| Basic Information | |
|---|---|
| Family ID | F073959 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MFDFAVLAIGRADEADRITAVALNFEMKGKRFAFDGYYKSKLIK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.90 % |
| % of genes near scaffold ends (potentially truncated) | 47.50 % |
| % of genes from short scaffolds (< 2000 bps) | 85.83 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.56% β-sheet: 0.00% Coil/Unstructured: 44.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 22.50 |
| PF13564 | DoxX_2 | 1.67 |
| PF01526 | DDE_Tnp_Tn3 | 1.67 |
| PF11818 | DUF3340 | 1.67 |
| PF00274 | Glycolytic | 0.83 |
| PF03466 | LysR_substrate | 0.83 |
| PF08240 | ADH_N | 0.83 |
| PF13450 | NAD_binding_8 | 0.83 |
| PF00210 | Ferritin | 0.83 |
| PF13533 | Biotin_lipoyl_2 | 0.83 |
| PF09995 | MPAB_Lcp_cat | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| PF13377 | Peripla_BP_3 | 0.83 |
| PF08388 | GIIM | 0.83 |
| PF02371 | Transposase_20 | 0.83 |
| PF09364 | XFP_N | 0.83 |
| PF00805 | Pentapeptide | 0.83 |
| PF00107 | ADH_zinc_N | 0.83 |
| PF00702 | Hydrolase | 0.83 |
| PF14691 | Fer4_20 | 0.83 |
| PF04984 | Phage_sheath_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 22.50 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 22.50 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 22.50 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 22.50 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 22.50 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 22.50 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 1.67 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.83 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.83 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.00 % |
| Unclassified | root | N/A | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01E26NZ | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 2170459004|F62QY1Z01BF6J1 | Not Available | 530 | Open in IMG/M |
| 2170459005|F1BAP7Q01A3NMR | Not Available | 510 | Open in IMG/M |
| 2170459010|GIO7OMY02GRL7R | Not Available | 525 | Open in IMG/M |
| 3300001083|JGI12678J13193_1000919 | Not Available | 1590 | Open in IMG/M |
| 3300001083|JGI12678J13193_1003714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 651 | Open in IMG/M |
| 3300001178|JGI12646J13576_102171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 738 | Open in IMG/M |
| 3300001178|JGI12646J13576_102192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 734 | Open in IMG/M |
| 3300001612|JGI20251J16332_10015 | Not Available | 1748 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100217949 | Not Available | 1801 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100887667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 773 | Open in IMG/M |
| 3300003218|JGI26339J46600_10012700 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300003219|JGI26341J46601_10090437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 904 | Open in IMG/M |
| 3300003223|JGI26343J46809_1001624 | Not Available | 1579 | Open in IMG/M |
| 3300003223|JGI26343J46809_1002237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → unclassified Thiohalocapsa → Thiohalocapsa sp. PB-PSB1 | 1412 | Open in IMG/M |
