| Basic Information | |
|---|---|
| Family ID | F073948 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MPTVALDVPSAHVLADQASIIQDLQFVMDCCKRLLTELAKPEEDRDP |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.83 % |
| % of genes near scaffold ends (potentially truncated) | 97.50 % |
| % of genes from short scaffolds (< 2000 bps) | 95.00 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.167 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.33% β-sheet: 0.00% Coil/Unstructured: 54.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF09995 | MPAB_Lcp_cat | 50.00 |
| PF00248 | Aldo_ket_red | 7.50 |
| PF00313 | CSD | 5.83 |
| PF03729 | DUF308 | 4.17 |
| PF00578 | AhpC-TSA | 2.50 |
| PF01927 | Mut7-C | 0.83 |
| PF07730 | HisKA_3 | 0.83 |
| PF14226 | DIOX_N | 0.83 |
| PF00009 | GTP_EFTU | 0.83 |
| PF00296 | Bac_luciferase | 0.83 |
| PF00534 | Glycos_transf_1 | 0.83 |
| PF00583 | Acetyltransf_1 | 0.83 |
| PF08281 | Sigma70_r4_2 | 0.83 |
| PF10604 | Polyketide_cyc2 | 0.83 |
| PF12146 | Hydrolase_4 | 0.83 |
| PF02518 | HATPase_c | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 4.17 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.83 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.83 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.83 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.83 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.83 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.17 % |
| Unclassified | root | N/A | 45.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_166567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1091 | Open in IMG/M |
| 3300001356|JGI12269J14319_10172885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. P1 | 887 | Open in IMG/M |
| 3300004092|Ga0062389_102992433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300004281|Ga0066397_10064899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 694 | Open in IMG/M |
| 3300004635|Ga0062388_102001946 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005178|Ga0066688_10882097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300005347|Ga0070668_100537434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1016 | Open in IMG/M |
| 3300005437|Ga0070710_11173284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 566 | Open in IMG/M |
| 3300005455|Ga0070663_100857366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 782 | Open in IMG/M |
| 3300005591|Ga0070761_10840515 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005591|Ga0070761_10902570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300005602|Ga0070762_10138679 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300005618|Ga0068864_100743272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 961 | Open in IMG/M |
| 3300005764|Ga0066903_103838342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 807 | Open in IMG/M |
| 3300006028|Ga0070717_11528349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 605 | Open in IMG/M |
| 3300006173|Ga0070716_100007334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 5424 | Open in IMG/M |
| 3300006173|Ga0070716_100869261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 703 | Open in IMG/M |
| 3300006174|Ga0075014_100438687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 720 | Open in IMG/M |
| 3300006606|Ga0074062_12877284 | Not Available | 513 | Open in IMG/M |
| 3300006755|Ga0079222_11072785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
