Metagenome / Metatranscriptome Family F073986

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F073986
Family Type	Metagenome / Metatranscriptome
Number of Sequences	120
Average Sequence Length	40 residues
Representative Sequence	MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALLV
Number of Associated Samples	84
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	88.24 %
% of genes near scaffold ends (potentially truncated)	12.50 %
% of genes from short scaffolds (< 2000 bps)	77.50 %
Associated GOLD sequencing projects	77
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (54.167 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.000 % of family members)
Environment Ontology (ENVO)	Unclassified (35.833 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (61.667 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.65% β-sheet: 5.88% Coil/Unstructured: 51.47%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF00486	Trans_reg_C	1.67
PF13531	SBP_bac_11	1.67
PF04055	Radical_SAM	1.67
PF13817	DDE_Tnp_IS66_C	0.83
PF01458	SUFBD	0.83
PF00543	P-II	0.83
PF03928	HbpS-like	0.83
PF01266	DAO	0.83
PF07690	MFS_1	0.83
PF13417	GST_N_3	0.83
PF02738	MoCoBD_1	0.83
PF09994	DUF2235	0.83
PF13683	rve_3	0.83
PF00037	Fer4	0.83
PF13641	Glyco_tranf_2_3	0.83
PF01381	HTH_3	0.83
PF13467	RHH_4	0.83
PF00378	ECH_1	0.83
PF11295	DUF3096	0.83
PF13174	TPR_6	0.83
PF00535	Glycos_transf_2	0.83
PF01402	RHH_1	0.83
PF09084	NMT1	0.83
PF02397	Bac_transf	0.83
PF01522	Polysacc_deac_1	0.83
PF00903	Glyoxalase	0.83
PF13847	Methyltransf_31	0.83
PF04392	ABC_sub_bind	0.83
PF01124	MAPEG	0.83
PF10098	DUF2336	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG0347	Nitrogen regulatory protein PII	Signal transduction mechanisms [T]	0.83
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.83
COG0719	Fe-S cluster assembly scaffold protein SufB	Posttranslational modification, protein turnover, chaperones [O]	0.83
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.83
COG2148	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)	Cell wall/membrane/envelope biogenesis [M]	0.83
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.83
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
All Organisms	root	All Organisms	45.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
cellular organisms	root	All Organisms → cellular organisms	45.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	45.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	32.50 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.83 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.83 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	28.33 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.50 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.83 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	16.67 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	2.50 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1.67 %
Parvularculales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales	0.83 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.83 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	4.17 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2.50 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2.50 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	1.67 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	0.83 %
Parvularculaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae	0.83 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.83 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.83 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.83 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	4.17 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2.50 %
Rhodovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum	1.67 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	0.83 %
unclassified Parvularculaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → unclassified Parvularculaceae	0.83 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.83 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.83 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.83 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	4.17 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2.50 %
unclassified Rhodovulum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum	1.67 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	0.83 %
Parvularculaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → unclassified Parvularculaceae → Parvularculaceae bacterium	0.83 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.83 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.83 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.83 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.17 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	4.17 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2.50 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1.67 %
Pseudolabrys sp. FHR47	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47	0.83 %
Parvularculaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → unclassified Parvularculaceae → Parvularculaceae bacterium	0.83 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.83 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.83 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.83 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459004\|F62QY1Z02GDTHW	Not Available	566	Open in IMG/M
3300001593\|JGI12635J15846_10209089	All Organisms → cellular organisms → Bacteria	1283	Open in IMG/M
3300001661\|JGI12053J15887_10063320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	2052	Open in IMG/M
3300005363\|Ga0008090_13766953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	800	Open in IMG/M
3300005529\|Ga0070741_10128031	All Organisms → cellular organisms → Bacteria → Proteobacteria	2603	Open in IMG/M
3300005531\|Ga0070738_10000093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	260088	Open in IMG/M
3300005538\|Ga0070731_10136377	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1626	Open in IMG/M
3300005538\|Ga0070731_10991379	Not Available	556	Open in IMG/M
3300005587\|Ga0066654_10153975	Not Available	1169	Open in IMG/M
3300005602\|Ga0070762_10778326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	646	Open in IMG/M
3300005764\|Ga0066903_103646250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	829	Open in IMG/M
3300005921\|Ga0070766_10536540	Not Available	780	Open in IMG/M
3300005921\|Ga0070766_10597385	Not Available	741	Open in IMG/M
3300005993\|Ga0080027_10103265	All Organisms → cellular organisms → Bacteria → Proteobacteria	1070	Open in IMG/M
3300005993\|Ga0080027_10424355	Not Available	537	Open in IMG/M
3300006028\|Ga0070717_10704876	All Organisms → cellular organisms → Bacteria	917	Open in IMG/M
3300006028\|Ga0070717_11099958	Not Available	724	Open in IMG/M
3300006028\|Ga0070717_11661511	Not Available	578	Open in IMG/M
3300006041\|Ga0075023_100038755	Not Available	1442	Open in IMG/M
3300006041\|Ga0075023_100102830	Not Available	991	Open in IMG/M
3300006047\|Ga0075024_100119618	All Organisms → cellular organisms → Bacteria	1173	Open in IMG/M
3300006047\|Ga0075024_100702311	Not Available	555	Open in IMG/M
3300006050\|Ga0075028_100084090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1596	Open in IMG/M
3300006050\|Ga0075028_100506221	Not Available	706	Open in IMG/M
3300006050\|Ga0075028_100730259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	598	Open in IMG/M
3300006052\|Ga0075029_101307911	Not Available	509	Open in IMG/M
