| Basic Information | |
|---|---|
| Family ID | F073915 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MDESKRRVVKFLEKEIKTYTALSLFLSKKGIKEHVRVGEKKV |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.36 % |
| % of genes near scaffold ends (potentially truncated) | 88.33 % |
| % of genes from short scaffolds (< 2000 bps) | 85.00 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.167 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF11752 | DUF3309 | 62.50 |
| PF00072 | Response_reg | 2.50 |
| PF13502 | AsmA_2 | 1.67 |
| PF04972 | BON | 1.67 |
| PF00027 | cNMP_binding | 0.83 |
| PF00496 | SBP_bac_5 | 0.83 |
| PF14067 | LssY_C | 0.83 |
| PF00882 | Zn_dep_PLPC | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.17 % |
| Unclassified | root | N/A | 25.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS01BINUM | Not Available | 503 | Open in IMG/M |
| 3300000571|JGI1358J11329_10200764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300001356|JGI12269J14319_10123256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1189 | Open in IMG/M |
| 3300001593|JGI12635J15846_10217418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1250 | Open in IMG/M |
| 3300002677|Ga0005475J37263_110315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300003368|JGI26340J50214_10063107 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300004135|Ga0058884_1008128 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300004140|Ga0058894_1486393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
| 3300004964|Ga0072331_1160379 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005180|Ga0066685_10419273 | Not Available | 930 | Open in IMG/M |
| 3300005440|Ga0070705_101777031 | Not Available | 522 | Open in IMG/M |
| 3300005471|Ga0070698_100481487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1178 | Open in IMG/M |
| 3300006059|Ga0075017_101094773 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006173|Ga0070716_100927864 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300006173|Ga0070716_101684173 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006354|Ga0075021_11096607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300006804|Ga0079221_10175752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1148 | Open in IMG/M |
| 3300006806|Ga0079220_10875452 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300006914|Ga0075436_100789967 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300006954|Ga0079219_10569763 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300006954|Ga0079219_11736141 | Not Available | 580 | Open in IMG/M |
| 3300007265|Ga0099794_10691734 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009521|Ga0116222_1495983 | Not Available | 534 | Open in IMG/M |
| 3300009524|Ga0116225_1113279 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300010341|Ga0074045_11012193 | Not Available | 522 | Open in IMG/M |
| 3300010379|Ga0136449_101034401 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300010401|Ga0134121_12386990 | Not Available | 569 | Open in IMG/M |
| 3300011120|Ga0150983_10190768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300011120|Ga0150983_10219648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