| 3300006904|Ga0075424_101972590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 616 | Open in IMG/M |
| 3300009098|Ga0105245_10242113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1749 | Open in IMG/M |
| 3300009162|Ga0075423_12765997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300009174|Ga0105241_11463711 | Not Available | 656 | Open in IMG/M |
| 3300009522|Ga0116218_1532305 | Not Available | 523 | Open in IMG/M |
| 3300009545|Ga0105237_12348317 | Not Available | 543 | Open in IMG/M |
| 3300009672|Ga0116215_1062553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1681 | Open in IMG/M |
| 3300009700|Ga0116217_10146469 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300010325|Ga0134064_10396991 | Not Available | 550 | Open in IMG/M |
| 3300010326|Ga0134065_10337460 | Not Available | 588 | Open in IMG/M |
| 3300010361|Ga0126378_10798477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp. | 1053 | Open in IMG/M |
| 3300010366|Ga0126379_13069220 | Not Available | 559 | Open in IMG/M |
| 3300010371|Ga0134125_11725455 | Not Available | 681 | Open in IMG/M |
| 3300010376|Ga0126381_104416278 | Not Available | 544 | Open in IMG/M |
| 3300010379|Ga0136449_103414737 | Not Available | 607 | Open in IMG/M |
| 3300010398|Ga0126383_13291208 | Not Available | 528 | Open in IMG/M |
| 3300012189|Ga0137388_11993640 | Not Available | 509 | Open in IMG/M |
| 3300012211|Ga0137377_10056948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3626 | Open in IMG/M |
| 3300012356|Ga0137371_10070529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2706 | Open in IMG/M |
| 3300012363|Ga0137390_11150880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300012908|Ga0157286_10319641 | Not Available | 575 | Open in IMG/M |
| 3300012989|Ga0164305_12021214 | Not Available | 526 | Open in IMG/M |
| 3300013307|Ga0157372_10412359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1574 | Open in IMG/M |
| 3300014164|Ga0181532_10158242 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300014166|Ga0134079_10245318 | Not Available | 772 | Open in IMG/M |
| 3300015356|Ga0134073_10116005 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300015371|Ga0132258_13810254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp. | 1027 | Open in IMG/M |
| 3300016404|Ga0182037_11806148 | Not Available | 546 | Open in IMG/M |
| 3300017959|Ga0187779_10793139 | Not Available | 646 | Open in IMG/M |
| 3300017961|Ga0187778_11301554 | Not Available | 512 | Open in IMG/M |
| 3300018060|Ga0187765_10702724 | Not Available | 664 | Open in IMG/M |
| 3300019879|Ga0193723_1152849 | Not Available | 617 | Open in IMG/M |
| 3300020199|Ga0179592_10412363 | Not Available | 588 | Open in IMG/M |
| 3300020581|Ga0210399_11278478 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300020582|Ga0210395_11374083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 516 | Open in IMG/M |
| 3300021168|Ga0210406_10420057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp. | 1069 | Open in IMG/M |
| 3300021171|Ga0210405_10245734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1416 | Open in IMG/M |
| 3300021404|Ga0210389_10249886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1387 | Open in IMG/M |
| 3300021405|Ga0210387_11506595 | Not Available | 575 | Open in IMG/M |
| 3300021406|Ga0210386_11112281 | Not Available | 671 | Open in IMG/M |
| 3300021433|Ga0210391_11551475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300021477|Ga0210398_11099834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