| 3300003368|JGI26340J50214_10081482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 847 | Open in IMG/M |
| 3300004081|Ga0063454_100029310 | Not Available | 1902 | Open in IMG/M |
| 3300005434|Ga0070709_10119751 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300005434|Ga0070709_10388359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 1039 | Open in IMG/M |
| 3300005437|Ga0070710_10190535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 1289 | Open in IMG/M |
| 3300005437|Ga0070710_10546355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 799 | Open in IMG/M |
| 3300005439|Ga0070711_100641621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 889 | Open in IMG/M |
| 3300005439|Ga0070711_101074986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 692 | Open in IMG/M |
| 3300005445|Ga0070708_101047321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 764 | Open in IMG/M |
| 3300005445|Ga0070708_101219600 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005454|Ga0066687_10138811 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300005467|Ga0070706_100420784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1243 | Open in IMG/M |
| 3300005471|Ga0070698_100818690 | Not Available | 875 | Open in IMG/M |
| 3300005549|Ga0070704_100192718 | Not Available | 1639 | Open in IMG/M |
| 3300005610|Ga0070763_10697052 | Not Available | 594 | Open in IMG/M |
| 3300006028|Ga0070717_10452341 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300006028|Ga0070717_11676550 | Not Available | 575 | Open in IMG/M |
| 3300006052|Ga0075029_100228216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. Nm84 | 1170 | Open in IMG/M |
| 3300006059|Ga0075017_100571296 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300006059|Ga0075017_100762356 | Not Available | 746 | Open in IMG/M |
| 3300006086|Ga0075019_10065840 | Not Available | 2053 | Open in IMG/M |
| 3300006102|Ga0075015_100992454 | Not Available | 513 | Open in IMG/M |
| 3300006172|Ga0075018_10636594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300006175|Ga0070712_101389359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 612 | Open in IMG/M |
| 3300006354|Ga0075021_10837178 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 595 | Open in IMG/M |
| 3300007788|Ga0099795_10095821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 1157 | Open in IMG/M |
| 3300007788|Ga0099795_10542167 | Not Available | 547 | Open in IMG/M |
| 3300009143|Ga0099792_10222776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1084 | Open in IMG/M |
| 3300010339|Ga0074046_10387185 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 846 | Open in IMG/M |
| 3300010341|Ga0074045_10206517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1313 | Open in IMG/M |
| 3300010341|Ga0074045_10841247 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 580 | Open in IMG/M |
| 3300010341|Ga0074045_10932014 | Not Available | 547 | Open in IMG/M |
| 3300010341|Ga0074045_10999161 | Not Available | 526 | Open in IMG/M |
| 3300010343|Ga0074044_10003000 | All Organisms → cellular organisms → Bacteria | 14561 | Open in IMG/M |
| 3300010343|Ga0074044_10046231 | Not Available | 3005 | Open in IMG/M |
| 3300010343|Ga0074044_10264846 | Not Available | 1133 | Open in IMG/M |