| 3300011120|Ga0150983_14626082 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300011120|Ga0150983_15855259 | Not Available | 547 | Open in IMG/M |
| 3300011120|Ga0150983_16532060 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300011271|Ga0137393_11359840 | Not Available | 599 | Open in IMG/M |
| 3300012096|Ga0137389_10637699 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300012096|Ga0137389_11633769 | Not Available | 540 | Open in IMG/M |
| 3300012205|Ga0137362_11783534 | Not Available | 502 | Open in IMG/M |
| 3300012208|Ga0137376_10399020 | Not Available | 1194 | Open in IMG/M |
| 3300012882|Ga0157304_1026667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300012923|Ga0137359_10731625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300012923|Ga0137359_11647109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012929|Ga0137404_11389539 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012984|Ga0164309_11105232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 660 | Open in IMG/M |
| 3300012984|Ga0164309_11246180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300012985|Ga0164308_12162689 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300014168|Ga0181534_10499957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300014501|Ga0182024_12077248 | Not Available | 626 | Open in IMG/M |
| 3300015054|Ga0137420_1225687 | All Organisms → cellular organisms → Bacteria | 4801 | Open in IMG/M |
| 3300017822|Ga0187802_10389340 | Not Available | 551 | Open in IMG/M |
| 3300017823|Ga0187818_10212687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300017928|Ga0187806_1083510 | Not Available | 1004 | Open in IMG/M |
| 3300017930|Ga0187825_10218114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300017937|Ga0187809_10070077 | Not Available | 1148 | Open in IMG/M |
| 3300017942|Ga0187808_10036864 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300017943|Ga0187819_10211687 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300018018|Ga0187886_1257960 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300020580|Ga0210403_10051170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3303 | Open in IMG/M |
| 3300020580|Ga0210403_10203784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1624 | Open in IMG/M |
| 3300020580|Ga0210403_10435295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1069 | Open in IMG/M |
| 3300020580|Ga0210403_10574114 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300020580|Ga0210403_10966307 | Not Available | 668 | Open in IMG/M |
| 3300020582|Ga0210395_10918716 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300021170|Ga0210400_10324129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1266 | Open in IMG/M |
| 3300021171|Ga0210405_10809358 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300021401|Ga0210393_10374602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1160 | Open in IMG/M |
| 3300021403|Ga0210397_10499890 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300021406|Ga0210386_10330830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1308 | Open in IMG/M |
| 3300021432|Ga0210384_10748204 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300021432|Ga0210384_11804134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300021433|Ga0210391_10468287 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300021478|Ga0210402_10542684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