| 3300021560|Ga0126371_10175047 | Not Available | 2225 | Open in IMG/M |
| 3300022721|Ga0242666_1105476 | Not Available | 655 | Open in IMG/M |
| 3300024222|Ga0247691_1011853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
| 3300024251|Ga0247679_1019955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp. | 1140 | Open in IMG/M |
| 3300025898|Ga0207692_10169547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1264 | Open in IMG/M |
| 3300025911|Ga0207654_10948364 | Not Available | 625 | Open in IMG/M |
| 3300025912|Ga0207707_11607183 | Not Available | 512 | Open in IMG/M |
| 3300025914|Ga0207671_10959791 | Not Available | 675 | Open in IMG/M |
| 3300025916|Ga0207663_10311834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp. | 1179 | Open in IMG/M |
| 3300025926|Ga0207659_11333091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 616 | Open in IMG/M |
| 3300025928|Ga0207700_11216579 | Not Available | 672 | Open in IMG/M |
| 3300026088|Ga0207641_10237798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1696 | Open in IMG/M |
| 3300027080|Ga0208237_1028914 | Not Available | 837 | Open in IMG/M |
| 3300027096|Ga0208099_1028968 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300027297|Ga0208241_1082680 | Not Available | 516 | Open in IMG/M |
| 3300027310|Ga0207983_1039743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300027725|Ga0209178_1053337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1300 | Open in IMG/M |
| 3300027911|Ga0209698_10265371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1367 | Open in IMG/M |
| 3300028906|Ga0308309_10904782 | Not Available | 766 | Open in IMG/M |
| 3300029944|Ga0311352_10538441 | Not Available | 939 | Open in IMG/M |
| 3300030494|Ga0310037_10296213 | Not Available | 690 | Open in IMG/M |
| 3300030520|Ga0311372_10094207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5483 | Open in IMG/M |
| 3300030659|Ga0316363_10404100 | Not Available | 530 | Open in IMG/M |
| 3300030906|Ga0302314_11732787 | Not Available | 550 | Open in IMG/M |
| 3300031543|Ga0318516_10338637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 868 | Open in IMG/M |
| 3300031546|Ga0318538_10364080 | Not Available | 781 | Open in IMG/M |
| 3300031564|Ga0318573_10147226 | Not Available | 1233 | Open in IMG/M |
| 3300031572|Ga0318515_10277745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 898 | Open in IMG/M |
| 3300031573|Ga0310915_11140454 | Not Available | 541 | Open in IMG/M |
| 3300031680|Ga0318574_10333001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 884 | Open in IMG/M |
| 3300031718|Ga0307474_10934053 | Not Available | 687 | Open in IMG/M |
| 3300031719|Ga0306917_10988554 | Not Available | 657 | Open in IMG/M |
| 3300031747|Ga0318502_10634987 | Not Available | 644 | Open in IMG/M |
| 3300031765|Ga0318554_10280418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
| 3300031778|Ga0318498_10052362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1814 | Open in IMG/M |
| 3300031779|Ga0318566_10493502 | Not Available | 600 | Open in IMG/M |
| 3300031781|Ga0318547_10875861 | Not Available | 560 | Open in IMG/M |
| 3300031781|Ga0318547_11073546 | Not Available | 504 | Open in IMG/M |
| 3300031794|Ga0318503_10087497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 982 | Open in IMG/M |
| 3300031833|Ga0310917_10182437 | Not Available | 1398 | Open in IMG/M |