| 3300010343|Ga0074044_10345779 | Not Available | 976 | Open in IMG/M |
| 3300010343|Ga0074044_10550213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 753 | Open in IMG/M |
| 3300010371|Ga0134125_11771211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 672 | Open in IMG/M |
| 3300012199|Ga0137383_10534705 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300012205|Ga0137362_11050983 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012361|Ga0137360_10318254 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1296 | Open in IMG/M |
| 3300012361|Ga0137360_10826879 | Not Available | 797 | Open in IMG/M |
| 3300012361|Ga0137360_10950907 | Not Available | 741 | Open in IMG/M |
| 3300012361|Ga0137360_11690731 | Not Available | 538 | Open in IMG/M |
| 3300012685|Ga0137397_10884247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 662 | Open in IMG/M |
| 3300012917|Ga0137395_10308501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → unclassified Thiohalocapsa → Thiohalocapsa sp. PB-PSB1 | 1122 | Open in IMG/M |
| 3300012922|Ga0137394_11375797 | Not Available | 567 | Open in IMG/M |
| 3300012955|Ga0164298_10210464 | Not Available | 1144 | Open in IMG/M |
| 3300014156|Ga0181518_10160050 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia ecosi | 1200 | Open in IMG/M |
| 3300014200|Ga0181526_10624513 | Not Available | 680 | Open in IMG/M |
| 3300017930|Ga0187825_10188201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300017946|Ga0187879_10456815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13 | 708 | Open in IMG/M |
| 3300017947|Ga0187785_10197275 | Not Available | 874 | Open in IMG/M |
| 3300017994|Ga0187822_10320022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 552 | Open in IMG/M |
| 3300020579|Ga0210407_10137896 | Not Available | 1874 | Open in IMG/M |
| 3300021171|Ga0210405_10080449 | Not Available | 2568 | Open in IMG/M |
| 3300021171|Ga0210405_11286861 | Not Available | 537 | Open in IMG/M |
| 3300021401|Ga0210393_10312742 | Not Available | 1277 | Open in IMG/M |
| 3300021403|Ga0210397_10009652 | All Organisms → cellular organisms → Bacteria | 5828 | Open in IMG/M |
| 3300021404|Ga0210389_10018871 | All Organisms → cellular organisms → Bacteria | 5330 | Open in IMG/M |
| 3300021404|Ga0210389_10300776 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300021405|Ga0210387_10255425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1534 | Open in IMG/M |
| 3300021405|Ga0210387_10494193 | Not Available | 1087 | Open in IMG/M |
| 3300021407|Ga0210383_10082704 | All Organisms → cellular organisms → Bacteria | 2689 | Open in IMG/M |
| 3300021407|Ga0210383_10084338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2664 | Open in IMG/M |
| 3300021439|Ga0213879_10012727 | Not Available | 1873 | Open in IMG/M |
| 3300021478|Ga0210402_11622977 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia ecosi | 573 | Open in IMG/M |
| 3300022507|Ga0222729_1071920 | Not Available | 511 | Open in IMG/M |
| 3300022714|Ga0242671_1006079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1322 | Open in IMG/M |
| 3300022715|Ga0242678_1007051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1112 | Open in IMG/M |
