales Family III. Incertae Sedis649Open in IMG/M
3300022737|Ga0247747_1038832Not Available574Open in IMG/M
3300023072|Ga0247799_1089439All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300025321|Ga0207656_10279870All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300025795|Ga0210114_1017473All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300025885|Ga0207653_10342825Not Available583Open in IMG/M
3300025899|Ga0207642_10375136All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300025901|Ga0207688_10007684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5872Open in IMG/M
3300025907|Ga0207645_10617252All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300025908|Ga0207643_10011656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4748Open in IMG/M
3300025917|Ga0207660_10613303All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300025921|Ga0207652_10286576All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300025930|Ga0207701_11612357Not Available522Open in IMG/M
3300025932|Ga0207690_10608705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales892Open in IMG/M
3300025981|Ga0207640_11368316All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300025993|Ga0208415_1023554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes598Open in IMG/M
3300026089|Ga0207648_10148339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2069Open in IMG/M
3300028587|Ga0247828_10263555All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300028705|Ga0307276_10199044Not Available526Open in IMG/M
3300028708|Ga0307295_10086916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacterales Family III. Incertae Sedis834Open in IMG/M
3300028719|Ga0307301_10132410All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300028784|Ga0307282_10131870All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300028784|Ga0307282_10391128Not Available673Open in IMG/M
3300028793|Ga0307299_10091814All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300028872|Ga0307314_10092659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacterales Family III. Incertae Sedis815Open in IMG/M
3300031548|Ga0307408_100009092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia6555Open in IMG/M
3300031731|Ga0307405_10261674Not Available1292Open in IMG/M
3300031858|Ga0310892_10271647All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300031892|Ga0310893_10237465All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300031996|Ga0308176_10026804All Organisms → cellular organisms → Bacteria4432Open in IMG/M
3300032174|Ga0307470_10838401Not Available716Open in IMG/M
3300033550|Ga0247829_10586666All Organisms → cellular organisms → Bacteria926Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.83%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.17%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.33%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.33%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.50%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.50%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.67%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.67%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.67%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.83%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.83%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.83%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025993Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10228777613300000956SoilYSTSDMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKNEATEG*
C688J18823_1000411153300001686SoilMAIWIVSVIALAAGMTYAVVKLTPEKSEKPEEAPEA*
C688J35102_12035908123300002568SoilMSTVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETAETTEA*
C688J35102_12049410723300002568SoilMSTVLGLFGMVIWILSVIALAAGMTYAVVKLTPEKAEKPEEAPEEA*
C688J35102_12097638963300002568SoilMSTVLGLFGMAIWIVSVIALAAGMTYAVVKLTPEKSEKPEEAPEA*
soilL1_1004941023300003267Sugarcane Root And Bulk SoilMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKGEATEG*
soilH1_1001722213300003321Sugarcane Root And Bulk SoilAASGYSTSDMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKGEATEG*
Ga0055471_1000372123300003987Natural And Restored WetlandsMGTVLGLFGMALWIVSVIALAAGMTYAVVRLTPEREEKTTEASET*
Ga0055472_1004384623300003998Natural And Restored WetlandsMDTVLGLFGMALWIVSVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0062593_10103707523300004114SoilGLFGMAIWILSVIALAAGITYAVVKLTPEKAEKPDEPAEA*
Ga0062590_10199451323300004157SoilLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET*
Ga0063356_10079221713300004463Arabidopsis Thaliana RhizosphereMTTVLGLFGMAIWILSVIALAAGITYAVVKLTPEKAEKPDEPAEA*
Ga0062595_10187647223300004479SoilMETVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0070676_1011889623300005328Miscanthus RhizosphereMETVLGLFGMVLWIVSVIALAAGITYAVVRLTPEREDKNPETTEA*
Ga0066388_10135818423300005332Tropical Forest SoilMETVLGLFGMALWIVSVIALAAGITYAVVKLTPERQEKPPTTEA*
Ga0066388_10408008323300005332Tropical Forest SoilMETVLGLFGVALWIVAVIALAAGITYAVVKITPEREDKQPETTEA*
Ga0068869_10174813023300005334Miscanthus RhizosphereMETVLGLFGMALWIVAVIALAAGITYAVVRLTPEREEKKPETTEA*
Ga0070680_10067355223300005336Corn RhizosphereMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTET*
Ga0070689_10019016523300005340Switchgrass RhizosphereMETVLGLFGVALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0070691_1014672523300005341Corn, Switchgrass And Miscanthus RhizosphereGYSTSDMETVLGLFGMVLWIVSVIALAAGITYAVVRLTPEREDKNPETTEA*
Ga0070692_1019468223300005345Corn, Switchgrass And Miscanthus RhizosphereMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREDKNPETTEA*
Ga0070669_10203141123300005353Switchgrass RhizosphereMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKNEATGG*
Ga0070694_10045443713300005444Corn, Switchgrass And Miscanthus RhizosphereMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATEG*
Ga0073909_1012855723300005526Surface SoilMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETSET*
Ga0070684_10048561023300005535Corn RhizosphereMETVLGLLGMALWIVSVIALAAGITYAVVRLTPEREEKSEATEG*
Ga0066698_1105765023300005558SoilMTTVLGLFGMVIWIVSVIALAAGITYAVVRLTPEKAEKPEEPSEA*
Ga0068866_1056620023300005718Miscanthus RhizosphereSDMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATEG*
Ga0068860_10148813523300005843Switchgrass RhizosphereDMETVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0068862_10049760723300005844Switchgrass RhizosphereASGYSTSDMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATEG*
Ga0075288_102199323300005874Rice Paddy SoilMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTEV*
Ga0075292_104014123300005887Rice Paddy SoilMGTVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREEKTTEASET*
Ga0081455_1001807723300005937Tabebuia Heterophylla RhizosphereMETVLGLFGMALWIVSVIALAAGITYAVVKLTPEREDKKPETNET*
Ga0081455_1043576423300005937Tabebuia Heterophylla RhizosphereMETVFGLFGMALWIVSVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0075432_1005301723300006058Populus RhizosphereMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETTET*
Ga0082029_178548023300006169Termite NestMETVLGLFGMALWIIAVIALAAGMTYAVVKLTPEREDKKPESTEA*
Ga0075418_1122790913300009100Populus RhizosphereMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKNEATEG*
Ga0105243_1018961133300009148Miscanthus RhizosphereMETVLGLFGMALWIVSVIALAAGITYAVVKLTPEREDKNPETTEA*
Ga0105238_1163842213300009551Corn RhizosphereSGYSTSDMETFLGLFGMALWIVSVIALAAGITYAVVRLTPEREDKNPETTEA*
Ga0105249_1031999213300009553Switchgrass RhizosphereVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0126307_10000121483300009789Serpentine SoilMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETTEA*
Ga0126313_1040051323300009840Serpentine SoilMDTVLGLFVMALWIVAVIALAAGVTYLVVKLSPGSDSKPKAET*
Ga0126312_1125673513300010041Serpentine SoilMETVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKPETTEA*
Ga0126314_1028914823300010042Serpentine SoilMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPDTTEA*
Ga0126310_1064417023300010044Serpentine SoilMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTEA*
Ga0126319_118330123300010147SoilMDTVLGLFGMVLWIVAVIALAAGITYAVVRLTPDREDKKPETTEA*
Ga0134088_1072289323300010304Grasslands SoilAASGYSTFRMTTVLGLFGMVIWIVSVIALAAGITYAVVRLTPEKAEKPEEPSEA*
Ga0126377_1357407323300010362Tropical Forest SoilMETVLGLFGMALWIVSVIALAAGITYAVVKLTPEREDKKEATEG*
Ga0134125_1196188523300010371Terrestrial SoilMETVLGLFGMALWILSVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0134126_1253817623300010396Terrestrial SoilMETVLGLFGMALWILSVIALAAGITYAVVRLTPEREDKSEATEG*
Ga0134124_1266604213300010397Terrestrial SoilMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKE
Ga0134127_1117667813300010399Terrestrial SoilSGYSTSDMETVLGLFGMVLWIVSVIALAAGITYAVVRLTPEREDKNPETTEA*
Ga0138513_10000249423300011000SoilMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET*
Ga0136620_1000189093300012186Polar Desert SandMDTVLGLLGIALFIVGVISLAAFITYAVVRLTPQRKRKAEPTETTG*
Ga0150985_10050711213300012212Avena Fatua RhizosphereTVLGLFGMALWIVSVIALAAGMTYAVVKLTPEREDKRPDTTEA*
Ga0150984_10449909523300012469Avena Fatua RhizosphereMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKNPDTTEA*
Ga0157294_1026022713300012892SoilMETVLGLFGMALWIVAVIALAAGITYAVVKLTPEREDKKPETTEA*
Ga0157309_1024803723300012895SoilMETVLGLLGMALWIVSVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0157285_1035310613300012897SoilAASGYSTSDMETVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0157288_1028710633300012901SoilFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0157289_1024061323300012903SoilMETVLGLFGMALWIVAVIALAAGITYAVVKLTPERAEKDEATEG*
Ga0157308_1028951613300012910SoilSGYSTLRMTTVLGLFGMAIWILSVIALAAGITYAVVRLTPEKAEKPEEPAEA*
Ga0157298_1020150923300012913SoilMETVLGLIGMALWIVSVIALAAGITYAVVRLTPEREDKKPETTEA*
Ga0157307_107935923300013096SoilDMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET*
Ga0157373_1034674123300013100Corn RhizosphereMETVLGLFGMALWILSVIALAAGITYAVVRLTPEREEKSEATEG*
Ga0182008_1001576143300014497RhizosphereMSTVLGLFGMVIWILSVIALAAGITYAVVKLTPEKAEKPEEAPEA*
Ga0157379_1005113323300014968Switchgrass RhizosphereMETVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKNPETTEA*
Ga0173483_1048183123300015077SoilMTTVLGLFGMAIWILSVIALAAGITYAVVRLTPEKAEKPEEPAEA*
Ga0173480_1075657123300015200SoilMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKSEATEG*
Ga0132258_1035992833300015371Arabidopsis RhizosphereMETVLGLFGMVLWIVSVIALAAGITYAVVKLTPEREDKNPETTEA*
Ga0132257_10087319823300015373Arabidopsis RhizosphereMETVLGLFGMVLWIVSVIALAAGITYAVVKLTPEREDKNPQTTEA*
Ga0136617_1005383543300017789Polar Desert SandMDTVLGLLGIALFIVGVISLAAFITYAVVRLTPQRKRKAEPTETTG
Ga0184608_1007559923300018028Groundwater SedimentMETVLGLFGMALWIVAVIALAAGMTYAVVKRTPEREDKKPETTET
Ga0184608_1012792523300018028Groundwater SedimentMTTVLGLCGMAIWIVSVIALAAGITYAVVRLTPERAEKPEAPEEA
Ga0184621_1012001513300018054Groundwater SedimentMTTVLGLFGMAIWIVSVIALAAGITYAVVRLTPERAEKPEAPEEA
Ga0184611_112855623300018067Groundwater SedimentMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETTET
Ga0184635_1006924333300018072Groundwater SedimentMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTET
Ga0184624_1004704223300018073Groundwater SedimentMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETTEA
Ga0184640_1030498623300018074Groundwater SedimentMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPERE
Ga0190269_1008109423300018465SoilMDTVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET
Ga0190270_1000201893300018469SoilMDTVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPDTTEA
Ga0173481_1000710633300019356SoilMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET
Ga0173481_1063473523300019356SoilMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREDKNPETTEA
Ga0173481_1068492713300019356SoilMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKEPDTTEA
Ga0173482_1019587423300019361SoilMETVLGLLGMALWIVSVIALAAGITYAVVRLTPEREEKSEATEG
Ga0173482_1035054523300019361SoilMVVWIIGVIALAAGVTYAVVRLTPEKADKPEEAPET
Ga0173479_1008681123300019362SoilMETVLGLFGMALWIVAVIALAAGITYAVVKLTPEREDKKPETTEA
Ga0190267_1001726123300019767SoilMETVLGLFGMALWIVAVIALAAGITYAVVRLTPDREDKKPETTEA
Ga0182009_1042248823300021445SoilMTTVLGILGMIVWIVAVIGLAAGITYAVVRLTPEKQEKPEEPAEA
Ga0182009_1048510223300021445SoilMSTVLGLFGMVIWILSVIALAAGITYAVVKLTPEKAEKPEEAPEA
Ga0247747_103883213300022737SoilAIWILSVIALAAGITYAVVRLTPEKAEKPEEPAEA
Ga0247799_108943923300023072SoilMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET
Ga0207656_1027987033300025321Corn RhizosphereMETVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA
Ga0210114_101747323300025795Natural And Restored WetlandsMGTVLGLFGMALWIVSVIALAAGMTYAVVRLTPEREEKTTEASET
Ga0207653_1034282513300025885Corn, Switchgrass And Miscanthus RhizosphereMETVLGLFGMVLWIVSVIALAAGITYAVVRLTPEREDKNPET
Ga0207642_1037513623300025899Miscanthus RhizosphereMETVLGLFGMALWIISVIALAAGITYAVVRLTPEREEKKEATEG
Ga0207688_1000768463300025901Corn, Switchgrass And Miscanthus RhizosphereMETVLGLFGMVLWIVSVIALAAGITYAVVRLTPEREDKNPETTEA
Ga0207645_1061725223300025907Miscanthus RhizosphereMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATEG
Ga0207643_1001165633300025908Miscanthus RhizosphereMETVLGLFGMALWIVAVIALAAGITYAVVRLTPEREEKKPETTEA
Ga0207660_1061330313300025917Corn RhizosphereMALWIVSVIALAAGITYAVVRLTPEREDKNPETTEA
Ga0207652_1028657623300025921Corn RhizosphereMETVLGLFGMALWIVSVIALAAGITYAVVKLTPEREDKNPETTEA
Ga0207701_1161235723300025930Corn, Switchgrass And Miscanthus RhizosphereMETVLGLFGVALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA
Ga0207690_1060870523300025932Corn RhizosphereMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKNEATGG
Ga0207640_1136831623300025981Corn RhizosphereGLFGVALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA
Ga0208415_102355423300025993Rice Paddy SoilMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTEV
Ga0207648_1014833913300026089Miscanthus RhizosphereASGYSTSDMETVLGLFGMALWIVSVIALAAGITYAVVKLTPEREDKNPETTEA
Ga0247828_1026355523300028587SoilMETVLGLFGMALWIISVIALAAGITYAVVRLTPEREDKNPETTEA
Ga0307276_1019904413300028705SoilMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKNPDTTEA
Ga0307295_1008691623300028708SoilMTTVLGLFGVVIWIVSVIALAAGITYAVVRLTPEKAEKPEAPEEA
Ga0307301_1013241013300028719SoilSGYSTSDMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTET
Ga0307282_1013187023300028784SoilVLGLFGMAIWIVSVIALAAGITYAVVRLTPERAEKPEAPEEA
Ga0307282_1039112813300028784SoilMTTVLGLFGMAIWIVSVIALAAGITYAVVRLTPER
Ga0307299_1009181413300028793SoilMAIWIVSVIALAAGITYAVVRLTPERAEKPEAPEEA
Ga0307314_1009265923300028872SoilMETVLGLFGMAIWILSVIALAAGITYAVVRLTPEKAEKPDEPAEA
Ga0307408_10000909253300031548RhizosphereMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPDTTEA
Ga0307405_1026167413300031731RhizosphereMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPET
Ga0310892_1027164723300031858SoilMETVLGLFGMVLWIVSVIALAAGITYAVVKLTPEREDKNPETTEA
Ga0310893_1023746523300031892SoilMETVLGLFGMVLWIVSVIALAAGITYAVVKITPEREDKNPETTEA
Ga0308176_1002680453300031996SoilMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPDTTEA
Ga0307470_1083840123300032174Hardwood Forest SoilMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATDG
Ga0247829_1058666623300033550SoilSTLDMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATEG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.