| 3300031854|Ga0310904_10193951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp. | 1219 | Open in IMG/M |
| 3300031860|Ga0318495_10153303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 1039 | Open in IMG/M |
| 3300031879|Ga0306919_11128524 | Not Available | 597 | Open in IMG/M |
| 3300031896|Ga0318551_10303817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
| 3300031896|Ga0318551_10816036 | Not Available | 542 | Open in IMG/M |
| 3300031910|Ga0306923_10419612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 1521 | Open in IMG/M |
| 3300031954|Ga0306926_12569047 | Not Available | 557 | Open in IMG/M |
| 3300031981|Ga0318531_10462224 | Not Available | 575 | Open in IMG/M |
| 3300032054|Ga0318570_10514012 | Not Available | 546 | Open in IMG/M |
| 3300032060|Ga0318505_10631107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300032064|Ga0318510_10146412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 930 | Open in IMG/M |
| 3300032064|Ga0318510_10198267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 810 | Open in IMG/M |
| 3300032782|Ga0335082_10747556 | Not Available | 840 | Open in IMG/M |
| 3300032783|Ga0335079_11512026 | Not Available | 663 | Open in IMG/M |
| 3300032828|Ga0335080_12290371 | Not Available | 517 | Open in IMG/M |
| 3300033134|Ga0335073_10160940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2831 | Open in IMG/M |
| 3300033134|Ga0335073_10345921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1764 | Open in IMG/M |
| 3300033289|Ga0310914_10759158 | Not Available | 867 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_03073470 | 2199352024 | Soil | MPMPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLADLAKPEEERDR |
| JGI12269J14319_101728852 | 3300001356 | Peatlands Soil | MPTVALDVPSAHVLADQASIIGDLQFVMDCCKRLLTELDKPEEDR |
| Ga0062389_1029924332 | 3300004092 | Bog Forest Soil | MPTVALDVPSAHVLADQASIIQDLQYVMDCCKRLLAELAKPEEDRDPLMPLA |
| Ga0066397_100648993 | 3300004281 | Tropical Forest Soil | MSPEVSGLTVALDLPSAQILADQAGIIQDLQFVMDCCKRLLTELAR |
| Ga0062388_1020019462 | 3300004635 | Bog Forest Soil | MLTVALDTPSAHVLADQASTIQDLQFVMDCCKRLLTELAKPEEDRDPLMPVALWSS |
| Ga0066688_108820971 | 3300005178 | Soil | VPEDLRVPMPTVPLDVPSAHILADQASIVQDLQFVMDCCKRLL |
| Ga0070668_1005374341 | 3300005347 | Switchgrass Rhizosphere | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADLAKPEEE |
| Ga0070710_111732841 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTVALDVPSARVLADQASIVAELQFVMDCCKRLLPELAKPEEERDQLMPLALWSS |
| Ga0070663_1008573661 | 3300005455 | Corn Rhizosphere | MATSSSELPTVPLDLPSAQVLADLVATVQDLQFVMDCCKRLL |
| Ga0070761_108405153 | 3300005591 | Soil | VAGTPALTVALDTPSARVLADQASIINDLQFVMDCCKRLLTELE |
| Ga0070761_109025702 | 3300005591 | Soil | MLTVALDVPSARILADQASIIQDLQFVMDCCKRLLEELARPEEDRDG |
| Ga0070762_101386791 | 3300005602 | Soil | MLTVALDVPSAQILADQASIIRDLQFVMDCCKRLLTELAKPEEERDPV |
| Ga0068864_1007432723 | 3300005618 | Switchgrass Rhizosphere | MLTVALDLPSARALAGQASVVQDLQFVMDCCKRLLA |
| Ga0066903_1038383421 | 3300005764 | Tropical Forest Soil | MTMPTVAIDVPSAHVLADQASIIAELQFVMDCCKRLLTELA |
| Ga0070717_115283491 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MATSSSELPTVPLDLPSAQVLADLVATVQDLQFVMDCCKRLLTELARPE |
| Ga0070716_1000073346 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MATSSSELPTVPLDLPSAQVLADLVATVQDLQFVMDCCKRLLTELARP |
| Ga0070716_1008692611 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADLAKPEEERDPL |
| Ga0075014_1004386871 | 3300006174 | Watersheds | MTMPTVALDVPSAHVLADQASIIADLQYVMDCCKRLLTELAKPEEDRDPLMP |
