Basic Information | |
---|---|
Family ID | F073987 |
Family Type | Metagenome |
Number of Sequences | 120 |
Average Sequence Length | 46 residues |
Representative Sequence | LRDALSKMSPDQLKVNEITEDDRRVQMSLYEKLSAYLRAAK |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 5.13 % |
% of genes near scaffold ends (potentially truncated) | 28.33 % |
% of genes from short scaffolds (< 2000 bps) | 32.50 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (69.167 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF00174 | Oxidored_molyb | 68.33 |
PF03404 | Mo-co_dimer | 15.83 |
PF14357 | DUF4404 | 2.50 |
PF00890 | FAD_binding_2 | 1.67 |
PF07439 | DUF1515 | 0.83 |
PF00781 | DAGK_cat | 0.83 |
PF07043 | DUF1328 | 0.83 |
PF03544 | TonB_C | 0.83 |
PF00326 | Peptidase_S9 | 0.83 |
PF02806 | Alpha-amylase_C | 0.83 |
PF00753 | Lactamase_B | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 68.33 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 68.33 |
COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.67 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.83 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.83 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.83 |
COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 69.17 % |
All Organisms | root | All Organisms | 30.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002568|C688J35102_119103105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 638 | Open in IMG/M |
3300004463|Ga0063356_101908558 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 896 | Open in IMG/M |
3300004479|Ga0062595_100629234 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 844 | Open in IMG/M |
3300004633|Ga0066395_10168869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1123 | Open in IMG/M |
3300005164|Ga0066815_10031066 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 803 | Open in IMG/M |
3300005289|Ga0065704_10339971 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 825 | Open in IMG/M |
3300005290|Ga0065712_10339854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 795 | Open in IMG/M |
3300005439|Ga0070711_101191123 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 659 | Open in IMG/M |
3300005535|Ga0070684_101805597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 577 | Open in IMG/M |
3300005555|Ga0066692_10135618 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
3300005558|Ga0066698_10993003 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 533 | Open in IMG/M |
3300006034|Ga0066656_10447262 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 841 | Open in IMG/M |
3300007004|Ga0079218_11232262 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 780 | Open in IMG/M |
3300007788|Ga0099795_10273063 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 736 | Open in IMG/M |
3300010325|Ga0134064_10476628 | Not Available | 513 | Open in IMG/M |
3300010376|Ga0126381_101259741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1069 | Open in IMG/M |
