Basic Information | |
---|---|
Family ID | F073988 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 45 residues |
Representative Sequence | METVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.83 % |
% of genes near scaffold ends (potentially truncated) | 26.67 % |
% of genes from short scaffolds (< 2000 bps) | 84.17 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.833 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.78% β-sheet: 4.44% Coil/Unstructured: 57.78% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF01262 | AlaDh_PNT_C | 45.00 |
PF05222 | AlaDh_PNT_N | 13.33 |
PF01676 | Metalloenzyme | 6.67 |
PF12982 | DUF3866 | 3.33 |
PF01546 | Peptidase_M20 | 2.50 |
PF00756 | Esterase | 1.67 |
PF02885 | Glycos_trans_3N | 0.83 |
PF02617 | ClpS | 0.83 |
PF13376 | OmdA | 0.83 |
PF02254 | TrkA_N | 0.83 |
PF07831 | PYNP_C | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG0213 | Thymidine phosphorylase | Nucleotide transport and metabolism [F] | 0.83 |
COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.00 % |
Unclassified | root | N/A | 25.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_102287776 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300001686|C688J18823_10004111 | All Organisms → cellular organisms → Bacteria | 9233 | Open in IMG/M |
3300002568|C688J35102_120359081 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300002568|C688J35102_120494107 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300002568|C688J35102_120976389 | All Organisms → cellular organisms → Bacteria | 4229 | Open in IMG/M |
3300003267|soilL1_10049410 | All Organisms → cellular organisms → Bacteria | 4176 | Open in IMG/M |
3300003321|soilH1_10017222 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300003987|Ga0055471_10003721 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
3300003998|Ga0055472_10043846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1104 | Open in IMG/M |
3300004114|Ga0062593_101037075 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300004157|Ga0062590_101994513 | Not Available | 602 | Open in IMG/M |
3300004463|Ga0063356_100792217 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
3300004479|Ga0062595_101876472 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005328|Ga0070676_10118896 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
3300005332|Ga0066388_101358184 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300005332|Ga0066388_104080083 | Not Available | 745 | Open in IMG/M |
3300005334|Ga0068869_101748130 | Not Available | 555 | Open in IMG/M |
3300005336|Ga0070680_100673552 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300005340|Ga0070689_100190165 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
3300005341|Ga0070691_10146725 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300005345|Ga0070692_10194682 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300005353|Ga0070669_102031411 | Not Available | 502 | Open in IMG/M |
3300005444|Ga0070694_100454437 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300005526|Ga0073909_10128557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1034 | Open in IMG/M |
3300005535|Ga0070684_100485610 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300005558|Ga0066698_11057650 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300005718|Ga0068866_10566200 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300005843|Ga0068860_101488135 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300005844|Ga0068862_100497607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1156 | Open in IMG/M |
3300005874|Ga0075288_1021993 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300005887|Ga0075292_1040141 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300005937|Ga0081455_10018077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6731 | Open in IMG/M |
3300005937|Ga0081455_10435764 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300006058|Ga0075432_10053017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1434 | Open in IMG/M |
3300006169|Ga0082029_1785480 | Not Available | 765 | Open in IMG/M |