| Ga0074062_128772841 | 3300006606 | Soil | MLTVALDLPSARVLAGQASVVQDLQFVMDCCKRLLAELDRPEEDRDG |
| Ga0079222_110727852 | 3300006755 | Agricultural Soil | MPTVAIDVPSAQVLADQASIISELQFVMDCCKRLL |
| Ga0075424_1019725902 | 3300006904 | Populus Rhizosphere | MPTVALDVPSARVLADQASIIAELQFVMDCCKRLLPELAKPEEERDQLMPLALW |
| Ga0105245_102421131 | 3300009098 | Miscanthus Rhizosphere | MPMPTVALDVPSARVLADQASIIAELQFVMDCCKR |
| Ga0075423_127659972 | 3300009162 | Populus Rhizosphere | MPMPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLTELDKP |
| Ga0105241_114637111 | 3300009174 | Corn Rhizosphere | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADLAKPEEERDPLMP |
| Ga0116218_15323052 | 3300009522 | Peatlands Soil | MPMPTVALDVPSAHVLADQASIISDLQFVMDCCKRLLTELA |
| Ga0105237_123483172 | 3300009545 | Corn Rhizosphere | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADLAKPEEERD |
| Ga0116215_10625531 | 3300009672 | Peatlands Soil | MPMPTVALDVPSAHVLADQASIISDLQFVMDCCKRLLTELAMPEEDRDP |
| Ga0116217_101464693 | 3300009700 | Peatlands Soil | MTMPTVALDVPSAHVLADQASIIGDLQFVMDCCKRLLTELDKPEEDRDPLMPVALW* |
| Ga0134064_103969912 | 3300010325 | Grasslands Soil | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLTELAKPEEE |
| Ga0134065_103374602 | 3300010326 | Grasslands Soil | MPMPTVAIDVPSAQVLADQASIIAELKFVMDSCKRLLTELAKP |
| Ga0126378_107984771 | 3300010361 | Tropical Forest Soil | MPMPTVALDVPSAHVLADQASIIAELQFVMDCCKRLLTELERPEE |
| Ga0126379_130692201 | 3300010366 | Tropical Forest Soil | MTMPTVAIDVPSAHVLADQASIIAELQFVMDCCKRLLTELAKPEEERDQLMPLA |
| Ga0134125_117254553 | 3300010371 | Terrestrial Soil | MATSSSELPTVPLDLPSAQVLADLVATVQDLQFVMDCCKRLLTELARPEDERDMVVPQA |
| Ga0126381_1044162781 | 3300010376 | Tropical Forest Soil | MLTVALDLPSARVLAGQASVIQDLQFVMDCCKRLLAELARPEEDRD |
| Ga0136449_1034147371 | 3300010379 | Peatlands Soil | MTMPTVALDVPSAHVLADQASIIQDLQFVMDCCKRLLTELAKPEEDRDPLLP |
| Ga0126383_132912082 | 3300010398 | Tropical Forest Soil | MTMPTVAIDVPSAHVLADQASIIAELQFVMDCCKRLLTELAKPEEERDQLMPLALW |
| Ga0137388_119936401 | 3300012189 | Vadose Zone Soil | MLTVALDLPSAQVLADQASIVSDLQFVVECCKGLLGEL |
| Ga0137377_100569484 | 3300012211 | Vadose Zone Soil | MLTVALDLPSARILAGQASVIQDLQFVMDCCKRLLTELALPEEDR |
| Ga0137371_100705295 | 3300012356 | Vadose Zone Soil | MLTVALDLPSAQTLADQASIIQDLQFVMDCCKRLL |
| Ga0137390_111508801 | 3300012363 | Vadose Zone Soil | MLTVALDVPSAQILADQASIIADLQFVMECCKRLLTEL |
| Ga0157286_103196411 | 3300012908 | Soil | MPMPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLADLAKPEEERDP |
| Ga0164305_120212141 | 3300012989 | Soil | MLTVALDLPSARVLAGQASVIQDLQFVMDCCKRLLAELDRPEED |
| Ga0157372_104123591 | 3300013307 | Corn Rhizosphere | MPMPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLADLAKPEEERDPL |
| Ga0181532_101582423 | 3300014164 | Bog | MTMPTVALDVPSAHVLADQASIIQDLQFVMDCCKRLL |
| Ga0134079_102453182 | 3300014166 | Grasslands Soil | MPMPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLTELD |
| Ga0134073_101160052 | 3300015356 | Grasslands Soil | MLTVALDLPSARTLADQASIIQDLQFVMDCCKRLLTELARPEEDRDRVV |
| Ga0132258_138102542 | 3300015371 | Arabidopsis Rhizosphere | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADLAKPEEERDP |
| Ga0182037_118061482 | 3300016404 | Soil | MLTVALDMPSAHVLADQASTIQDLQFVMDCCKRLLTELAKPEEERDAVVPQA |
| Ga0187779_107931392 | 3300017959 | Tropical Peatland | MAMPTVALDVPSARVLADQASIIADLQFVIDCSKQLLTELAKPDEDRDPL |