| 3300021479|Ga0210410_10583564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300021479|Ga0210410_10795209 | Not Available | 831 | Open in IMG/M |
| 3300022731|Ga0224563_1015140 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300024286|Ga0247687_1074139 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300025442|Ga0208034_1059655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300025480|Ga0208688_1012558 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300025527|Ga0208714_1094195 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300025905|Ga0207685_10613133 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300025916|Ga0207663_10418852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300025916|Ga0207663_10586430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300025922|Ga0207646_11413360 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300025922|Ga0207646_11775541 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300026304|Ga0209240_1000022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 57289 | Open in IMG/M |
| 3300026489|Ga0257160_1024541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300027678|Ga0209011_1059609 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300027911|Ga0209698_10328512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
| 3300028792|Ga0307504_10286310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300029636|Ga0222749_10751996 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031231|Ga0170824_119783478 | Not Available | 500 | Open in IMG/M |
| 3300031524|Ga0302320_11289283 | Not Available | 739 | Open in IMG/M |
| 3300031715|Ga0307476_10265369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1255 | Open in IMG/M |
| 3300031715|Ga0307476_10764982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300031720|Ga0307469_12498383 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031753|Ga0307477_10146624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1646 | Open in IMG/M |
| 3300031754|Ga0307475_10081524 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300031820|Ga0307473_10096001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1564 | Open in IMG/M |
| 3300031823|Ga0307478_11411489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300032174|Ga0307470_10542499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300032174|Ga0307470_10798396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 731 | Open in IMG/M |
| 3300032180|Ga0307471_100069711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3025 | Open in IMG/M |
| 3300032180|Ga0307471_100118992 | All Organisms → cellular organisms → Bacteria | 2454 | Open in IMG/M |
| 3300032180|Ga0307471_101984686 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300032180|Ga0307471_103154037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300032180|Ga0307471_103809986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300032205|Ga0307472_102726328 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300032756|Ga0315742_10063147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1695 | Open in IMG/M |