3300010376|Ga0126381_105073054 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 504 | Open in IMG/M |
3300012203|Ga0137399_10885276 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 752 | Open in IMG/M |
3300012948|Ga0126375_11473918 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 580 | Open in IMG/M |
3300012988|Ga0164306_11898551 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 518 | Open in IMG/M |
3300013297|Ga0157378_11621424 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 693 | Open in IMG/M |
3300013308|Ga0157375_12674432 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 596 | Open in IMG/M |
3300016294|Ga0182041_11380810 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 646 | Open in IMG/M |
3300016319|Ga0182033_10390537 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 1174 | Open in IMG/M |
3300018054|Ga0184621_10056955 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1318 | Open in IMG/M |
3300024254|Ga0247661_1073766 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 636 | Open in IMG/M |
3300025898|Ga0207692_10125401 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
3300025929|Ga0207664_10655445 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 944 | Open in IMG/M |
3300025934|Ga0207686_11324858 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 592 | Open in IMG/M |
3300026023|Ga0207677_10792330 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300026523|Ga0209808_1196830 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 677 | Open in IMG/M |
3300027907|Ga0207428_10915826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 619 | Open in IMG/M |
3300028708|Ga0307295_10108937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
3300028884|Ga0307308_10156715 | Not Available | 1091 | Open in IMG/M |
3300031469|Ga0170819_12892741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 528 | Open in IMG/M |
3300031474|Ga0170818_105985593 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
3300031833|Ga0310917_10286596 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 1112 | Open in IMG/M |
3300031942|Ga0310916_11003062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 697 | Open in IMG/M |
3300032179|Ga0310889_10225923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 877 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.17% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.33% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.50% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.50% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.50% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.50% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.83% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026816 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-B (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2ZMR_00791370 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | LLERVQALRNSLSRMSPDQLKLNEITEDDRRVQMSLYEKLSASLRAVK |
JGI1027J12803_1019692492 | 3300000955 | Soil | ALRDTLSKMSPDQLKVNEITEDDRHVQMNLYEKLSASLRAAK* |