| Ga0187778_113015542 | 3300017961 | Tropical Peatland | MAMPTVALDVPSARVLADQAAIIQDLQFVMDCCKRLLTEL |
| Ga0187765_107027242 | 3300018060 | Tropical Peatland | MLTVALDLPSARKLAGQASVIQDLQFVMDCCKRLLAELDRPEE |
| Ga0193723_11528491 | 3300019879 | Soil | MPMPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLADLAKPEEER |
| Ga0179592_104123632 | 3300020199 | Vadose Zone Soil | MDAASPEAPVLTVALDMPSAHVLADQASIIQDLQFVMDCCKRLLTELALPEEDRD |
| Ga0210399_112784781 | 3300020581 | Soil | MLTVALDVPSARILADQASIIQDLQFVMDCSKRLLAELARPEEDRDGVVPQ |
| Ga0210395_113740832 | 3300020582 | Soil | MLTVALDLPSAQILADQASIVSDLQFVVECCKGLLGELDKPEEERDSV |
| Ga0210406_104200571 | 3300021168 | Soil | MPMPTVAIDVPSAQVLADQASIIAELQFVMDCCKRLLAELA |
| Ga0210405_102457343 | 3300021171 | Soil | MPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLTE |
| Ga0210389_102498861 | 3300021404 | Soil | MLTVALDVPSARILADQASIIQDLQFVMDCSKRLLEELARPEEDRD |
| Ga0210387_115065952 | 3300021405 | Soil | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADL |
| Ga0210386_111122811 | 3300021406 | Soil | MPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLTELDKPEEERDQLMPLAL |
| Ga0210391_115514752 | 3300021433 | Soil | MLTVALEVPSAQILADQASIIQDLQFVMDCCKRLL |
| Ga0210398_110998342 | 3300021477 | Soil | MLTVALDLPSAQVLADQASIVSDLQFVVECCKGLLGELDKPEDERD |
| Ga0126371_101750473 | 3300021560 | Tropical Forest Soil | MLTVALDLPSAQILADQAGIIQDLQFVMDCCKRLLTELAKPEEDRD |
| Ga0242666_11054762 | 3300022721 | Soil | MLTVALDVPSARILADQASIIQDLQFVMDCSKRLLEELARPEEDRDGVVPQPL |
| Ga0247691_10118533 | 3300024222 | Soil | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADLAKPEEERDPLLPLAL |
| Ga0247679_10199552 | 3300024251 | Soil | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADLAKPEEERDPLLPL |
| Ga0207692_101695471 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLTELDKPEDERDQLMPL |
| Ga0207654_109483642 | 3300025911 | Corn Rhizosphere | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADLAKPEEERDPLL |
| Ga0207707_116071831 | 3300025912 | Corn Rhizosphere | MVPMPTVAIDVPSAQVLADQASIISELQFIMDCCKRLLAELDKPEEERDQ |
| Ga0207671_109597912 | 3300025914 | Corn Rhizosphere | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADLAKPEEERDPLMPLALW |
| Ga0207663_103118341 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLADLAKPEEERDQLMPL |
| Ga0207659_113330912 | 3300025926 | Miscanthus Rhizosphere | MLTVALDLPSAQTLADQASIIQDLQFVMDCCKRLLTELARPEED |
| Ga0207700_112165792 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMPTVALDVPSARVLADQASIIAELQFVMDCCKRLLPELAK |
| Ga0207641_102377981 | 3300026088 | Switchgrass Rhizosphere | MPTVALDVPSARVLADQASIIAELQFVMDCCKRLLPELAKPEDERD |
| Ga0208237_10289142 | 3300027080 | Forest Soil | MTMPTVALDVPSAHVLADQASIIADLQYVMDCCKRLLTE |
| Ga0208099_10289682 | 3300027096 | Forest Soil | MLTVALDVPSARILADQASIIQDLQFVMDCSKRLLEE |
| Ga0208241_10826801 | 3300027297 | Forest Soil | MTMPTVALDVPSAHVLADQASIIADLQYVMDCCKRLLTELAKPEE |
| Ga0207983_10397432 | 3300027310 | Soil | MPTVALDVPSAHVLADQASTISELQFVMDCCKRLLTELAKPEEERDQLM |
| Ga0209178_10533373 | 3300027725 | Agricultural Soil | MPMPTVAIDVPSAQILADQASIISELQFVMDCCKRLL |
| Ga0209698_102653711 | 3300027911 | Watersheds | VPGLTVALDMPSARILADQASIIQDLQFVMDCCKRLLTELAK |
| Ga0308309_109047822 | 3300028906 | Soil | MPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLVELDKPEEERDQ |
| Ga0311352_105384411 | 3300029944 | Palsa | MDAASPDKPMVTVALDVPSAYVLADQAAIIQDLQFVMDGCKRLLAELAKPEEDR |
| Ga0310037_102962131 | 3300030494 | Peatlands Soil | MPTVALDVPSAHVLADQASIIQDLQFVMDCCKRLLTELAKPEEDRDP |