| 3300023056|Ga0233357_1001708 | Not Available | 1732 | Open in IMG/M |
| 3300024288|Ga0179589_10205248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 862 | Open in IMG/M |
| 3300025922|Ga0207646_10756608 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300025922|Ga0207646_11169154 | Not Available | 675 | Open in IMG/M |
| 3300025939|Ga0207665_10833950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 729 | Open in IMG/M |
| 3300026340|Ga0257162_1035178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 621 | Open in IMG/M |
| 3300026354|Ga0257180_1032094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 716 | Open in IMG/M |
| 3300026355|Ga0257149_1042230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 653 | Open in IMG/M |
| 3300026475|Ga0257147_1038795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300026507|Ga0257165_1042991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 806 | Open in IMG/M |
| 3300026880|Ga0209623_1000457 | Not Available | 1752 | Open in IMG/M |
| 3300027000|Ga0207803_1037150 | Not Available | 569 | Open in IMG/M |
| 3300027297|Ga0208241_1002993 | Not Available | 2070 | Open in IMG/M |
| 3300027521|Ga0209524_1121837 | Not Available | 544 | Open in IMG/M |
| 3300027546|Ga0208984_1021153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → unclassified Thiohalocapsa → Thiohalocapsa sp. PB-PSB1 | 1319 | Open in IMG/M |
| 3300027575|Ga0209525_1154952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 522 | Open in IMG/M |
| 3300027674|Ga0209118_1027071 | Not Available | 1780 | Open in IMG/M |
| 3300027680|Ga0207826_1006932 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
| 3300027681|Ga0208991_1147968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 695 | Open in IMG/M |
| 3300027698|Ga0209446_1014803 | Not Available | 1920 | Open in IMG/M |
| 3300027701|Ga0209447_10191057 | Not Available | 561 | Open in IMG/M |
| 3300027812|Ga0209656_10005889 | All Organisms → cellular organisms → Bacteria | 7865 | Open in IMG/M |
| 3300027812|Ga0209656_10023037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa bogorovii | 3785 | Open in IMG/M |
| 3300027812|Ga0209656_10045966 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
| 3300027889|Ga0209380_10059130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 2180 | Open in IMG/M |
| 3300028023|Ga0265357_1010850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 922 | Open in IMG/M |
| 3300030937|Ga0138302_1473307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales endosymbiont of Peranema trichophorum | 871 | Open in IMG/M |
| 3300031718|Ga0307474_10117297 | Not Available | 1996 | Open in IMG/M |
| 3300031720|Ga0307469_11739722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 601 | Open in IMG/M |
| 3300031754|Ga0307475_11268751 | Not Available | 572 | Open in IMG/M |
| 3300031820|Ga0307473_11140861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 576 | Open in IMG/M |
| 3300031962|Ga0307479_11970214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 533 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 13.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 8.33% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 8.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.17% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300001083 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 | Environmental | Open in IMG/M |