JGI10216J12902_1137992292 | 3300000956 | Soil | LLQRVEALRESLSKMSVDQLKVNEITEEDRRVQMSLYDKLSVYLRAAK* |
JGI24036J26619_100116071 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPDQLKVNEITEDDRRVQMSLYEKLSGSLRAAK* |
C688J35102_1191031052 | 3300002568 | Soil | VQGSRQKLLERVEALRDALSKMSPDQLKVNEITQDDRRVQISLYEKLSAYIRAAK* |
Ga0063356_1019085581 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NRQELLERVQALRNSLSRMSPDQLKVNEITDDDRRVQMSLYEKLSAELRAAK* |
Ga0062595_1006292342 | 3300004479 | Soil | QGSRQELLERVEALRDALSKMSPDQLRVNEITEDDRRVQMSLYEKLAAFLRAAK* |
Ga0066395_101688692 | 3300004633 | Tropical Forest Soil | RQELLKRVEELRDTLSKMSPDQLKVNEITEDDRRVQMSLYEKLSASLRAAK* |
Ga0066815_100310661 | 3300005164 | Soil | QELLKRVESLRDALSRMSPDQLKVNEITEDDRRVQMSLYEKLSAFLRAAK* |
Ga0066685_109966602 | 3300005180 | Soil | LRDALSKMSPDQLKVNEITEDDRRVQMSLYEKLSAYLRAAK* |
Ga0066678_103946602 | 3300005181 | Soil | QRVEALRDALSKMSPDQLKVNEIMEDDRRVQMSLYEKLSAALLAAK* |
Ga0065704_103399712 | 3300005289 | Switchgrass Rhizosphere | LLQRVEVLRDALSKMSPDQLKANKITENDRRVQMSLYEKLSSFVRATK* |
Ga0065712_103398542 | 3300005290 | Miscanthus Rhizosphere | QGSRQELLQRVEALRDALSKMSPDQLKVNEITEDDRRVQMSLYEKLSSFLRPAK* |
Ga0065715_108552062 | 3300005293 | Miscanthus Rhizosphere | LLQRVEALRDALSKMSPDQLKANEITEDDRHVQMSLYEKLSAYLGAVK* |
Ga0065707_100176211 | 3300005295 | Switchgrass Rhizosphere | RDALSKMSPDQLKVNEITEDDRRVQMSLYEKLSASLRAAK* |
Ga0066388_1039355013 | 3300005332 | Tropical Forest Soil | QRVEALRDALRKMSSDQLKVNEITEDDRRVQMSLYEKLSAYLGSAE* |
Ga0066388_1055182812 | 3300005332 | Tropical Forest Soil | RVDIVRDALSKMSPDQLKPNEIAEEDRRVQMSSYEKLCAFLRAAK* |
Ga0068869_1015801991 | 3300005334 | Miscanthus Rhizosphere | LRDALSKMSPDQLKVNEITEDDRRVQMSLYEKLSSFLRPAK* |
Ga0070659_1000230246 | 3300005366 | Corn Rhizosphere | RDALSKMSPDQLKVNEITEDDHRVQMSLYEKLSADLRAAK* |
Ga0070711_1011911232 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GSPQELLQRVEALRDALSKMSAGQLKVNEITEDDRRVQMSLYEKLSAYLRAAK* |
Ga0070705_1006959011 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RQELLQRVDALRDSLAKMSSEQLKVNEITEDDRRVQMSLYEKLSAYLRAAK* |
Ga0070705_1016901071 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LRDALSKMSPDQLKVNEITEDDHRVQMSLYEKLSADLRAAK* |
Ga0066681_109145811 | 3300005451 | Soil | QRVEALRDALSKMSPEQLKVNEITEDDRRVQMSLYEKLSAFLTAEK* |
Ga0070684_1018055971 | 3300005535 | Corn Rhizosphere | QGSRDELLQRVEALRDTLRQMSADQLKVNEITEDDRRSQLALYEKLCTYLRTPK* |
Ga0066692_101356181 | 3300005555 | Soil | SREELLERVMALRDALNRMSPDQLKVNEINEEDRRVQLELYEKLSAYLRTPK* |
Ga0066698_109930031 | 3300005558 | Soil | REELLERVMALRDALSRMSPDQLKVNEINEEDRRTQLELYNKLGAYLRTSK* |
Ga0068856_1022732991 | 3300005614 | Corn Rhizosphere | RVEALRDALGKMSPDQLKVHEITEDDRRVQMSLYQKLSAYLSAAK* |
Ga0066656_104472623 | 3300006034 | Soil | EELLERVMALRDALSRMSPDQLKVNEINEEDRRVQLELYEKLSAYLRTSK* |
Ga0082029_18075321 | 3300006169 | Termite Nest | ALRNALSRMSPEQLKVNEITEDDRRVQMSLYEKLSAYLRAAK* |
Ga0070716_1006202432 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VDALRDSLAKMSSDQLKVNEITEDDRRVQMSLYEKLSAYLRAAK* |
Ga0066665_113152661 | 3300006796 | Soil | SKMSTDQLKVNEITQDDRRVQISLYEKLSAFLRAAK* |
Ga0079218_112322622 | 3300007004 | Agricultural Soil | SREELLERVQALRDSLKQMSGAELKRNEIDETDRQVQLALYDKLCGDLASAK* |
Ga0099795_102730632 | 3300007788 | Vadose Zone Soil | GSRQELLQRVEALRDALTKMSPDQLKVNEITQDDRRVQMSLYEKLSAFLRAAK* |
Ga0066710_1026507201 | 3300009012 | Grasslands Soil | VEALRDALSRMSPDQLEVNEITEDDRRVQMSLYEKLSAFLRAAK |
Ga0111539_117546502 | 3300009094 | Populus Rhizosphere | EALRDALCRMSPDQLKVNEIIDDDRQVQMSLYQKLSAYLRAAK* |
Ga0105243_130898711 | 3300009148 | Miscanthus Rhizosphere | QRVEALRDALSKMSPDQLKVNEITEDDHRVQMSLYEKLSAYLGAVK* |
Ga0126380_101070183 | 3300010043 | Tropical Forest Soil | VEALRDALGKMSPDQLKVNEITEDDRRVQMSLYDKLCASLRAAK* |
Ga0126382_110859261 | 3300010047 | Tropical Forest Soil | RVEALRDALGKMSPDQLKLNEISQDDRRVQMSLYEKLSSSLGAAK* |
Ga0134064_104766282 | 3300010325 | Grasslands Soil | LQGSREELLERVMALRDALNRMSPDQLKVNEINEEDRRVQLELYEKLSAYLRTPK* |
Ga0126370_126705092 | 3300010358 | Tropical Forest Soil | LSKMSADQLKMNEITEEDRRVQMSLYEKLSAYLRAGK* |
Ga0126376_104037503 | 3300010359 | Tropical Forest Soil | RDALRKMSPEQLKVNEITEDDRGVQMSLYEKLSAYLRAAK* |
Ga0126378_121363881 | 3300010361 | Tropical Forest Soil | DALSKMSPDQLRVNEITEDDRHVQTGLYEKLSAFLRAAK* |
Ga0126377_124036751 | 3300010362 | Tropical Forest Soil | KMSPDQLKLNEISENDRGVQMSLYEKLSAYLRAAK* |
Ga0105239_127943342 | 3300010375 | Corn Rhizosphere | LGKMSAEQLKVNEITDDDRRIQMILYEKLSAALRAAK* |
Ga0126381_1012597413 | 3300010376 | Tropical Forest Soil | VQGSRQELLQRVEGLRDALGKMSPEQLKVNEITEDDRRVQMSLYEKLSSSLRAA |
Ga0126381_1050730541 | 3300010376 | Tropical Forest Soil | SREELLQRVEALRDSLAKMSSDQLKVNEITEEDRRVQMSLYEKLAAYLRTAA* |
Ga0134124_103566282 | 3300010397 | Terrestrial Soil | DALRDSLAKMSSEQLKVNEITEDDRRVQVSLYEKLSAYLRAAK* |
Ga0137399_108852761 | 3300012203 | Vadose Zone Soil | GSRQELLQRVEALRDALTKMSPDQLKVNEVTGDDRRVQMSLYEKLSAFLRAAK* |
Ga0137362_106372101 | 3300012205 | Vadose Zone Soil | RVDALRDALAKMSHDQLKVHEITGDDRRGQMSLYEKLSASLRAAK* |
Ga0137376_117659162 | 3300012208 | Vadose Zone Soil | GKMSPDQLKVHEITEDDRRVQMSLYEKLSASLRAAK* |
Ga0137370_103943972 | 3300012285 | Vadose Zone Soil | LRDALSKMSPDQLKVNEITKDDRRVQISLYEKLSAYVRAAK* |
Ga0157351_10094132 | 3300012501 | Unplanted Soil | QRAQALRDALSKMSPDQLKVHEITEDDRRVQMSLYEKLSAYLGAVK* |
Ga0126375_114739181 | 3300012948 | Tropical Forest Soil | QGSHQELLQRVEALRESLSKMSADQLKVNEITEEDRRLQMSLYDKLSMYLRAAK* |
Ga0164303_103990161 | 3300012957 | Soil | KISPDQLKVHEITEEDRRVKMSLYQKLSAYLSAAK* |
Ga0164301_114417332 | 3300012960 | Soil | RVEALRDALSKMSAGQLKVNEITEDDRRVQMSLYEKLSAFLRTAK* |
Ga0164302_111546352 | 3300012961 | Soil | QRVEALRNALSKMSLEQLKVNEITEDDRRIQMILYEKLSAALRAAK* |
Ga0164307_102339252 | 3300012987 | Soil | ALRDALGKMSPDQLKVNEITEDDRRVQMSLYEKLSAFLRTAK* |
Ga0164307_112892011 | 3300012987 | Soil | LSKMSPDQLKINEITEDDRRVQMSLYEKLSASLRAAK* |
Ga0164306_118985511 | 3300012988 | Soil | QELLQRVEALGDALGKMSPDQLKVNEITQDDRRVQMSLYEKLSAYLRAAK* |
Ga0157369_121179192 | 3300013105 | Corn Rhizosphere | GRMSPEQLKVNEITEDDRRVQMSLYQKLSACLSAAK* |
Ga0157374_109814852 | 3300013296 | Miscanthus Rhizosphere | LGRMSPDQLKVNEITEDDRRVQMSLYEKLSAYLSAAK* |