| Ga0311372_100942075 | 3300030520 | Palsa | MDAASPDKPMVTVALDVPSAYILADQAAIIQDLQFVMDGCKRLLAELAKPEEE |
| Ga0316363_104041002 | 3300030659 | Peatlands Soil | MPTVALDVPSAHVLADQASIIGDLQFVMDCCKRLLT |
| Ga0302314_117327871 | 3300030906 | Palsa | MDAASPDKPMVTVALDVPSAYILADQAAIIQDLQFVMDGCKRLLAELAKPE |
| Ga0318516_103386372 | 3300031543 | Soil | MLTVALDMPSAHVLADQASTIQDLQFVMDCCKRLLTELARPE |
| Ga0318538_103640801 | 3300031546 | Soil | MTMPTVAIDVPSARVLADQASIIAELQFVMDCCKRLLTELAKPEEER |
| Ga0318573_101472263 | 3300031564 | Soil | MPTVALDVPSAHVLADQASIVSELQFVMDCCKRLLTELSAPEEERDQLMPLALWSS |
| Ga0318515_102777452 | 3300031572 | Soil | MPTVALDMPSAHVLADQASTIQDLQFVMDCCKRLLTELAK |
| Ga0310915_111404542 | 3300031573 | Soil | MLTVALDLPSARVLAGQASVIQDLQFVMDCCKRLLAELALPEEDRDGVVP |
| Ga0318574_103330012 | 3300031680 | Soil | MVTVALDTPSALVLADQASTIQDLQFVMDCCKRLLTELAKPEEERDAVVPQALW |
| Ga0307474_109340531 | 3300031718 | Hardwood Forest Soil | MPMPTVAIDVPSAHVLADQASIISELQFVMDCCKRLLADLAKPEE |
| Ga0306917_109885541 | 3300031719 | Soil | MPTVALDVPSAHVLADQASIVSELQFVMDCCKRLLTELAAPEEER |
| Ga0318502_106349871 | 3300031747 | Soil | MLTVALDLPSARVLAGQASVIQDLQFVMDCCKRLLTELALPE |
| Ga0318554_102804182 | 3300031765 | Soil | MLTVALDLPSAQILADQAGIIQDLQFVMDCCKRLLTELAKPEEDRDGVVP |
| Ga0318498_100523621 | 3300031778 | Soil | MPTVALDVPSARVLADQASIIQDLQFVMDCCKRLLAELAKPEEERDPLMP |
| Ga0318566_104935021 | 3300031779 | Soil | MLTVALDLPSAQILADQAGIIQDLQFVMDCCKRLLTELAK |
| Ga0318547_108758612 | 3300031781 | Soil | VRTVALDIPSARVLADQASIIQDLQFVMDCCKRLLTELAVPAEDRDTVLPLALWSS |
| Ga0318547_110735461 | 3300031781 | Soil | VPMPTVALDVPSARILADQASIIQDLQFVMDCCKRLLTELE |
| Ga0318503_100874971 | 3300031794 | Soil | MLTVALDMPSAHVLADQASTIQDLQFVMDCCKRLLTE |
| Ga0310917_101824373 | 3300031833 | Soil | VGALTVAIDTPSARILADQASVIQDLQFVMDCCKRLLTEL |
| Ga0310904_101939511 | 3300031854 | Soil | MPMPTVAIDVPSAQVLADQASIISELQFVMDCCKRLLAELAKPEEERDQLIPL |
| Ga0318495_101533031 | 3300031860 | Soil | MLTVALDMPSAHVLADQASTIQDLQFVMDCCKRLLTELAKPEDERDAVVPQAL |
| Ga0306919_111285241 | 3300031879 | Soil | MLTVALDLPSARVLAGQASVIQDLQFVMDCCKRLLAEL |
| Ga0318551_103038171 | 3300031896 | Soil | MLTVALDLPSAQILADQAGIIQDLQFVMDCCKRLLTE |
| Ga0318551_108160361 | 3300031896 | Soil | MVTVALDTPSALVLADQASTIQDLQFVMDCCKRLLTELAKPE |
| Ga0306923_104196122 | 3300031910 | Soil | MLTVALDLPSAQILADQAGIIQDLQFVMDCCKRLLTEL |
| Ga0306926_125690471 | 3300031954 | Soil | MLTVPLDLPSARVLAGQASVIQDLQFVMDCCKRLLTELALPEEDRD |
| Ga0318531_104622242 | 3300031981 | Soil | MPTVAIDVPSAHVLADQASIIAELQFVMDCCKRILPELAKPEAEQDQ |
| Ga0318570_105140122 | 3300032054 | Soil | MPTVALDVPSAHVLADQASIVSELQFVMDCCKRLLTELAAPE |
| Ga0318505_106311072 | 3300032060 | Soil | MLTVALDLPSAQILADQAGIIQDLQFVMDCCKRLLTELA |
| Ga0318510_101464122 | 3300032064 | Soil | MVTVALDTPSALVLADQASTIQDLQFVMDCCKRLLTELAK |
| Ga0318510_101982671 | 3300032064 | Soil | MLTVALDMPSAHVLADQASTIQDLQFVMDCCKRLLTELEKPEEDR |
| Ga0335082_107475561 | 3300032782 | Soil | MPMPTVALDVPSARILADQASIIQDLQFVMDSCKRLLAELEKPEEDRDPVT |
| Ga0335079_115120261 | 3300032783 | Soil | MATSSSELPTVPLDLPSAQVLADLVATVQDLQFVMDCCKRLLTELDRPEAERDPVVPQ |
| Ga0335080_122903712 | 3300032828 | Soil | MPTVALDVPSAHVLADQASIVSELQFVMDCCKRLLTELAEPEEERDQ |
| Ga0335073_101609401 | 3300033134 | Soil | MLTVALDVTSAQILADQASIIQDLQFVMDCCKRLLTELAKSEENRDPVVPPALW |
| Ga0335073_103459213 | 3300033134 | Soil | MPMPTVAIDVPSAHVLADQASIIAELQFVMDCSKRLLTELA |
| Ga0310914_107591581 | 3300033289 | Soil | MLTVALDLPSARVLAGQASVIQDLQFVMDCCKRLLAELAL |
| ⦗Top⦘ |