| 3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001178 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 | Environmental | Open in IMG/M |
| 3300001612 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF017 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026880 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_2556820 | 2035918004 | Soil | AQAGDAAVGGMFDFAVLAIGRADEADRITAVALNFEMKGKRFAFDGYYKKQINQMISTN |
| E4B_04631070 | 2170459004 | Grass Soil | MLDFAIFAKGRADETDRITAVALNFEVKGKRFGFYGYRINILTS |
| E41_06196860 | 2170459005 | Grass Soil | MLDFAIFAKGRADETDRITAVALNFEMKGKRFAFNGYPMSILTS |
| F62_02073740 | 2170459010 | Grass Soil | GDATVRGMLDFAIFAKGRADETDRITAVALNFEVKGKRFAFNGYIISILTS |
| JGI12678J13193_10009192 | 3300001083 | Forest Soil | MGGMFDFAVLAIGRADEADRITAVALNFEMKGKRFAFDGYYKSKLIK* |
| JGI12678J13193_10037142 | 3300001083 | Forest Soil | VSGVFDFAVFAIGRADQADRITAVALNFEMKGKRFAFDGY* |
| JGI12654J13325_10005402 | 3300001160 | Forest Soil | MFDFAALAEGGADETDRITPVGLNFEMKPGRIAFDGYYITLFTC* |
| JGI12646J13576_1021711 | 3300001178 | Forest Soil | VSGVFDFAVFAIGRADQADRSTAVALNFEMKRKRFAVDGYPISILIN |
| JGI12646J13576_1021921 | 3300001178 | Forest Soil | MLDLAIFAKGRADETDRITAVALNFEMKGKRFAFNGYRISILTSQNQ |
| JGI20251J16332_100152 | 3300001612 | Forest Soil | MLDFAIFAKGRADETDRITAVALNFEVKGKRFAFNGYRISILTG* |
| JGIcombinedJ26739_1002179492 | 3300002245 | Forest Soil | MLDFAIFAKGRADETDRMTAVALNFEMKGKRFAFNGYLKSTLTS* |
| JGIcombinedJ26739_1002232992 | 3300002245 | Forest Soil | MFDFAALAEGGADETDRITPVGLNFEMKPGRIAFDGYYITLLTC* |
| JGIcombinedJ26739_1008876672 | 3300002245 | Forest Soil | VFDFAVFAIGRADQADRSTAVALNFEMKRKRFAVDGYPISILINHTQQINSK |
| JGI26339J46600_100127002 | 3300003218 | Bog Forest Soil | VFDFAVLAIGRADKAERITAVALNFKMKGKRFAFDGYQKSKLIY* |
| JGI26341J46601_100904372 | 3300003219 | Bog Forest Soil | VSGVFDFAVLAIGRADKAERITAVALNFKMKGKRFAFDGYQKSKLIY* |
| JGI26343J46809_10016242 | 3300003223 | Bog Forest Soil | VFDFAVLAIGRADKADRITAVALNFKMKGKRFAFDGYQKSRLIY* |
| JGI26343J46809_10022372 | 3300003223 | Bog Forest Soil | VSGVFDFAVLAIGRADKADRITAVALNFKMKGKRFAFDGYQKSRLIY* |
| JGI26340J50214_100814821 | 3300003368 | Bog Forest Soil | VFDFAVLAIGRADKADRITAVALNFKMKGKRFAFDGYQKSKLIY* |
| Ga0063454_1000293102 | 3300004081 | Soil | VGGMFDFALLAKGRADEADWSTAVALNFEMKGKEFAFNGY* |
| Ga0070709_101197512 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDFAIFAKGRADKTDRITAVALNFEVKGKRFVFNGYRISILTSQNQV* |
| Ga0070709_103883591 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VFDFAVFAIGRTDEADRSAAVALNFEMKGKRFAFDGYLISKIIR* |
| Ga0070710_101905352 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDFAIFAKGRADKTDRITAVALNFEVKGKRFAFNGYRISILTSQNQV* |
| Ga0070710_105463551 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VFDFAVFAIGRADQADRSTAVALNFEMKRKRFAVDGYPISILINHTQQINS |
| Ga0070711_1006416212 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGVFDFAVFAIGRTDEADRSAAVALNFEMKGKRFAFDGYLTSKIIR* |
| Ga0070711_1010749861 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDFAIFAKGRADETDRITAVALNFEVKGKRFAFNGYRISILTSHNQA* |