3300009100|Ga0075418_11227909 | Not Available | 812 | Open in IMG/M |
3300009148|Ga0105243_10189611 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
3300009551|Ga0105238_11638422 | Not Available | 674 | Open in IMG/M |
3300009553|Ga0105249_10319992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1562 | Open in IMG/M |
3300009789|Ga0126307_10000121 | All Organisms → cellular organisms → Bacteria | 46482 | Open in IMG/M |
3300009840|Ga0126313_10400513 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300010041|Ga0126312_11256735 | Not Available | 547 | Open in IMG/M |
3300010042|Ga0126314_10289148 | Not Available | 1168 | Open in IMG/M |
3300010044|Ga0126310_10644170 | Not Available | 796 | Open in IMG/M |
3300010147|Ga0126319_1183301 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300010304|Ga0134088_10722893 | Not Available | 501 | Open in IMG/M |
3300010362|Ga0126377_13574073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales | 503 | Open in IMG/M |
3300010371|Ga0134125_11961885 | Not Available | 636 | Open in IMG/M |
3300010396|Ga0134126_12538176 | Not Available | 557 | Open in IMG/M |
3300010397|Ga0134124_12666042 | Not Available | 543 | Open in IMG/M |
3300010399|Ga0134127_11176678 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300011000|Ga0138513_100002494 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
3300012186|Ga0136620_10001890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9954 | Open in IMG/M |
3300012212|Ga0150985_100507112 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300012469|Ga0150984_104499095 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
3300012892|Ga0157294_10260227 | Not Available | 538 | Open in IMG/M |
3300012895|Ga0157309_10248037 | Not Available | 579 | Open in IMG/M |
3300012897|Ga0157285_10353106 | Not Available | 516 | Open in IMG/M |
3300012901|Ga0157288_10287106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 569 | Open in IMG/M |
3300012903|Ga0157289_10240613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 612 | Open in IMG/M |
3300012910|Ga0157308_10289516 | Not Available | 595 | Open in IMG/M |
3300012913|Ga0157298_10201509 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300013096|Ga0157307_1079359 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300013100|Ga0157373_10346741 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300014497|Ga0182008_10015761 | All Organisms → cellular organisms → Bacteria | 3937 | Open in IMG/M |
3300014968|Ga0157379_10051133 | All Organisms → cellular organisms → Bacteria | 3691 | Open in IMG/M |
3300015077|Ga0173483_10481831 | Not Available | 657 | Open in IMG/M |
3300015200|Ga0173480_10756571 | Not Available | 615 | Open in IMG/M |
3300015371|Ga0132258_10359928 | All Organisms → cellular organisms → Bacteria | 3601 | Open in IMG/M |
3300015373|Ga0132257_100873198 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300017789|Ga0136617_10053835 | All Organisms → cellular organisms → Bacteria | 3549 | Open in IMG/M |
3300018028|Ga0184608_10075599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales | 1372 | Open in IMG/M |
3300018028|Ga0184608_10127925 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300018054|Ga0184621_10120015 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300018067|Ga0184611_1128556 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300018072|Ga0184635_10069243 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
3300018073|Ga0184624_10047042 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
3300018074|Ga0184640_10304986 | Not Available | 723 | Open in IMG/M |
3300018465|Ga0190269_10081094 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
3300018469|Ga0190270_10002018 | All Organisms → cellular organisms → Bacteria | 9717 | Open in IMG/M |
3300019356|Ga0173481_10007106 | All Organisms → cellular organisms → Bacteria | 3047 | Open in IMG/M |
3300019356|Ga0173481_10634735 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300019356|Ga0173481_10684927 | Not Available | 551 | Open in IMG/M |
3300019361|Ga0173482_10195874 | Not Available | 824 | Open in IMG/M |