3300006172\|Ga0075018_10000956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	9343	Open in IMG/M
3300006176\|Ga0070765_100424401	Not Available	1244	Open in IMG/M
3300009650\|Ga0105857_1174942	Not Available	612	Open in IMG/M
3300010048\|Ga0126373_10008862	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8025	Open in IMG/M
3300010048\|Ga0126373_10026874	Not Available	4932	Open in IMG/M
3300010048\|Ga0126373_10595402	Not Available	1158	Open in IMG/M
3300010048\|Ga0126373_12201598	Not Available	612	Open in IMG/M
3300010159\|Ga0099796_10503222	Not Available	543	Open in IMG/M
3300010361\|Ga0126378_10498604	All Organisms → cellular organisms → Bacteria	1333	Open in IMG/M
3300010361\|Ga0126378_12224732	Not Available	626	Open in IMG/M
3300010376\|Ga0126381_100415607	Not Available	1878	Open in IMG/M
3300010376\|Ga0126381_103180789	Not Available	649	Open in IMG/M
3300011270\|Ga0137391_10410572	Not Available	1156	Open in IMG/M
3300011270\|Ga0137391_10442525	Not Available	1106	Open in IMG/M
3300011271\|Ga0137393_10921245	All Organisms → cellular organisms → Bacteria	745	Open in IMG/M
3300012199\|Ga0137383_10143915	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1744	Open in IMG/M
3300012210\|Ga0137378_10474404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1157	Open in IMG/M
3300012361\|Ga0137360_11000997	Not Available	721	Open in IMG/M
3300012683\|Ga0137398_10857157	Not Available	634	Open in IMG/M
3300012683\|Ga0137398_10904384	Not Available	615	Open in IMG/M
3300012917\|Ga0137395_10947736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	620	Open in IMG/M
3300012924\|Ga0137413_11393314	Not Available	566	Open in IMG/M
3300012944\|Ga0137410_11112511	Not Available	677	Open in IMG/M
3300014501\|Ga0182024_10027974	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9830	Open in IMG/M
3300014501\|Ga0182024_11233784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	872	Open in IMG/M
3300014657\|Ga0181522_10174152	Not Available	1262	Open in IMG/M
3300015242\|Ga0137412_10032074	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	4289	Open in IMG/M
3300016445\|Ga0182038_11553902	Not Available	595	Open in IMG/M
3300017975\|Ga0187782_10807735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → unclassified Parvularculaceae → Parvularculaceae bacterium	725	Open in IMG/M
3300020199\|Ga0179592_10016617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	3234	Open in IMG/M
3300020199\|Ga0179592_10026526	All Organisms → cellular organisms → Bacteria	2600	Open in IMG/M
3300020580\|Ga0210403_10012718	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6810	Open in IMG/M
3300020580\|Ga0210403_10051513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	3292	Open in IMG/M
3300020580\|Ga0210403_10129126	Not Available	2061	Open in IMG/M
3300020580\|Ga0210403_10140028	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1975	Open in IMG/M
3300020580\|Ga0210403_10215137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1577	Open in IMG/M
3300020580\|Ga0210403_10660693	Not Available	840	Open in IMG/M
3300020581\|Ga0210399_10139255	All Organisms → cellular organisms → Bacteria → Acidobacteria	2002	Open in IMG/M
3300021168\|Ga0210406_10695815	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47	784	Open in IMG/M
3300021170\|Ga0210400_10333149	Not Available	1248	Open in IMG/M
3300021170\|Ga0210400_11039346	Not Available	665	Open in IMG/M
3300021171\|Ga0210405_11376243	Not Available	515	Open in IMG/M
3300021377\|Ga0213874_10011861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2220	Open in IMG/M
3300021401\|Ga0210393_10187199	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1671	Open in IMG/M
3300021404\|Ga0210389_10356036	Not Available	1150	Open in IMG/M