| 3300032756|Ga0315742_10711707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300033405|Ga0326727_10673027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300033433|Ga0326726_11271451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. | 716 | Open in IMG/M |
| 3300033561|Ga0371490_1113462 | Not Available | 704 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 12.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.67% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.83% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.83% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 3300000571 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002677 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF124 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004135 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004140 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004964 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_08739110 | 2170459012 | Grass Soil | MDESRRRVVRFLEKEIKTYTALSLFLSKKGIKGHVRVEE |
| JGI1358J11329_102007641 | 3300000571 | Groundwater | MDEARRRVIKFLEKEIKTYAALALFLSKKGSKESVRVANKEIILSP |
| JGI12269J14319_101232561 | 3300001356 | Peatlands Soil | MDQSRRRIVNFLEKEIKTYTALSLFLSKKGIQEQLRV |
| JGI12635J15846_102174181 | 3300001593 | Forest Soil | MDESRRRAIKFLEKEIKTYLALSLFLSKKGIKADVRVGEKKVLXSPSY |
| Ga0005475J37263_1103153 | 3300002677 | Forest Soil | MEDSRRRVVKFLEKEIKTYTALSLFLSKKGIKEHVRVGAKRVLISP |
| JGI26340J50214_100631071 | 3300003368 | Bog Forest Soil | MDESKRRIVRFLEREIKTYMALSYFLTKKGIKEHLRVGEKRVLISPSF |
| Ga0058884_10081284 | 3300004135 | Forest Soil | MDDSRRRVVKFLEKEIKTYRALSLFLLKKGIKERVRVGEKKVLI |
| Ga0058883_10073401 | 3300004137 | Forest Soil | MNDSKQRVVRFLEKEIKTYVALSLFLSKKGIRERMDAGDKR |
| Ga0058894_14863931 | 3300004140 | Forest Soil | MEDSRRRVVRFLEKEIKTYTALSLFLSKKGIKEHVRVGAKRVLISPSFY |
| Ga0072331_11603791 | 3300004964 | Peatlands Soil | MDQSRRRIVNFLEKEIKTYTALSLFLSKKGIQEQLRVGGKQALVSP |
| Ga0066685_104192731 | 3300005180 | Soil | MDESKKHVVKFLEKEIKTYMALSLFLSKKGIQEHVRVGEKKVLIG |
| Ga0070705_1017770312 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDPKRRAVKFLEKEIRTYKALSLFFSKKGIKEHVRFGEKKVLISPTFY |
| Ga0070698_1004814871 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDPKRRAVKFLEKEIRTYKALSLFFSKKGIKEHVRFGEKKVLISPTFYE |
| Ga0080027_102011221 | 3300005993 | Prmafrost Soil | MDKSSRRVIQFLEKEIKTYAPFSLFLMKKGINERVRVGDKR |
| Ga0075017_1010947731 | 3300006059 | Watersheds | MSETRRHVVKFLEKEIKTYRALCLFFSKTGKKGHL |
| Ga0070716_1009278643 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDSKRNAVKFLEKEIQTYMALSLFLAKRGIDEHVCIGDRKILISPTFYKER |
| Ga0070716_1016841732 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MDESKRSAVKFLEKESKTYLALSLFLSKKGIEEHVRVGDNKILINPTFYKE |
| Ga0075021_110966071 | 3300006354 | Watersheds | MDESKRHAVQFLEKEIKTYTALSLFLTKKGIKEHIRVGEKSVLISSSFY |
| Ga0079221_101757524 | 3300006804 | Agricultural Soil | MDESKRRVVKFLEKEIKTYKALSLFLSKKGFQEHVRLGKKQVLISP |
| Ga0079220_108754521 | 3300006806 | Agricultural Soil | MDESKRRVVKFLEKEIKTYKALSLFLSKKGIQEHVRLGKKKVLIS |
| Ga0075436_1007899671 | 3300006914 | Populus Rhizosphere | MSDPKRRAVKFLEKEIRTYKALSLFFSKKGIKEHVRFGEKKV |
| Ga0079219_105697631 | 3300006954 | Agricultural Soil | MDESKRRVVKFLEKEIKTYKALSLFLSKKGIKEHVRLGAKKVLISP |