Ga0157374_122951071 | 3300013296 | Miscanthus Rhizosphere | MSPEQLKVNEITDDDRRIQMILYEKLSAALRGAK* |
Ga0157378_116214241 | 3300013297 | Miscanthus Rhizosphere | SPQELLQRVEALRAALGRMSPDQLKVNEITEDDRRVQMSLYEKLSACLTAAK* |
Ga0157372_118820292 | 3300013307 | Corn Rhizosphere | QELLQRVDALRNALSKMSPDQLKVNEITEDDRRVQMSLYEKLSGSLRAAK* |
Ga0157375_126744322 | 3300013308 | Miscanthus Rhizosphere | QELLQRVEALQDALSKMSPEQLQVHEISEDDRRVQMSLYEKLSACLRAAK* |
Ga0137418_104151162 | 3300015241 | Vadose Zone Soil | RDALGKMSPDQLKMHEITEDDRRVQMSLYEKLSASLRAAK* |
Ga0134073_101770972 | 3300015356 | Grasslands Soil | LLQRVEALRDALSKMSPEQLKVNEITEDDRRVQMSLYEKLSVFLSAAK* |
Ga0132258_133435311 | 3300015371 | Arabidopsis Rhizosphere | MPPDQLKVNEITEDDRRVQISLYEKLSTSLRAPK* |
Ga0132257_1004584573 | 3300015373 | Arabidopsis Rhizosphere | LRDALSKMSPDQLKVNEITEDDRRVQISLYEKLSAFVRAAK* |
Ga0132255_1058190022 | 3300015374 | Arabidopsis Rhizosphere | LQRVEALRNALSKMSPDQLKTNEITEDDRRVQMSLYERLSAYLGAVK* |
Ga0182041_113808101 | 3300016294 | Soil | QELLQRVDALRDALGKMSPDQLKVNEITEDDRRVQMSLYEKLSTSLRAAK |
Ga0182033_103905372 | 3300016319 | Soil | VHGDRQELVQRVDALRDALSRMSPDQLKVNEITENDRRVQMSLHEKLSSSLRAAK |
Ga0182032_112240521 | 3300016357 | Soil | ALRDTLSKMSPDQLKVNEITENDRRVQMSLYEKLSASLGAAK |
Ga0184621_100569551 | 3300018054 | Groundwater Sediment | QGSRQELLQRVEALRDALSKMSPEQLKVNEITEDDRRVQMSLYEKLSASLRAVK |
Ga0184612_103112332 | 3300018078 | Groundwater Sediment | LSKMSPDQLKVHEITEDDRRVQMSLYEKLSASLRAAK |
Ga0184625_102814191 | 3300018081 | Groundwater Sediment | RDALSKMSPDQLKVHEITEDDRRVQISLYEKLSAYLRAAK |
Ga0066667_110214151 | 3300018433 | Grasslands Soil | RGALLQSVKLLRDALARMSPDQLKLNEITEEDRRVQMSLYEKMSAYLHAAK |
Ga0066669_109133572 | 3300018482 | Grasslands Soil | LQRVDALRDALSKMSPDQLKVNEITEEDRRVQMSLYEKLSVYLRAAK |
Ga0066669_124281632 | 3300018482 | Grasslands Soil | LQRVDALRDALSKMSPDQLKVNEITEEDRRVQMSLYEKLSASLRAAK |
Ga0193693_10656712 | 3300019996 | Soil | GKMSSEQLKVHEITEDDRRVQMSLYEKLSAYLRAAK |
Ga0193721_10199271 | 3300020018 | Soil | KALRDALSKMAPDQLKVNEITEDDRRVQMSLYEKLSASLRAAK |
Ga0193724_10875552 | 3300020062 | Soil | EALRDALSKMSPEQLKVHEITEDDRRVQMSLYEKLSAYLRAAK |
Ga0210382_101957422 | 3300021080 | Groundwater Sediment | SKMSPDQLKVHEITEDDRRVQMSLYEKLSASLRAAK |
Ga0126371_116014391 | 3300021560 | Tropical Forest Soil | RDALGKMSPEQLKVNEITEDDRRVQMSLYEKLSSSLRAAK |
Ga0126371_134448991 | 3300021560 | Tropical Forest Soil | LKRVEELRDTLSKMSPDQLKVNEITEDDRRVQMSLYEKLSASLRAAK |
Ga0222622_107046832 | 3300022756 | Groundwater Sediment | ALSKMSPAQLKMNEIKEDDRRVQMSLYEKLSASLRSAR |
Ga0193714_10422441 | 3300023058 | Soil | EALRDALSRMSPDQLKVNEITEDDRGAQMILYKKLSADLHTAK |
Ga0247661_10737661 | 3300024254 | Soil | VQGNRQELLQRVDALRDSLAKMSSDQLKVNEITEDDRRVQMSLYEKLSAYLRAAK |
Ga0207697_100296903 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VEALQDALSKMSPEQLKVHEISEDDRRVQMSLYKKLSAFLQVAK |
Ga0207697_103574082 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | GDSLTKMSPDQLKVNEITEEDRRVQKSLYEKLSAYLRSAN |