3300021405\|Ga0210387_10054021	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3240	Open in IMG/M
3300021420\|Ga0210394_11198193	Not Available	652	Open in IMG/M
3300021432\|Ga0210384_11644387	Not Available	548	Open in IMG/M
3300021476\|Ga0187846_10376994	Not Available	584	Open in IMG/M
3300021478\|Ga0210402_10840471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	844	Open in IMG/M
3300021478\|Ga0210402_11836908	Not Available	532	Open in IMG/M
3300021479\|Ga0210410_10006411	All Organisms → cellular organisms → Bacteria	10234	Open in IMG/M
3300021560\|Ga0126371_10013821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7341	Open in IMG/M
3300021560\|Ga0126371_10066584	All Organisms → cellular organisms → Bacteria	3490	Open in IMG/M
3300021560\|Ga0126371_10831325	Not Available	1069	Open in IMG/M
3300021560\|Ga0126371_11596065	Not Available	779	Open in IMG/M
3300021560\|Ga0126371_11890377	Not Available	716	Open in IMG/M
3300021560\|Ga0126371_12855251	Not Available	586	Open in IMG/M
3300021861\|Ga0213853_11195639	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1082	Open in IMG/M
3300026217\|Ga0209871_1077363	Not Available	642	Open in IMG/M
3300026496\|Ga0257157_1036143	Not Available	820	Open in IMG/M
3300026496\|Ga0257157_1069880	Not Available	601	Open in IMG/M
3300026551\|Ga0209648_10027950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4927	Open in IMG/M
3300026555\|Ga0179593_1024024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2429	Open in IMG/M
3300026557\|Ga0179587_10647451	Not Available	696	Open in IMG/M
3300027546\|Ga0208984_1132961	Not Available	535	Open in IMG/M
3300027591\|Ga0209733_1004886	Not Available	3372	Open in IMG/M
3300027727\|Ga0209328_10205306	Not Available	594	Open in IMG/M
3300027738\|Ga0208989_10305663	Not Available	507	Open in IMG/M
3300027869\|Ga0209579_10661112	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300027894\|Ga0209068_10000768	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	16686	Open in IMG/M
3300027894\|Ga0209068_10001278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	12644	Open in IMG/M
3300027902\|Ga0209048_10149425	All Organisms → cellular organisms → Bacteria	1744	Open in IMG/M
3300027902\|Ga0209048_10781227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	624	Open in IMG/M
3300027903\|Ga0209488_10935623	Not Available	605	Open in IMG/M
3300027911\|Ga0209698_10833058	Not Available	695	Open in IMG/M
3300027915\|Ga0209069_10780171	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300027965\|Ga0209062_1000188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	231976	Open in IMG/M
3300028047\|Ga0209526_10375128	Not Available	948	Open in IMG/M
3300028536\|Ga0137415_11301222	Not Available	545	Open in IMG/M
3300028906\|Ga0308309_11325214	Not Available	619	Open in IMG/M
3300031057\|Ga0170834_100339474	Not Available	826	Open in IMG/M
3300031668\|Ga0318542_10596841	Not Available	576	Open in IMG/M
3300031715\|Ga0307476_10208632	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1420	Open in IMG/M
3300031797\|Ga0318550_10412624	Not Available	654	Open in IMG/M
3300031879\|Ga0306919_10396085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1059	Open in IMG/M
3300031890\|Ga0306925_10029181	All Organisms → cellular organisms → Bacteria	5603	Open in IMG/M
3300031890\|Ga0306925_10928540	Not Available	893	Open in IMG/M
3300031941\|Ga0310912_10538200	All Organisms → cellular organisms → Bacteria	910	Open in IMG/M
3300031954\|Ga0306926_12037738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	644	Open in IMG/M
3300032076\|Ga0306924_11825539	Not Available	633	Open in IMG/M
3300032261\|Ga0306920_101136558	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1131	Open in IMG/M
3300032261\|Ga0306920_101756209	Not Available	877	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.17%