| Ga0079219_117361412 | 3300006954 | Agricultural Soil | MDESKRRAVRFLEKEIKTYKALALFLSKEEIKKHMPLND |
| Ga0099794_106917342 | 3300007265 | Vadose Zone Soil | LEDNVDESKRWAVRFLEKEIKTYMALSLFLSKKGIK |
| Ga0116222_14959832 | 3300009521 | Peatlands Soil | MDESKRRAIQFLEKEIKTYLALALFLSKKDVQKHLRAGSKG |
| Ga0116225_11132793 | 3300009524 | Peatlands Soil | MDQSRRRIVNFLEKEIKTYTALSLFLSKKGIQEQLRVGGKQALVSPAFYKE |
| Ga0074045_110121931 | 3300010341 | Bog Forest Soil | MDESKRHAIRFLEKEIRTYTALSLFLSKQGIRQHVRVGTSTVLICPLFYRE |
| Ga0136449_1010344013 | 3300010379 | Peatlands Soil | MDESKRHVVEFLEKEIKTYLALSLFLSKKGIKEHVRVG |
| Ga0134121_123869902 | 3300010401 | Terrestrial Soil | MDQSKQRAIHFLEKEIKTYTALALFFSKKGIKEPVK |
| Ga0150983_101907682 | 3300011120 | Forest Soil | MDESKRRVVKFLEKEIKTYKALSLFLSKKGIKELVRVGEKKVHISPSF |
| Ga0150983_102196481 | 3300011120 | Forest Soil | MDESKRRAVKFLQKEIKTYLALSLFLSKKGIKEHLRA |
| Ga0150983_146260821 | 3300011120 | Forest Soil | MEDYKRRVARFLHKEIKTYTALSLFLSKKDARDHLRLGVEAIL |
| Ga0150983_158552593 | 3300011120 | Forest Soil | MDESRRRAIKFLEKEIKTYLALSLFLSKKSIRQHLRVGEKKVLG |
| Ga0150983_165320601 | 3300011120 | Forest Soil | MDESKRRVVRFLEKEIKTYMALSLFLSKKGIKGHVRVGER |
| Ga0137393_113598401 | 3300011271 | Vadose Zone Soil | MDESTRRVVKFLEKEIKTYTALSLFLSKKGIKEHVRVGEKKVLISPSFYKER |
| Ga0137389_106376993 | 3300012096 | Vadose Zone Soil | MDESTRRVVKFLEKEIKTYTALSLFLSKKGIKEHVRVGEKKVLISP |
| Ga0137389_116337692 | 3300012096 | Vadose Zone Soil | MDESRRHAIKFLEKEIKTYLALSLFLSKKGIKEHVRVG |
| Ga0137362_117835341 | 3300012205 | Vadose Zone Soil | MDESRRRAIKFLEKEIKTYLALSLFLSKKGIKADVRVGEKKVLISP |
| Ga0137376_103990202 | 3300012208 | Vadose Zone Soil | MDESKRRAVRFLEKEIKTYMALSLFLSKKGIKEHARMEKKKILISPSI* |
| Ga0157304_10266671 | 3300012882 | Soil | MEADWRSAMDDSKRSAVKFLEKEIKTYMALSLFLAKRGIDEHVCVGDKKI |
| Ga0137359_107316254 | 3300012923 | Vadose Zone Soil | MDESRRRAIKFLEKEIKTYLALSLFLSKKGIKADV |
| Ga0137359_116471092 | 3300012923 | Vadose Zone Soil | MDESKRRVIKFLEKEIKTYKALALFLSKKGIKEHVRVGE |
| Ga0137404_113895391 | 3300012929 | Vadose Zone Soil | MDDSRRRAIQFLEKEIKTYLALSLFLSKKGIKADVRLEAKKVIIS |
| Ga0164309_111052321 | 3300012984 | Soil | MEESVRRVIQFLEKEIKTYGALSLFLSKKGIREHLRVGDNRVL |
| Ga0164309_112461801 | 3300012984 | Soil | VVRRIAMDESKRMAVKFLEKEIKTYLALSLFLSRKDAREHV |
| Ga0164308_121626891 | 3300012985 | Soil | VVRRIAMDESKRMAVKFLEKEIKTYLALSLFLSRKDAREHVRIG |
| Ga0181534_104999571 | 3300014168 | Bog | MDVARRGVVRFLEKETKTYAALSLFLSKKGIKEHLRTGTKA |
| Ga0182024_120772481 | 3300014501 | Permafrost | MDDSKRHVVQFLEKEIKTYKALARFLAKKGIEEHVRIGSKRILISPAFYKDR |
| Ga0137420_12256871 | 3300015054 | Vadose Zone Soil | MDESRRRAIKFLEKEIKTYLALSLFLSKKGIKADVRVGEKKVLISPSYYKEPR |
| Ga0187802_103893401 | 3300017822 | Freshwater Sediment | MSEWKRSVVKFLEKEIKTYMALSLFLSKKGIKEHVRV |
| Ga0187818_102126871 | 3300017823 | Freshwater Sediment | MDESKRRVVKFLEKEIKTYMALSLFLSKKGIKEHVRVGEKKVLISPTF |
| Ga0187806_10835102 | 3300017928 | Freshwater Sediment | MDQSKRRAVEFLEKEIKTYTALSLFLWKQGIRQHVRVGTTTVLLCYLFYKER |
| Ga0187825_102181141 | 3300017930 | Freshwater Sediment | MDESKRHAVKFLEKEIKTYTALSLFLWKQGIRQHVRVGTTTVLLCYL |
| Ga0187809_100700772 | 3300017937 | Freshwater Sediment | MDQSKRRAVEFLEKEIKTYTALSLFLWKQGIRQHVRVG |