| Ga0070708_1010473212 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDFAVLAIGRADEADRITAVALNFEMKGKRFAFDGYYKSKLIK* |
| Ga0070708_1012196001 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DFAVLAKRRADEADRITAVALNFEMKGKRLAFDGYQISTSINNNQSHIA* |
| Ga0066687_101388112 | 3300005454 | Soil | VFDFAVLAIGRADKADRITAVALNFKMKGKRFAFDGYHKSKLIN* |
| Ga0070706_1004207842 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GGMFDFAVLAKRRADEADRITAVALNFEMKGKRVAFNGYQISMSISNDQ* |
| Ga0070698_1008186902 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGMFDFAVLAKRRADEADRITAVALNFEMKGKRFAFDNQISTSINNNQSHIA* |
| Ga0070704_1001927181 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGVFDFAVLAKRRADEADRITAVALNFEMKGKRFAFDGYYKSKLIK* |
| Ga0070763_106970521 | 3300005610 | Soil | GMLDFAIFAKGRADETDRITAVALNFEVKGKMFAFNGYRISILTG* |
| Ga0070717_104523414 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AGDASVGGMFDFAVLAKRRADEADRITAVALNFEMKGKRVAFNGYQISMSINNNQ* |
| Ga0070717_116765501 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGMFDFAVLAKRRADEADRITAVALNFEMKGKRFAFDGY* |
| Ga0075029_1002282162 | 3300006052 | Watersheds | RVLDFAMLAIGRAEEADRITAVALNFEMKGKWFASDGH* |
| Ga0075017_1005712962 | 3300006059 | Watersheds | VSGVFDFAVLAIGRADKADRITAVALNFKMKGKRFAFDGYQKSKLIY* |
| Ga0075017_1007623562 | 3300006059 | Watersheds | SQAGDAPMGRVLDFAMLAIGRAEEADRITAVALNFEMKGKRFASDGH* |
| Ga0075019_100658403 | 3300006086 | Watersheds | VSGVFDFAVLAIGRADKADRITAVALNFKMKGKRFAFYGYQKSKLIY* |
| Ga0075015_1009924541 | 3300006102 | Watersheds | ASVGGMFDFAVLAKRRADDADRITAVALNFEMKWKRFAFDGYQISTLINPNQLK* |
| Ga0075018_106365941 | 3300006172 | Watersheds | GDASVGGMFDFAVLAKRRADEADRITAVALNFEMKGKRFAFDGYQISTSINNNQSHIV* |
| Ga0070712_1013893591 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGVFDFAVFAIGRTDEADRSAAVALNFEMKGKRFAFDGYLISKIIR* |
| Ga0075021_108371782 | 3300006354 | Watersheds | VFDFAVFAIGRTDEADRSTAVALNFEMKGKRFAFDGYPMSISTG* |
| Ga0099795_100958211 | 3300007788 | Vadose Zone Soil | MFDSAVLAKRRADDADRITAVALNFEMKGKRFAFDGYPISTLIN* |
| Ga0099795_105421671 | 3300007788 | Vadose Zone Soil | AVSGVFDFAVFAIGRTDEADRSAAVALNFEMKGKRFAFDGYLISKIIR* |
| Ga0099792_102227762 | 3300009143 | Vadose Zone Soil | VFDFAVFAIGRADQADRSTAVALNFEMKRKRFAVDGYLISKIINQ* |
| Ga0074046_103871852 | 3300010339 | Bog Forest Soil | GMFDFAVLAIGRADQADRITAVALNFEMKGERFASNGHQIRTLNSNNQAKTT* |
| Ga0074045_102065173 | 3300010341 | Bog Forest Soil | GRADKAERITAVALNFKMKGKKIAFDGYQKSKLIY* |
| Ga0074045_108412471 | 3300010341 | Bog Forest Soil | VLAIGRADKADRITAVALNFKMKGKRFAFDGYQKSRLIY* |
| Ga0074045_109320142 | 3300010341 | Bog Forest Soil | PMGRVLDFAMLAIGRAEEADRITAVALNFEMKGKWFASDGH* |
| Ga0074045_109991612 | 3300010341 | Bog Forest Soil | GDAPMGRVLDFAMLAIGRAEEADRITAVALNFEMKGKWFASNGH* |
| Ga0074044_1000300017 | 3300010343 | Bog Forest Soil | DFAVLAIGRADKAERITAVALNFKMKGKRFAFDGYQKSKLIH* |
| Ga0074044_100462313 | 3300010343 | Bog Forest Soil | VLDFAMLAIGRAEEADRITAVALNFEMKGKWFASDGH* |
| Ga0074044_102648463 | 3300010343 | Bog Forest Soil | DAAVGGMFDFAVLAIGRADQADRITAVALNFEMKGERFASNGHQVSTLNSNNQAKTT* |
| Ga0074044_103457791 | 3300010343 | Bog Forest Soil | AVGGMFDFPVLAIGRADQADRITAVALNFEMKGERFVSNGHKISTLNSNNQEKTT* |
| Ga0074044_105502132 | 3300010343 | Bog Forest Soil | MLDFAVFAIGRTDEADRITAVALNFEMKGERSVFNGY* |
| Ga0134125_117712111 | 3300010371 | Terrestrial Soil | MFDFALLAKGGADETDRSTAVALNFEMKGKRFAFDGYYKSKLIK* |
| Ga0137383_105347052 | 3300012199 | Vadose Zone Soil | VGGMFDFAVLAIGRADQADRITAVALNFEMKGERFASNGHQISALNSNNQAKTI* |
| Ga0137362_110509832 | 3300012205 | Vadose Zone Soil | MLDFAIFAKGRADETDRITAVALNFEVKGKRFAFNGYRISILNR* |
| Ga0137360_103182543 | 3300012361 | Vadose Zone Soil | DFALLAKRGADEADRITAVALNFEVKRERFAFNGH* |
| Ga0137360_108268792 | 3300012361 | Vadose Zone Soil | AAVGGMFDFAVLAIGRADEADRITAVALNFEMKGKRFAFDGYYKSKLIK* |
| Ga0137360_109509071 | 3300012361 | Vadose Zone Soil | GGMFDFALLAKRGADEADRITAVALNFEVKGERFAFNGH* |
| Ga0137360_116907312 | 3300012361 | Vadose Zone Soil | MLDFAIFAKGRADETDRITAVALNFEVKGKRFAFNGY* |
| Ga0137397_108842472 | 3300012685 | Vadose Zone Soil | MLDFAIFAKGRADETDRITAVALNFEMKGKRFAFNGYPMSILTS* |
| Ga0137395_103085011 | 3300012917 | Vadose Zone Soil | MFDFAVLAIGRADQADRITAVALNFEMKGKRFAFDGYLISKIIR* |
| Ga0137394_113757971 | 3300012922 | Vadose Zone Soil | MLDFAIFAKGRADETDRITAVALNFEVKGKRFAFNGYRISILTS* |
| Ga0164298_102104641 | 3300012955 | Soil | VFDFAVFAIGRTDEADRSAAVALNFEMKGKRFAFDGYLTSKIIR* |
| Ga0181518_101600501 | 3300014156 | Bog | MFDFAVLAIGRADQADRITAVALNFEMKGKRFAFNGHQISTLNSNNQAKTT* |
| Ga0181526_106245132 | 3300014200 | Bog | MTVRQGRSPIQAGDAAVGGMFDFAIFAKGRADETDRITAVTLNFEMKGAWPAFNGYQISI |
| Ga0187825_101882011 | 3300017930 | Freshwater Sediment | VSGVFDFAVLAIGRADKADRITAVALNFKMKGKRFAFDGYQKSKLIY |
| Ga0187879_104568151 | 3300017946 | Peatland | DFAVLAIGRADQADRITAVALNFEMKGDRFASNGHQISTLNSNNQVKTL |
| Ga0187785_101972751 | 3300017947 | Tropical Peatland | LQQFELPQTQAGDAPVSGMFDFAILAIGGADEADRIAAGALNLEMEGKRFSFNGH |
| Ga0187822_103200222 | 3300017994 | Freshwater Sediment | MFDFAVLAIGRADKADRITAVALNFKMKGKRFAFDGYQKSKLIY |
| Ga0210407_101378962 | 3300020579 | Soil | MLDFAIFAKGRADETDRITAVALNFEVKGKRFAFNGYRISILTG |
| Ga0210405_100804491 | 3300021171 | Soil | VFDFAVFAIGRADQADRITAVALNFEMKGKRFAFDGYQKSKLIN |
| Ga0210405_112868612 | 3300021171 | Soil | MLDFAIFAKGRTDETDRMTAVALNFEMKGKRFAFNGYLRSTLTS |
| Ga0210393_103127421 | 3300021401 | Soil | GMLDFAIFAKGRADETDRITAVALNFEVKGKRCAFNGYRTSILNS |
| Ga0210397_100096521 | 3300021403 | Soil | DATVGGMLDFAIFAKGRADETDRITPVALNFEMKGKRFAFNGYQISILAS |
| Ga0210389_100188711 | 3300021404 | Soil | DATVGGMLDFAIFAKGRADETDRITAVALNFEMKGKRFAFNGYQISILAS |
| Ga0210389_103007761 | 3300021404 | Soil | TVGGMLDFAIFAKGRADETDRITAVALNFEMKGKRFAFNGY |
| Ga0210387_102554251 | 3300021405 | Soil | FAKGRADETDRITAVALNFEVKGKRFAFNGYRISMLTS |
| Ga0210387_104941932 | 3300021405 | Soil | FAKGRADETDRITAVALNFEVKGKRFAFNGYRISILTG |
| Ga0210383_100827041 | 3300021407 | Soil | ATVGGMLDFAIFAKGRADETDRITAVALNFEMKGKRFAFNGY |
| Ga0210383_100843385 | 3300021407 | Soil | DFAIFAKGRADETDRITAVALNFEVKGKRFAFNGYRISILTG |
| Ga0213879_100127271 | 3300021439 | Bulk Soil | MFDFAVLAKRRADDADRITAVALNFEMKWKRFAFDGY |
| Ga0210402_116229772 | 3300021478 | Soil | SGMLDLAIFAKGRADETDRITAVALNFEMKGKRFAFNGYRISIFTS |
| Ga0222729_10719201 | 3300022507 | Soil | VGGMLDFAIFAKGRADETDRITAVALNFEVKGKRVAFNGY |
| Ga0242671_10060792 | 3300022714 | Soil | MLDFAIFAKGRADETDRITAVALNFEMKGKRFAFNGYRISILTG |
| Ga0242678_10070512 | 3300022715 | Soil | MFDFAVLAKRRADDADRITAVALNFEVKGKRFAFNGYRISILTS |
| Ga0233357_10017081 | 3300023056 | Soil | VFDFAVFAIGRADQADRITAVALNFEMKGKRFAFDGY |
| Ga0179589_102052481 | 3300024288 | Vadose Zone Soil | VFDFAVFAIGRADQADRSTAVALNFEMKRKRFAVDGYPISILI |
| Ga0207646_107566083 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DAAVGGMFDFALLAKRGADEADRITAVALNFEAKGERFAFNGHQISI |
| Ga0207646_111691541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GDAAVGGMFDFALLAKRGADEADRITAVALNFEVKGERFAFNGHQISI |
| Ga0207665_108339502 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGVFDFAVFAIGRTDEADRSAAVALNFEMKGKRFAFDGYLISKIIR |
| Ga0257162_10351781 | 3300026340 | Soil | MFDSAVLAKRRADDADRITAVALNFEMKGKRFAFDGYPISTLINENQSQLF |
| Ga0257180_10320941 | 3300026354 | Soil | VFDFAVLAIGRADEADRITAVALNFEMKGKRFAFDGY |
| Ga0257149_10422302 | 3300026355 | Soil | VSGVFDFAVFAIGRADQADRITAVALNFEMKGKRFAFDGY |
| Ga0257147_10387951 | 3300026475 | Soil | MLDFAIFAKGRANETDRITAVALNFEVKGKRFAFNGYRISILTSHNQAYN |
| Ga0257165_10429912 | 3300026507 | Soil | MLDFAIFAKGRTDETDRMTAVALNFEMKGKRFAFNGYLR |
| Ga0209623_10004572 | 3300026880 | Forest Soil | VSGVFDFAVLAIGRADQADRITAVALNFEMKGKRFAFDGY |
| Ga0207803_10371502 | 3300027000 | Tropical Forest Soil | GGMFDFAVLAIGRADQADRSPAVALNFEMKWQRFAFNGH |
| Ga0208241_10029932 | 3300027297 | Forest Soil | MLDLAIFAKGRADETDRITAVALNFEMKGKRFAFNGYRISILTG |
| Ga0209524_11218372 | 3300027521 | Forest Soil | AVLAIGRADEADRITAVALNFEMKGKRFAFDGYHKNKLIN |
| Ga0208984_10211532 | 3300027546 | Forest Soil | MLDFAIFAKGRADETDRITAVALNFEMKGKRFSFNGYSISILTSYNQVQNI |
| Ga0209525_11549521 | 3300027575 | Forest Soil | MLDFAIFAKGRADETDRMTAVALNFEMKGKRFAFNGYLKSTLTS |
| Ga0209118_10270712 | 3300027674 | Forest Soil | VSGVFDFAVLAIGRADEADRITAVALNFEMKGKRFAFDGYYKSKLIK |
| Ga0207826_10069322 | 3300027680 | Tropical Forest Soil | VGGVFDFALLAKGGADKADRSPAVALNLEVKRERSAFNGH |
| Ga0208991_11479681 | 3300027681 | Forest Soil | MLDFAIFAKGRADETDRITAVALNFEMKGKRFSFNGYSISILTSYNQVKNIK |
| Ga0209446_10148031 | 3300027698 | Bog Forest Soil | VFDFAVLAIGRADKADRITAVALNFKMKGKRFAFDGYQKSRLIY |
| Ga0209447_101910571 | 3300027701 | Bog Forest Soil | AVGGVFDFAVLAIGRADEADRSTAVALNFEMKRKRFAFNGHQKSIIVRYNQVKM |
| Ga0209656_1000588910 | 3300027812 | Bog Forest Soil | APMGRVLDFAMLAIGRAEEADRITAVALNFEMKGKWFASDGH |
| Ga0209656_100230371 | 3300027812 | Bog Forest Soil | VSGVFDFAVLAIGRADKAERITAVALNFKMKGKRFAFDGYQKSKLIY |
| Ga0209656_100459663 | 3300027812 | Bog Forest Soil | SGVFDFAVLAIGRADKAERITAVALNFKMKGKRFAFDGYQKSKLIN |
| Ga0209380_100591302 | 3300027889 | Soil | AQAGDAAVGGMFDFAVLAIGRADEADRITAVALNFEMKGKRFAFDGYHKSKLIN |
| Ga0265357_10108501 | 3300028023 | Rhizosphere | MLDLAIFAKGRADETDRITAVALNFEMKGKRFAFNGYRISILT |
| Ga0138302_14733072 | 3300030937 | Soil | MLDFAIFAKGRADETDRITAVALNFEVKGKRFAFNGYRIST |
| Ga0307474_101172973 | 3300031718 | Hardwood Forest Soil | MFDFALLAIGGADEADRITAVALNFEVKRGWFATNGY |
| Ga0307469_117397222 | 3300031720 | Hardwood Forest Soil | MFDFAVLAKRRADEADRITAVALNFEMKGKRFAFDGYYKSKLIK |
| Ga0307475_112687511 | 3300031754 | Hardwood Forest Soil | AAVGGMFDFALLAKGGADETDRSTAVALNFEMKGKGLAFNGHQISILTRK |
| Ga0307473_111408611 | 3300031820 | Hardwood Forest Soil | MLDFAIFAKGRADETDRITAVALNFEMKGKRFAFNGYL |
| Ga0307479_119702142 | 3300031962 | Hardwood Forest Soil | MFDFAVLAIGRADEADRITAVALNFEMKGKRFAFDGYYKSKLIK |
| ⦗Top⦘ |