Host-Associated	Host-Associated	0.83%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	85.00%
Aquatic	Environmental → Aquatic	14.17%
Plants	Host-Associated → Plants	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	84.17%
Sediment	Environmental → Aquatic → Sediment	10.83%
Freshwater	Environmental → Aquatic → Freshwater	3.33%
Cave	Environmental → Terrestrial → Cave	0.83%
Roots	Host-Associated → Plants → Roots	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	64.17%
Loam	Environmental → Terrestrial → Soil → Loam	14.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	10.83%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.83%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.67%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.83%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.83%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.83%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.50%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	28.33%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	11.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	10.83%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	5.00%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.50%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.67%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.83%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.83%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.83%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.83%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.83%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	20.00%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	15.83%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	11.67%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	10.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.67%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	5.83%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	5.00%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	5.00%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.50%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.67%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	1.67%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	1.67%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	1.67%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.83%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.83%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.83%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.83%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.83%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.83%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.83%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.83%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.83%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.83%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459004	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)	Environmental	Open in IMG/M
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300005993	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300009650	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014657	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Host-Associated	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021476	Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300026217	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)	Environmental	Open in IMG/M
3300026496	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A	Environmental	Open in IMG/M
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental	Open in IMG/M
3300026555	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027546	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027591	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)	Environmental	Open in IMG/M
3300027727	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027738	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)	Environmental	Open in IMG/M
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027902	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300027965	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031668	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031797	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E4B_01563340	2170459004	Grass Soil	MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV
JGI12635J15846_102090892	3300001593	Forest Soil	MFMRMTAQRRLLGLDIGDWSMLLGGLTLAGVLALFI*
JGI12053J15887_100633202	3300001661	Forest Soil	MLQQLTTLRFTTEGRLLGFDLGDWSMLLGGFGLAGMLSFFL*
Ga0008090_137669532	3300005363	Tropical Rainforest Soil	MLRFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLSLL
Ga0070741_101280311	3300005529	Surface Soil	MTRVLADGRLLGFDSGDWSMLLGGFVLAGLLALFV*
Ga0070738_10000093101	3300005531	Surface Soil	MLRIATLRLTSDGRLLGFDTGDWSMLLGGFALAGLLALFV*
Ga0070731_101363772	3300005538	Surface Soil	MLRQAALRLTAEGRLLGFDTGDWSILLGGFVLCGLVALLV*
Ga0070731_109913791	3300005538	Surface Soil	TLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV*
Ga0066654_101539751	3300005587	Soil	MLRLTTLRLTSDGRLLGFDPGDWSMLLGGFALAGLLALFV*
Ga0070762_107783261	3300005602	Soil	MLRTASLHLTAEGRLLGFDTGDWSVLLGGFFLAGLLALMV*
Ga0066903_1036462502	3300005764	Tropical Forest Soil	MLRFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLSLLV*
Ga0070766_105365401	3300005921	Soil	MLRTASLHLTAEGRLLGFDTGDWSMLLGGFFLAGLLALMV*
Ga0070766_105973851	3300005921	Soil	MLRLTTFRLTTDGRLLGFDTGDWSMLLGGFMVAGLLALLV*
Ga0080027_101032651	3300005993	Prmafrost Soil	MQRLTYFTADGRLLGFDTGDWSLLLGGFVVAGLLTLFV*
Ga0080027_104243552	3300005993	Prmafrost Soil	MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV*
Ga0070717_107048762	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MLRLATLRLTDEGRLLGLDTGDWSILLGGFFLAGLVALLV*
Ga0070717_110999582	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	NDTKVVPMLRLTTLRLTSDGRLLGFDPGDWSMLLGGFALAGLLALFV*
Ga0070717_116615111	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MSRLMTLCITTDGRLLGFDAGDWSVLFGGFFLAGLLALVV*
Ga0075023_1000387553	3300006041	Watersheds	MLRSATLRFSGEGRLLGFDTGDWSMLLGGFFLAGLLALMV*
Ga0075023_1001028302	3300006041	Watersheds	MQRLTHFTADGRLLGFDTGDWSLLLGGFVVAGLLTLFV*
Ga0075024_1001196183	3300006047	Watersheds	MLRLTLFTADGRLMGFDTGDWSLLLGGFVVAGLLTLFV*
Ga0075024_1007023112	3300006047	Watersheds	MTRLTTFRLTTDGRLLGFDTGDWSMLLGGFVLAGLLTLFV*
Ga0075028_1000840901	3300006050	Watersheds	MLRSAALRLTPEGRLLGFDTGDWSMLLGGFVLAGLLALMV*
Ga0075028_1005062212	3300006050	Watersheds	MLRLTALRLTSDGRLLGFDSGDWSMLLGGFMVAGLLALLV*
Ga0075028_1007302592	3300006050	Watersheds	MLRTASLHLTAEGRLLGFDIGDWSVLLGGFVLAGLLALMV*
Ga0075029_1013079112	3300006052	Watersheds	MRTGVGIMLPLTHFTTDGRLLGFDLGDWSMLLGGFVLAGLLTLFV*
Ga0075018_1000095614	3300006172	Watersheds	MLRFTQLTTDGRLLGFDTGDWSMLLGGFVLAGLLALFV*
Ga0070765_1004244012	3300006176	Soil	MSRITALRLTSDGRLLGFDTGDWSMLLGGFVLAGLLTLFV*
Ga0070765_1019959691	3300006176	Soil	NGIEASTMLRSTALRYTAQARLLGFDAGDWSMLLGGFFLAGLLALLA*
Ga0105857_11749421	3300009650	Permafrost Soil	MLRTATLRLTAEGRLLGFDTGDWSMLLGGFFLAGLLALMV*
Ga0126373_100088625	3300010048	Tropical Forest Soil	MLRLATNLRLTSDGRLLGFDRGDWSMLLGGFAVAGLLSLLV*
Ga0126373_100268745	3300010048	Tropical Forest Soil	MSRLMTLRITTDGRLLGFDTGDWSILLGGFAVAGLLALMV*
Ga0126373_105954022	3300010048	Tropical Forest Soil	MLRQAALRLTAEGRLLGFDTGDWSILLGGFVLAGLVALLV*
Ga0126373_122015981	3300010048	Tropical Forest Soil	MLRLATNLRFTNDGRLLGFDTGDWSMLLGGFAVAGLLSLLV*
Ga0099796_105032221	3300010159	Vadose Zone Soil	MLRLTTLRLTSDGRLLGFDTGDWSILLGGFVLAGLLAL