| Ga0187808_100368641 | 3300017942 | Freshwater Sediment | MDESKRHAVKFLEKEIKTYTALSLFLSKQGIRQHVRVGTTTVL |
| Ga0187819_102116871 | 3300017943 | Freshwater Sediment | MSESKRRMVKFLEKEIKTYKALSLFLSKKDIKEHIRKEQQKVPISPT |
| Ga0187886_12579601 | 3300018018 | Peatland | MNQSKRRVVKFLEKEIKTYMALSLFLTKKGIKEHLRVGEKKVLISPTFYKER |
| Ga0187859_100544321 | 3300018047 | Peatland | MDKSSRRVIQFLEKEIKTYAALSLFFMKKGINERG |
| Ga0210403_100511701 | 3300020580 | Soil | MDESKRRAVKFLEKEIKTYKALSLFLSKKGVKEHLG |
| Ga0210403_102037844 | 3300020580 | Soil | MDESKRHAFKFLEKEIKTYAALSLFLSKQGIRQRVRMGASTVLICPLFY |
| Ga0210403_104352953 | 3300020580 | Soil | MGTSRRSVVRFIEKEIKTYMALSLFLSKKGIKEHARPGEENLVGPSF |
| Ga0210403_105741141 | 3300020580 | Soil | MEESKRRAVRFLEKEIKTYTALSLFLSKKGIKEHVRVGEKRVLISPS |
| Ga0210403_109663071 | 3300020580 | Soil | MDESRRRAIKFLEKEIKTYLALSLFLSKKGIKEHVRVGEKRVLIGP |
| Ga0210395_109187161 | 3300020582 | Soil | MDESMQRAIKFLEKEIKTYMALSLFLSKKGIKADVRLGQKKVLVSSAYYKER |
| Ga0210400_103241293 | 3300021170 | Soil | MDESRRRAIKFLEKEIKTYLALSLFLSKKGIKEHVRVGEKKVLISP |
| Ga0210405_105167033 | 3300021171 | Soil | MSTSRRRVVRFIEKEIKTYMALSRFLSKKGTTEHVREGEEKVLA |
| Ga0210405_108093583 | 3300021171 | Soil | MDESMQRAIKFLEKEIKTYTALSLFLSKKGIKADVRLGQKKVLISPAY |
| Ga0210388_105640592 | 3300021181 | Soil | MDKSSRRVVQFLEKEIKTYAALSLFFMKKGLNERGRVG |
| Ga0210393_103746021 | 3300021401 | Soil | MDQSKRRAVKFLEKEIKTYTALSLFLSKQGIRQHVRVGATTV |
| Ga0210397_104998901 | 3300021403 | Soil | MDDSKRHAIQFLEKEIKTYTALSLFLTKKGIKEHVLVGEK |
| Ga0210386_103308303 | 3300021406 | Soil | MDESKRRAVKFLEKEIKTYAALSLFLSNKGMKQQVRVGTSTVLLS |
| Ga0210384_100037441 | 3300021432 | Soil | MNDSKQRVAKFLEKEIKTYAALSLFLSKKGISESLN |
| Ga0210384_107482043 | 3300021432 | Soil | MNDSNRRVVRFLQKEIKTYTALSLFLTRKGTKQHVHLSATV |
| Ga0210384_118041341 | 3300021432 | Soil | MDESRRRAVRFLEKEIKTYMALSRFLSKKGIKEHVRLGDKTVLICPSF |
| Ga0210391_104682871 | 3300021433 | Soil | MHDSRQRAVRFLEKEIKTYTALSLFLSKKGVREQLRA |
| Ga0210390_104696101 | 3300021474 | Soil | MDKSSRRVVQFLEKEIKTYAALSLFFMKKGLNERGRV |
| Ga0210402_105426841 | 3300021478 | Soil | MEDPKRRVVKFLEKEIKTYTALSLFLSKKGFKEHVRVGAKRVL |
| Ga0210410_105835642 | 3300021479 | Soil | AMDESKRRVVKFLEKEINTYRALSLFLSKKGIKEHVQVGEKKVLLSPSFIKSE |
| Ga0210410_107952091 | 3300021479 | Soil | MHDAKQQAVRFLEKEIKTYTALSLFLSKKGGSKHPSA |
| Ga0224563_10151401 | 3300022731 | Soil | MHDSKQQVVRFLEKEIKTYTALSLFLSKKGIRAHQRAGANK |
| Ga0247687_10741392 | 3300024286 | Soil | MDDSKRSAVKFLEKEIKTYMALSLFLAKKGIDEHVCVGDKKILISPTFYKERM |
| Ga0208034_10596551 | 3300025442 | Peatland | LDESKRRVIQFLEKEIKTYTALALFLSKKGIKERMRVGGKEI |
| Ga0208688_10125585 | 3300025480 | Peatland | MDQSKRRIVKFLEKEIKTYMALSLFLSKKGIKEHLRVGENKVLISPTFYKE |
| Ga0208714_10941951 | 3300025527 | Arctic Peat Soil | MDESKRHAVRFLEKEIKTYLALSLFFSKKDIKEHVRVGEKKVVINLAFY |
| Ga0207647_105730901 | 3300025904 | Corn Rhizosphere | MDESSRRVIQFLEKEIKTYAALSLFLSKKGIREHLR |
| Ga0207685_106131331 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MDESKRMAVKFLEKEIKTYLALSLFLSRKDAEEHVRIGGRKIL |
| Ga0207663_104188522 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MDESKRRTVKFLEKEIKTYLALSLFLSKKGIKQHVRVGEKKVVISPSF |
| Ga0207663_105864303 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MDESKRNAVKFLEKEIKTYLALSLFLSKKDLEQHVRV |