Ga0207692_101254013 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RQELLQRVEGLRDALSKMSPEQLKVHEITEDDRRVQMSLYEKLSAYLRAPK |
Ga0207693_109789982 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LQQRAEALRDALSKMSPEQLKVNEITEDDRRVQMSLYEKLSAALLAAK |
Ga0207664_106554452 | 3300025929 | Agricultural Soil | GSRHELLQWVGALRDALGRMSPDQLKVNEITEDDRRVQMSLYEKLSAFLSAAK |
Ga0207701_104043361 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RDALSKMSPDQLKANEITEDDRHVQMSLYEKLSAYLGAVK |
Ga0207701_116141402 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GRMSPDQLKVNEITEDDRRVQMSLYEKLSAYLSAAK |
Ga0207690_103233232 | 3300025932 | Corn Rhizosphere | ELLQRVEALRDALSKMSPDQLKVNEITEDDRRVQMSLYEKLSSFLRPAK |
Ga0207690_108150442 | 3300025932 | Corn Rhizosphere | QRVEALRDALSKMSPDQLKVNEITEDDHRVQMSLYEKLSADLRAAK |
Ga0207686_113248582 | 3300025934 | Miscanthus Rhizosphere | RHELLQRVGALRDGLSRMSPDQLKVNEITENDRRVQISLYEKLSAFLSAAK |
Ga0207661_105502861 | 3300025944 | Corn Rhizosphere | VDALRDALSKMSPDQLKVNEITEDDRRVQMSLYEKLSGSLRAAK |
Ga0207712_103437562 | 3300025961 | Switchgrass Rhizosphere | QRIEALRDALSKMSPDQLKANEITEDDRHVQMSLYEKLSAYLGAVK |
Ga0207712_106263972 | 3300025961 | Switchgrass Rhizosphere | RVDALRNALSKMSPDQLKVNEITEDDRRVQMSLYEKLSGSLRAAK |
Ga0207677_107923301 | 3300026023 | Miscanthus Rhizosphere | PGYLVQGSRDELLQRVESLRDVLRQMSADQLKVNEITEEDRRIQLALYEKLCAYLRTPK |
Ga0207676_109070461 | 3300026095 | Switchgrass Rhizosphere | LQDALSKMSPEQLKVHEISEDDRRVQMSLYKKLSAFLQVAK |
Ga0209808_11968301 | 3300026523 | Soil | VQGSRQELLERVEALRDALSKMSPDQLKVNEITGDDRRVQMSLYEKLSAYLRAAK |
Ga0209808_12396071 | 3300026523 | Soil | LSKMSPDQLKVNEITQDDRRVQISLYEKLSAYIRAAK |
Ga0207509_1062251 | 3300026816 | Soil | VDALRESLAKMSSDQLKVNEITEDDRRVQMSLYEKLSAYLRAAK |
Ga0207428_109158261 | 3300027907 | Populus Rhizosphere | GSRQELLQRVEALRDALGKMSPEQLKVHEITEDDRRVQMSLYKKLSASLQAAK |
Ga0307295_101089373 | 3300028708 | Soil | RDELLQRVEALRDALRQMSAEQLKVNEITEDDRRIQLALYEKLCAYLRTPK |
Ga0307323_103216022 | 3300028787 | Soil | ELLQRVEALRDALRQMSAEQLKVNEITEDDRRIQLALYEKLCAYLRTPK |
Ga0307308_101567152 | 3300028884 | Soil | SREELLQRVEGLRDALSRMPPDQLKVNEITEDDRRVQMSLYEKLSASLRSAK |
Ga0170819_128927412 | 3300031469 | Forest Soil | GSRQELLQRVEALRDALTKMSADQLKVHEITEDDRRVQMSLYEKLSASLRAVK |
Ga0170818_1059855933 | 3300031474 | Forest Soil | AQGSRQELLQRVEGLRDALSKMSPEQLKVHEITEDDRRVQMSLYEKLSAYLRAPK |
Ga0170818_1068592391 | 3300031474 | Forest Soil | KMSPDQLKVHEITEDDRRVQMSLYEKLSAFLRTAK |
Ga0307469_100170661 | 3300031720 | Hardwood Forest Soil | GDALSKMSPDQLKTNEITEDDRHVQMSLYEKLSAYLRAAG |
Ga0310917_102865962 | 3300031833 | Soil | VHGDRQELVQRVDALRDALSRMSPDQLKVNEIAENDRRVQMSLHEKLSSSLRAAK |
Ga0306921_111405431 | 3300031912 | Soil | QRVDALRDALSRMSPDQLKVNEITENDRRVQMSLHEKLSSSLRAAK |
Ga0310916_110030622 | 3300031942 | Soil | VHGDRQELVQRVDALRDALSRMSPDQLKVNEITENDRRFQMSLHEKLSSSLRAAK |
Ga0306922_100563545 | 3300032001 | Soil | DALSRMSPDQLKVNEIAENDRRVQMSLHEKLSSSLRAAK |
Ga0310889_102259231 | 3300032179 | Soil | SREQLLQRVEALRNALSKMSPDQLKVNEITEDDRRVQMSLYEKLSAYLGAVK |
Ga0310811_111143311 | 3300033475 | Soil | RVQALRNSLSRMSPDQLKVNEITEDDRRVQMSLYEKLSASLGAVK |
⦗Top⦘ |