Ga0126378_104986042	3300010361	Tropical Forest Soil	MLRFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLTLLV*
Ga0126378_122247321	3300010361	Tropical Forest Soil	MSRLMTLRITTDGRLLGFDTGDWSMLLGGFVLAGLLAMLV*
Ga0126381_1004156072	3300010376	Tropical Forest Soil	MSHLMKLPITTDGRLLGFDTGDWSMLLGGAVLAGLLAMMV*
Ga0126381_1031807891	3300010376	Tropical Forest Soil	MSRLTARLTIDGRLLGFDTGDWSMLLGGFVLAGLVALLV*
Ga0137391_104105722	3300011270	Vadose Zone Soil	MLRLTTLRLTSDGRLLGFDSGDWSMLLGGFVLAGLLTLLV*
Ga0137391_104425251	3300011270	Vadose Zone Soil	AHLTAEGRLLGFDTGDWALLLGGFTLVGFLALLV*
Ga0137393_109212451	3300011271	Vadose Zone Soil	MLRLSTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV*
Ga0137383_101439152	3300012199	Vadose Zone Soil	MLRLATLRFTTDGRLLGFDTGDWSMLVGGFVLAGLVALFI*
Ga0137378_104744042	3300012210	Vadose Zone Soil	MLRLTTLRFTNDGRLLGFDTGDWSMLLGGFALAGLVALLV*
Ga0137360_110009972	3300012361	Vadose Zone Soil	TRKQRFGTMLRLAHFTTDGRLLGFDTGDWSLLLGGFVLAGLLTLFV*
Ga0137398_108571571	3300012683	Vadose Zone Soil	MLRLAHFTTDGRLLGFDTGDWSLLLGGFVLAGLLTLFV*
Ga0137398_109043841	3300012683	Vadose Zone Soil	MSRIIALRITTEGRLLGFDTGDWSMLLGGFVLAGMLSIIL*
Ga0137395_109477361	3300012917	Vadose Zone Soil	MLRFTAIRLTAEGRLLGFDTGDWSMLLGGFFLAGFLALMV*
Ga0137413_113933141	3300012924	Vadose Zone Soil	MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALLV*
Ga0137410_111125111	3300012944	Vadose Zone Soil	MQRLTTLRITSDGRLLGFDTGDWSMLLGGFVLAGLLTLLV*
Ga0182024_100279747	3300014501	Permafrost	MLRLATLRLTSDGRLLGFDTGDWSMLLGGFVLAGLVALLV*
Ga0182024_112337841	3300014501	Permafrost	MLRSAALRCTADGRLLGFDTGDWSMLLGGFVLAGIL
Ga0181522_101741522	3300014657	Bog	VAEETTLEETRFAPMQRLATLRLTSDGRLLGFDTGDWSMLLGGFVLAGLVALFV*
Ga0137412_100320742	3300015242	Vadose Zone Soil	MQRLATMRLTSDGRLLGFDSGDWSMLLGGFFLAGLVTLMV*
Ga0182038_115539021	3300016445	Soil	MSRLMTLRITTDGRLLGFDTGDWSMLLGGLVLAGLLALMV
Ga0187782_108077351	3300017975	Tropical Peatland	MLRLSTLRLTTDGRLLGFDTGDWSMLLGGFALAGLLALLA
Ga0179592_100166171	3300020199	Vadose Zone Soil	MSRIIALRITTEGRLLGFDTGDWSMLLGGFVLAGMLSIIL
Ga0179592_100265264	3300020199	Vadose Zone Soil	MLRLTTLRLTSDGRLLGFDSGDWSMLLGGFVLAGLLTLLV
Ga0210403_100127184	3300020580	Soil	MLRSAALRFTAEGRLLGFDSGDWSMLLGGFFLAGLLALMV
Ga0210403_100515133	3300020580	Soil	MMLWFATDGRLLGFDIGDWSMLLGGFVLAGLLTLLV
Ga0210403_101291264	3300020580	Soil	MLRFAHFTTDGRLLGFDIGDWSMLLGGFVLAGLLTLLV
Ga0210403_101400282	3300020580	Soil	MLRSAAVRFTAEGRLLGFDTGDWSMLLGGFFLAGFLALMV
Ga0210403_102151372	3300020580	Soil	MLRTASLHLTAEGRLLGFDTGDWSMLLGGFFLAGLLALMV
Ga0210403_106606932	3300020580	Soil	MLRLTTLRLTTDGRLLGFDTGDWSMLLGGFMVAGLLALLV
Ga0210399_101392553	3300020581	Soil	MLRSAALRFTTGGRLLGFDTGDWSMLLGGFFLAGFLALMV
Ga0210406_106958151	3300021168	Soil	MLRLTTLRLTSDGRLLGFDTGDWSILLGGFMVAGLLALLV
Ga0210400_103331493	3300021170	Soil	MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLTLFV
Ga0210400_110393461	3300021170	Soil	MTRLTTLRLTTDGRLLGFDSGDWSMLLGGFVVAGLLALLV
Ga0210405_113762432	3300021171	Soil	MLRLTALRLTSDGRLLGFDTGDWSMLLGGFMVAGLLALLV
Ga0213874_100118612	3300021377	Plant Roots	MSRLTARLTIDGRLLGFDTGDWSMLLGGFVLAGLVALLV
Ga0210393_101871992	3300021401	Soil	MLRLATLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV
Ga0210389_103560361	3300021404	Soil	MLRLATLRLTSDGRLLGFDTGDWSMLLGGFVLAGLVALLV
Ga0210387_100540214	3300021405	Soil	MLRFSQFTTDGRLLGLDTGDWSMLLGGLALAGLLILFV
Ga0210394_111981931	3300021420	Soil	MLRSLALRFTAEGRLLGFDTGDWSVLLGGFFVAGLLTLII
Ga0210384_116443872	3300021432	Soil	MLRLTTLRLTNDGRLLGFDTGDWSMLLGGFVLAGLLALLV
Ga0187846_103769941	3300021476	Biofilm	MLRLATNLRFTNDGRLLGFDTGDWSMLLGGFAVAGLLSLLV
Ga0210402_108404711	3300021478	Soil	MLRSAVLRFTAEGRLLGFDTGDWSMLFGGFFLAGLLTLMV
Ga0210402_118369081	3300021478	Soil	MLRSAALRFTAEGRLLGFDTGDWSMLLGGFFLAGLLALMV
Ga0210410_1000641114	3300021479	Soil	MLRFTHFTTDGRLLGLDIGDWSMLLGGFVLAGLLILLV