| Ga0207646_114133603 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDESKVSAVKFLEKEIKTYMALSLFLSKKGIDEHVRVG |
| Ga0207646_117755411 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDESKRSAVKFLEKEIKTYLALSLFLSRKGTEEHVRVG |
| Ga0207694_114328821 | 3300025924 | Corn Rhizosphere | MDESSRRVIQFLEKEIKTYAALSLFLSKKGIREHLRV |
| Ga0209240_100002247 | 3300026304 | Grasslands Soil | MDDSKRRAVTFLEKEIKTYAALSLFLSKKGIKEHMRVGEKRVLISPS |
| Ga0257160_10245413 | 3300026489 | Soil | MDESKPSAAKFLEKEIKTYLALSLFLSKKGIEEHLRLATTKF |
| Ga0209011_10596091 | 3300027678 | Forest Soil | MDESRRRAIKFLEKEIKTYLALSLFLSKKGIKADVRVGEKKVLISPSYYKE |
| Ga0209698_103285121 | 3300027911 | Watersheds | LNESKRRVIQFLEKEIKTYTALALFLSKKGIKERIRVGGKE |
| Ga0307504_102863101 | 3300028792 | Soil | MNESKRRVVKFLEKEIKTYTALSLFLSKKGIKDHVRIGEKRV |
| Ga0308309_105297641 | 3300028906 | Soil | MDESSRRVIQFLEKEIKTYAALSLFLVKKGIKERVRVGNKR |
| Ga0222749_107519961 | 3300029636 | Soil | MERSKQRVVIFLEKEIKTYLALSLFLSKKGIKEHARLEKKK |
| Ga0170824_1197834781 | 3300031231 | Forest Soil | MDESKRHVVKFLEKEIKTYTALALFLSKKNIKEHVRV |
| Ga0302320_112892831 | 3300031524 | Bog | MDDSKRHAVQFLEKEIKTYRALARFLAKKGIEEHVRIGSKRILISPAFYK |
| Ga0307476_102653691 | 3300031715 | Hardwood Forest Soil | MDESKRRVVRFLEKEIKTYLALSLFLSKKGIKEHVRVGE |
| Ga0307476_107649822 | 3300031715 | Hardwood Forest Soil | MDESKRRAVRFLEKEIKTYTALSLFLSKKGIKEPVRVGARKIVISPTFY |
| Ga0307469_124983831 | 3300031720 | Hardwood Forest Soil | MDESKRSAVKFLEKEIKTYLALSLFLSKKGIEEHVGVGASKILISPTFYKE |
| Ga0307477_101466243 | 3300031753 | Hardwood Forest Soil | MEDSVDESKRRAVRFLEKEIKTYTALSLFLSKKGIREHARTEKKKVLISPTFYK |
| Ga0307475_100815244 | 3300031754 | Hardwood Forest Soil | MEDSKRRVVRFLEKEIKTYTALSLFLSKKGIREHVRV |
| Ga0307473_100960011 | 3300031820 | Hardwood Forest Soil | MDESKRRVVKFLEKEIKTYTALSLFLSKKGIKEHARMEKKKILISPSF |
| Ga0307478_114114893 | 3300031823 | Hardwood Forest Soil | MDESKRNAVKFLEKEIKTYLALSLFLSKKDIDEHVRVGARKILIG |
| Ga0307470_105424992 | 3300032174 | Hardwood Forest Soil | MDNSKLSAVKFLEKEIKTYMALSLFLAKRGIDEHVCIGDKKILISPTFYKERM |
| Ga0307470_107983963 | 3300032174 | Hardwood Forest Soil | MDESKRNAVKFLEKEIKTYLALSLFLSKKDIEQHVRV |
| Ga0307471_1000697114 | 3300032180 | Hardwood Forest Soil | MDESKRRVVKFLEKEINTYMALSLFLSKNGIKERVRVGEKEVLISP |
| Ga0307471_1001189921 | 3300032180 | Hardwood Forest Soil | MDESRRRAIKFLEKEIKTYLALSLFLSKKGIKADVRVGAKKVLISPSFYKE |
| Ga0307471_1019846862 | 3300032180 | Hardwood Forest Soil | MDKSRQRAIKFLEKEIKTYLALSLFLSKKAIKEHVRVGEEKVLIS |
| Ga0307471_1031540373 | 3300032180 | Hardwood Forest Soil | MDESKRRVVKFLEKEIKTYTALSLFLSKKGIKEHVRVGEKKV |
| Ga0307471_1038099861 | 3300032180 | Hardwood Forest Soil | MNESKRRVVKFLEKEIKTYRALSLFLSKKGIKELV |
| Ga0307472_1027263281 | 3300032205 | Hardwood Forest Soil | MDDSKRSAVKFLEKEIKTYMALSLFLAKRGIDEHVCVGDRKILISPT |
| Ga0315742_100631474 | 3300032756 | Forest Soil | MHDSKQQVVRFLEKEIKTYTALSLFLSKKGVREQVQEKRLRSKVKERE |
| Ga0315742_107117073 | 3300032756 | Forest Soil | MDESKRRAVRFLEKEIKTYAALSLFLSKKGIKEPLCVGARKIVIGP |
| Ga0326727_106730271 | 3300033405 | Peat Soil | MVESKRRVVRFLEKEIKTYTALSLFLSKKGIHEHVRVGGEKILISPTFY |
| Ga0326726_112714513 | 3300033433 | Peat Soil | MNQSKRRVVKFLEKEIKTYMALSLFLTKKGIKEHLR |
| Ga0371490_11134621 | 3300033561 | Peat Soil | MRESKRRVVKFLEKEIKTYTALSLFLSKKGIKEQLHAGQKKVLISP |
| ⦗Top⦘ |