3300019361|Ga0173482_10350545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 669 | Open in IMG/M |
3300019362|Ga0173479_10086811 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300019767|Ga0190267_10017261 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
3300021445|Ga0182009_10422488 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300021445|Ga0182009_10485102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacterales Family III. Incertae Sedis | 649 | Open in IMG/M |
3300022737|Ga0247747_1038832 | Not Available | 574 | Open in IMG/M |
3300023072|Ga0247799_1089439 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300025321|Ga0207656_10279870 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300025795|Ga0210114_1017473 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
3300025885|Ga0207653_10342825 | Not Available | 583 | Open in IMG/M |
3300025899|Ga0207642_10375136 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300025901|Ga0207688_10007684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5872 | Open in IMG/M |
3300025907|Ga0207645_10617252 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300025908|Ga0207643_10011656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4748 | Open in IMG/M |
3300025917|Ga0207660_10613303 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300025921|Ga0207652_10286576 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300025930|Ga0207701_11612357 | Not Available | 522 | Open in IMG/M |
3300025932|Ga0207690_10608705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 892 | Open in IMG/M |
3300025981|Ga0207640_11368316 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300025993|Ga0208415_1023554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 598 | Open in IMG/M |
3300026089|Ga0207648_10148339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2069 | Open in IMG/M |
3300028587|Ga0247828_10263555 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300028705|Ga0307276_10199044 | Not Available | 526 | Open in IMG/M |
3300028708|Ga0307295_10086916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacterales Family III. Incertae Sedis | 834 | Open in IMG/M |
3300028719|Ga0307301_10132410 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300028784|Ga0307282_10131870 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300028784|Ga0307282_10391128 | Not Available | 673 | Open in IMG/M |
3300028793|Ga0307299_10091814 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300028872|Ga0307314_10092659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacterales Family III. Incertae Sedis | 815 | Open in IMG/M |
3300031548|Ga0307408_100009092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6555 | Open in IMG/M |
3300031731|Ga0307405_10261674 | Not Available | 1292 | Open in IMG/M |
3300031858|Ga0310892_10271647 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300031892|Ga0310893_10237465 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300031996|Ga0308176_10026804 | All Organisms → cellular organisms → Bacteria | 4432 | Open in IMG/M |
3300032174|Ga0307470_10838401 | Not Available | 716 | Open in IMG/M |
3300033550|Ga0247829_10586666 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.67% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.83% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.17% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.17% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.33% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.50% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.50% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.67% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.67% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.83% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1022877761 | 3300000956 | Soil | YSTSDMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKNEATEG* |
C688J18823_100041115 | 3300001686 | Soil | MAIWIVSVIALAAGMTYAVVKLTPEKSEKPEEAPEA* |
C688J35102_1203590812 | 3300002568 | Soil | MSTVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETAETTEA* |
C688J35102_1204941072 | 3300002568 | Soil | MSTVLGLFGMVIWILSVIALAAGMTYAVVKLTPEKAEKPEEAPEEA* |
C688J35102_1209763896 | 3300002568 | Soil | MSTVLGLFGMAIWIVSVIALAAGMTYAVVKLTPEKSEKPEEAPEA* |
soilL1_100494102 | 3300003267 | Sugarcane Root And Bulk Soil | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKGEATEG* |
soilH1_100172221 | 3300003321 | Sugarcane Root And Bulk Soil | AASGYSTSDMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKGEATEG* |
Ga0055471_100037212 | 3300003987 | Natural And Restored Wetlands | MGTVLGLFGMALWIVSVIALAAGMTYAVVRLTPEREEKTTEASET* |
Ga0055472_100438462 | 3300003998 | Natural And Restored Wetlands | MDTVLGLFGMALWIVSVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0062593_1010370752 | 3300004114 | Soil | GLFGMAIWILSVIALAAGITYAVVKLTPEKAEKPDEPAEA* |
Ga0062590_1019945132 | 3300004157 | Soil | LFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET* |
Ga0063356_1007922171 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTTVLGLFGMAIWILSVIALAAGITYAVVKLTPEKAEKPDEPAEA* |
Ga0062595_1018764722 | 3300004479 | Soil | METVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0070676_101188962 | 3300005328 | Miscanthus Rhizosphere | METVLGLFGMVLWIVSVIALAAGITYAVVRLTPEREDKNPETTEA* |
Ga0066388_1013581842 | 3300005332 | Tropical Forest Soil | METVLGLFGMALWIVSVIALAAGITYAVVKLTPERQEKPPTTEA* |
Ga0066388_1040800832 | 3300005332 | Tropical Forest Soil | METVLGLFGVALWIVAVIALAAGITYAVVKITPEREDKQPETTEA* |
Ga0068869_1017481302 | 3300005334 | Miscanthus Rhizosphere | METVLGLFGMALWIVAVIALAAGITYAVVRLTPEREEKKPETTEA* |
Ga0070680_1006735522 | 3300005336 | Corn Rhizosphere | METVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTET* |
Ga0070689_1001901652 | 3300005340 | Switchgrass Rhizosphere | METVLGLFGVALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0070691_101467252 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | GYSTSDMETVLGLFGMVLWIVSVIALAAGITYAVVRLTPEREDKNPETTEA* |
Ga0070692_101946822 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREDKNPETTEA* |
Ga0070669_1020314112 | 3300005353 | Switchgrass Rhizosphere | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKNEATGG* |
Ga0070694_1004544371 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATEG* |
Ga0073909_101285572 | 3300005526 | Surface Soil | METVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETSET* |
Ga0070684_1004856102 | 3300005535 | Corn Rhizosphere | METVLGLLGMALWIVSVIALAAGITYAVVRLTPEREEKSEATEG* |
Ga0066698_110576502 | 3300005558 | Soil | MTTVLGLFGMVIWIVSVIALAAGITYAVVRLTPEKAEKPEEPSEA* |
Ga0068866_105662002 | 3300005718 | Miscanthus Rhizosphere | SDMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATEG* |
Ga0068860_1014881352 | 3300005843 | Switchgrass Rhizosphere | DMETVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0068862_1004976072 | 3300005844 | Switchgrass Rhizosphere | ASGYSTSDMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATEG* |
Ga0075288_10219932 | 3300005874 | Rice Paddy Soil | METVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTEV* |
Ga0075292_10401412 | 3300005887 | Rice Paddy Soil | MGTVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREEKTTEASET* |
Ga0081455_100180772 | 3300005937 | Tabebuia Heterophylla Rhizosphere | METVLGLFGMALWIVSVIALAAGITYAVVKLTPEREDKKPETNET* |
Ga0081455_104357642 | 3300005937 | Tabebuia Heterophylla Rhizosphere | METVFGLFGMALWIVSVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0075432_100530172 | 3300006058 | Populus Rhizosphere | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETTET* |
Ga0082029_17854802 | 3300006169 | Termite Nest | METVLGLFGMALWIIAVIALAAGMTYAVVKLTPEREDKKPESTEA* |
Ga0075418_112279091 | 3300009100 | Populus Rhizosphere | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKNEATEG* |
Ga0105243_101896113 | 3300009148 | Miscanthus Rhizosphere | METVLGLFGMALWIVSVIALAAGITYAVVKLTPEREDKNPETTEA* |
Ga0105238_116384221 | 3300009551 | Corn Rhizosphere | SGYSTSDMETFLGLFGMALWIVSVIALAAGITYAVVRLTPEREDKNPETTEA* |
Ga0105249_103199921 | 3300009553 | Switchgrass Rhizosphere | VLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0126307_1000012148 | 3300009789 | Serpentine Soil | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETTEA* |
Ga0126313_104005132 | 3300009840 | Serpentine Soil | MDTVLGLFVMALWIVAVIALAAGVTYLVVKLSPGSDSKPKAET* |
Ga0126312_112567351 | 3300010041 | Serpentine Soil | METVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKPETTEA* |
Ga0126314_102891482 | 3300010042 | Serpentine Soil | METVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPDTTEA* |
Ga0126310_106441702 | 3300010044 | Serpentine Soil | METVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTEA* |
Ga0126319_11833012 | 3300010147 | Soil | MDTVLGLFGMVLWIVAVIALAAGITYAVVRLTPDREDKKPETTEA* |
Ga0134088_107228932 | 3300010304 | Grasslands Soil | AASGYSTFRMTTVLGLFGMVIWIVSVIALAAGITYAVVRLTPEKAEKPEEPSEA* |
Ga0126377_135740732 | 3300010362 | Tropical Forest Soil | METVLGLFGMALWIVSVIALAAGITYAVVKLTPEREDKKEATEG* |
Ga0134125_119618852 | 3300010371 | Terrestrial Soil | METVLGLFGMALWILSVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0134126_125381762 | 3300010396 | Terrestrial Soil | METVLGLFGMALWILSVIALAAGITYAVVRLTPEREDKSEATEG* |
Ga0134124_126660421 | 3300010397 | Terrestrial Soil | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKE |
Ga0134127_111766781 | 3300010399 | Terrestrial Soil | SGYSTSDMETVLGLFGMVLWIVSVIALAAGITYAVVRLTPEREDKNPETTEA* |
Ga0138513_1000024942 | 3300011000 | Soil | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET* |
Ga0136620_100018909 | 3300012186 | Polar Desert Sand | MDTVLGLLGIALFIVGVISLAAFITYAVVRLTPQRKRKAEPTETTG* |
Ga0150985_1005071121 | 3300012212 | Avena Fatua Rhizosphere | TVLGLFGMALWIVSVIALAAGMTYAVVKLTPEREDKRPDTTEA* |
Ga0150984_1044990952 | 3300012469 | Avena Fatua Rhizosphere | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKNPDTTEA* |
Ga0157294_102602271 | 3300012892 | Soil | METVLGLFGMALWIVAVIALAAGITYAVVKLTPEREDKKPETTEA* |
Ga0157309_102480372 | 3300012895 | Soil | METVLGLLGMALWIVSVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0157285_103531061 | 3300012897 | Soil | AASGYSTSDMETVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0157288_102871063 | 3300012901 | Soil | FGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0157289_102406132 | 3300012903 | Soil | METVLGLFGMALWIVAVIALAAGITYAVVKLTPERAEKDEATEG* |
Ga0157308_102895161 | 3300012910 | Soil | SGYSTLRMTTVLGLFGMAIWILSVIALAAGITYAVVRLTPEKAEKPEEPAEA* |
Ga0157298_102015092 | 3300012913 | Soil | METVLGLIGMALWIVSVIALAAGITYAVVRLTPEREDKKPETTEA* |
Ga0157307_10793592 | 3300013096 | Soil | DMETVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET* |
Ga0157373_103467412 | 3300013100 | Corn Rhizosphere | METVLGLFGMALWILSVIALAAGITYAVVRLTPEREEKSEATEG* |
Ga0182008_100157614 | 3300014497 | Rhizosphere | MSTVLGLFGMVIWILSVIALAAGITYAVVKLTPEKAEKPEEAPEA* |
Ga0157379_100511332 | 3300014968 | Switchgrass Rhizosphere | METVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKNPETTEA* |
Ga0173483_104818312 | 3300015077 | Soil | MTTVLGLFGMAIWILSVIALAAGITYAVVRLTPEKAEKPEEPAEA* |
Ga0173480_107565712 | 3300015200 | Soil | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKSEATEG* |
Ga0132258_103599283 | 3300015371 | Arabidopsis Rhizosphere | METVLGLFGMVLWIVSVIALAAGITYAVVKLTPEREDKNPETTEA* |
Ga0132257_1008731982 | 3300015373 | Arabidopsis Rhizosphere | METVLGLFGMVLWIVSVIALAAGITYAVVKLTPEREDKNPQTTEA* |
Ga0136617_100538354 | 3300017789 | Polar Desert Sand | MDTVLGLLGIALFIVGVISLAAFITYAVVRLTPQRKRKAEPTETTG |
Ga0184608_100755992 | 3300018028 | Groundwater Sediment | METVLGLFGMALWIVAVIALAAGMTYAVVKRTPEREDKKPETTET |
Ga0184608_101279252 | 3300018028 | Groundwater Sediment | MTTVLGLCGMAIWIVSVIALAAGITYAVVRLTPERAEKPEAPEEA |
Ga0184621_101200151 | 3300018054 | Groundwater Sediment | MTTVLGLFGMAIWIVSVIALAAGITYAVVRLTPERAEKPEAPEEA |
Ga0184611_11285562 | 3300018067 | Groundwater Sediment | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETTET |
Ga0184635_100692433 | 3300018072 | Groundwater Sediment | METVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTET |
Ga0184624_100470422 | 3300018073 | Groundwater Sediment | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETTEA |
Ga0184640_103049862 | 3300018074 | Groundwater Sediment | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPERE |
Ga0190269_100810942 | 3300018465 | Soil | MDTVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET |
Ga0190270_100020189 | 3300018469 | Soil | MDTVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPDTTEA |
Ga0173481_100071063 | 3300019356 | Soil | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET |
Ga0173481_106347352 | 3300019356 | Soil | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREDKNPETTEA |
Ga0173481_106849271 | 3300019356 | Soil | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKEPDTTEA |
Ga0173482_101958742 | 3300019361 | Soil | METVLGLLGMALWIVSVIALAAGITYAVVRLTPEREEKSEATEG |
Ga0173482_103505452 | 3300019361 | Soil | MVVWIIGVIALAAGVTYAVVRLTPEKADKPEEAPET |
Ga0173479_100868112 | 3300019362 | Soil | METVLGLFGMALWIVAVIALAAGITYAVVKLTPEREDKKPETTEA |
Ga0190267_100172612 | 3300019767 | Soil | METVLGLFGMALWIVAVIALAAGITYAVVRLTPDREDKKPETTEA |
Ga0182009_104224882 | 3300021445 | Soil | MTTVLGILGMIVWIVAVIGLAAGITYAVVRLTPEKQEKPEEPAEA |
Ga0182009_104851022 | 3300021445 | Soil | MSTVLGLFGMVIWILSVIALAAGITYAVVKLTPEKAEKPEEAPEA |
Ga0247747_10388321 | 3300022737 | Soil | AIWILSVIALAAGITYAVVRLTPEKAEKPEEPAEA |
Ga0247799_10894392 | 3300023072 | Soil | MALWIVAVIALAAGMTYAVVRLTPEREDKKPETSET |
Ga0207656_102798703 | 3300025321 | Corn Rhizosphere | METVLGLFGMALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA |
Ga0210114_10174732 | 3300025795 | Natural And Restored Wetlands | MGTVLGLFGMALWIVSVIALAAGMTYAVVRLTPEREEKTTEASET |
Ga0207653_103428251 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | METVLGLFGMVLWIVSVIALAAGITYAVVRLTPEREDKNPET |
Ga0207642_103751362 | 3300025899 | Miscanthus Rhizosphere | METVLGLFGMALWIISVIALAAGITYAVVRLTPEREEKKEATEG |
Ga0207688_100076846 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | METVLGLFGMVLWIVSVIALAAGITYAVVRLTPEREDKNPETTEA |
Ga0207645_106172522 | 3300025907 | Miscanthus Rhizosphere | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATEG |
Ga0207643_100116563 | 3300025908 | Miscanthus Rhizosphere | METVLGLFGMALWIVAVIALAAGITYAVVRLTPEREEKKPETTEA |
Ga0207660_106133031 | 3300025917 | Corn Rhizosphere | MALWIVSVIALAAGITYAVVRLTPEREDKNPETTEA |
Ga0207652_102865762 | 3300025921 | Corn Rhizosphere | METVLGLFGMALWIVSVIALAAGITYAVVKLTPEREDKNPETTEA |
Ga0207701_116123572 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | METVLGLFGVALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA |
Ga0207690_106087052 | 3300025932 | Corn Rhizosphere | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKNEATGG |
Ga0207640_113683162 | 3300025981 | Corn Rhizosphere | GLFGVALWIVAVIALAAGITYAVVRLTPEREDKKPETTEA |
Ga0208415_10235542 | 3300025993 | Rice Paddy Soil | METVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTEV |
Ga0207648_101483391 | 3300026089 | Miscanthus Rhizosphere | ASGYSTSDMETVLGLFGMALWIVSVIALAAGITYAVVKLTPEREDKNPETTEA |
Ga0247828_102635552 | 3300028587 | Soil | METVLGLFGMALWIISVIALAAGITYAVVRLTPEREDKNPETTEA |
Ga0307276_101990441 | 3300028705 | Soil | METVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKNPDTTEA |
Ga0307295_100869162 | 3300028708 | Soil | MTTVLGLFGVVIWIVSVIALAAGITYAVVRLTPEKAEKPEAPEEA |
Ga0307301_101324101 | 3300028719 | Soil | SGYSTSDMETVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPETTET |
Ga0307282_101318702 | 3300028784 | Soil | VLGLFGMAIWIVSVIALAAGITYAVVRLTPERAEKPEAPEEA |
Ga0307282_103911281 | 3300028784 | Soil | MTTVLGLFGMAIWIVSVIALAAGITYAVVRLTPER |
Ga0307299_100918141 | 3300028793 | Soil | MAIWIVSVIALAAGITYAVVRLTPERAEKPEAPEEA |
Ga0307314_100926592 | 3300028872 | Soil | METVLGLFGMAIWILSVIALAAGITYAVVRLTPEKAEKPDEPAEA |
Ga0307408_1000090925 | 3300031548 | Rhizosphere | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPDTTEA |
Ga0307405_102616741 | 3300031731 | Rhizosphere | METVLGLFGMALWIVAVIALAAGMTYAVVRLTPEREDKKPET |
Ga0310892_102716472 | 3300031858 | Soil | METVLGLFGMVLWIVSVIALAAGITYAVVKLTPEREDKNPETTEA |
Ga0310893_102374652 | 3300031892 | Soil | METVLGLFGMVLWIVSVIALAAGITYAVVKITPEREDKNPETTEA |
Ga0308176_100268045 | 3300031996 | Soil | METVLGLFGMALWIVAVIALAAGMTYAVVKLTPEREDKKPDTTEA |
Ga0307470_108384012 | 3300032174 | Hardwood Forest Soil | METVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATDG |
Ga0247829_105866662 | 3300033550 | Soil | STLDMETVLGLFGMALWIVSVIALAAGITYAVVRLTPEREEKKEATEG |
⦗Top⦘ |