Ga0126371_100138217	3300021560	Tropical Forest Soil	MLRLATNLRLTSDGRLLGFDRGDWSMLLGGFAVAGLLSLLV
Ga0126371_100665844	3300021560	Tropical Forest Soil	MSRLMTLRITTDGRLLGFDTGDWSILLGGFAVAGLLALMV
Ga0126371_108313252	3300021560	Tropical Forest Soil	MLRQAALRLTAEGRLLGFDTGDWSILLGGFVLAGLVALLV
Ga0126371_115960652	3300021560	Tropical Forest Soil	MLRFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLTLLV
Ga0126371_118903771	3300021560	Tropical Forest Soil	MLLFATTLRLTGDGRLLGFDTGDWSMLLGGFVVAGLLSLLV
Ga0126371_128552511	3300021560	Tropical Forest Soil	MSPRMTSRITTDGRLLGFDTGDWSILLGGAVLAGLLAMMV
Ga0213853_111956394	3300021861	Watersheds	MLRTASLHLTAEGRLLGFDIGDWSVLLGGFVLAGLLALMV
Ga0209871_10773632	3300026217	Permafrost Soil	MLRSATLRFSGEGRLLGFDTGDWSMLLGGFFLAGLLALMV
Ga0257157_10361433	3300026496	Soil	MLRFTHFTTDGRLLGFDTGDWSMLLGGFVLAGLLTLFV
Ga0257157_10698801	3300026496	Soil	MFARMTAQRRLLGFDIGDWSMLLGGLTLAGVLALLI
Ga0209648_100279507	3300026551	Grasslands Soil	MLRLTTLRVTSDGRLLGFDTGDWSMLLGGFVLAGLLALLV
Ga0179593_10240242	3300026555	Vadose Zone Soil	MLRLATLRFTTDGRLLGFDTGDWSMLLGGFVLAGLVALLV
Ga0179587_106474512	3300026557	Vadose Zone Soil	MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFMLAGLLALFV
Ga0208984_11329612	3300027546	Forest Soil	MQRLTTLHLTTDGRLLGFDTGDWSMLLGGFVLAGLLTLFV
Ga0209733_10048864	3300027591	Forest Soil	MFMRMTAQRRLLGLDIGDWSMLLGGLTLAGVLALFI
Ga0209328_102053061	3300027727	Forest Soil	MLRLTTTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLTLFV
Ga0208989_103056631	3300027738	Forest Soil	MQRLTALHLTTDGRLLGFDTGDWSMLLGGFVLAGLLTLFV
Ga0209579_106611121	3300027869	Surface Soil	TLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV
Ga0209068_100007687	3300027894	Watersheds	MQRLTYFTADGRLLGFDTGDWSLLLGGFVVAGLLTLFV
Ga0209068_100012783	3300027894	Watersheds	MLRFTQLTTDGRLLGFDTGDWSMLLGGFVLAGLLALFV
Ga0209048_101494253	3300027902	Freshwater Lake Sediment	MLRLTTLRLTTDGRLLGFDTGDWSMLLGGFVLAGLVALFV
Ga0209048_107812271	3300027902	Freshwater Lake Sediment	MLRTATLRLTAEGRLLGFDTGDWSMLLGGFFLAGLLALMV
Ga0209488_109356232	3300027903	Vadose Zone Soil	MLRLTTLRLTSDGRLLGFDSGDWSMLLGGFVLAGLLTLFV
Ga0209698_108330582	3300027911	Watersheds	MRTGVGIMLPLTHFTTDGRLLGFDLGDWSMLLGGFVLAGLLTLFV
Ga0209069_107801711	3300027915	Watersheds	MTRLTTFRLTTDGRLLGFDTGDWSMLLGGFVLAGLLTLF
Ga0209062_1000188144	3300027965	Surface Soil	MLRIATLRLTSDGRLLGFDTGDWSMLLGGFALAGLLALFV
Ga0209526_103751281	3300028047	Forest Soil	MLRLTTTLRLTSDGRLLGFDTGDWSMLLGGLVLAGLVTLFV
Ga0137415_113012221	3300028536	Vadose Zone Soil	MLRLSTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV
Ga0308309_113252141	3300028906	Soil	LTKVAMMSRLTTLRLTTDGRLLGFDTGDWSMLLGGFVLAGLLALLV
Ga0170834_1003394742	3300031057	Forest Soil	MMLRFATDGRLLGFDIGDWSMLLGGFVLAGLLTLLV
Ga0318542_105968412	3300031668	Soil	MDASKMLRYAALGLRAEGRLLGLDTGDWSMLIGGFFLAGLLALMA
Ga0307476_102086321	3300031715	Hardwood Forest Soil	MSRLAARLTTDGRLLGFDTGDWSMLLGGFVLAALLALLV
Ga0318550_104126241	3300031797	Soil	MLRYAALGLRAEGRLLGLDTGDWSMLIGGFFLAGLLA
Ga0306919_103960852	3300031879	Soil	MLRFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLSLLV
Ga0306925_100291814	3300031890	Soil	MLRYAALGLRAEGRLLGLDTGDWSMLIGGFFLAGLLALMA
Ga0306925_109285402	3300031890	Soil	MSRLMTLRITTDGRLLGFDTGDWSMLLGGFVLAGLLAMLV
Ga0310912_105382002	3300031941	Soil	RFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLSLLV
Ga0306926_120377381	3300031954	Soil	ATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLSLLV
Ga0306924_118255391	3300032076	Soil	MSRLATLRITTDGRLLGFDTGDWSMLLGGFVLAGLLAMLV
Ga0306920_1011365581	3300032261	Soil	MSNNKHQGYPMSRLMTLRITTDGRLLGFDTGDWSMLLGGFVLAGLLAMLV
Ga0306920_1017562091	3300032261	Soil	MSRLMTLRIATDGRLLGFDTGDWSMLLGGFFLAGVLALMV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F073986

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences