Basic Information | |
---|---|
Family ID | F073912 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 41 residues |
Representative Sequence | MPDTQKQIVTVGVTGASGAILAQKTLALLEEDARVARVHL |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 39.17 % |
% of genes near scaffold ends (potentially truncated) | 99.17 % |
% of genes from short scaffolds (< 2000 bps) | 90.00 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (59.167 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.500 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF00731 | AIRC | 25.00 |
PF12680 | SnoaL_2 | 15.00 |
PF08240 | ADH_N | 3.33 |
PF01609 | DDE_Tnp_1 | 1.67 |
PF03841 | SelA | 0.83 |
PF00440 | TetR_N | 0.83 |
PF12704 | MacB_PCD | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.67 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.67 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.67 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.67 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.67 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.67 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.83 % |
Unclassified | root | N/A | 39.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573004|GZGWRS402HKQSF | Not Available | 519 | Open in IMG/M |
3300001154|JGI12636J13339_1051586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300002908|JGI25382J43887_10286545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 732 | Open in IMG/M |
3300002917|JGI25616J43925_10037702 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
3300005451|Ga0066681_10152683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1358 | Open in IMG/M |
3300005526|Ga0073909_10393635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 651 | Open in IMG/M |
3300005529|Ga0070741_11470097 | Not Available | 563 | Open in IMG/M |
3300005555|Ga0066692_10731608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 611 | Open in IMG/M |
3300005568|Ga0066703_10060031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2154 | Open in IMG/M |
3300005921|Ga0070766_10936922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 594 | Open in IMG/M |
3300005950|Ga0066787_10050154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 801 | Open in IMG/M |
3300006047|Ga0075024_100178898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 982 | Open in IMG/M |
3300006050|Ga0075028_100382674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 801 | Open in IMG/M |
3300006052|Ga0075029_100537640 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300006173|Ga0070716_100999022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 661 | Open in IMG/M |
3300006174|Ga0075014_100376402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 768 | Open in IMG/M |
3300006175|Ga0070712_100237733 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
3300006804|Ga0079221_10626359 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300007258|Ga0099793_10406788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300007258|Ga0099793_10434962 | Not Available | 648 | Open in IMG/M |
3300009012|Ga0066710_101009663 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300009038|Ga0099829_10571080 | Not Available | 940 | Open in IMG/M |
3300009038|Ga0099829_10639467 | Not Available | 884 | Open in IMG/M |
3300009143|Ga0099792_10905966 | Not Available | 584 | Open in IMG/M |
3300009624|Ga0116105_1220611 | Not Available | 530 | Open in IMG/M |
3300009646|Ga0116132_1179620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300010046|Ga0126384_11586494 | Not Available | 616 | Open in IMG/M |
3300010320|Ga0134109_10013123 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
3300010339|Ga0074046_10923810 | Not Available | 506 | Open in IMG/M |
3300010358|Ga0126370_11783372 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300010376|Ga0126381_101649100 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300011270|Ga0137391_11210060 | Not Available | 603 | Open in IMG/M |
3300012189|Ga0137388_11702469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 564 | Open in IMG/M |
3300012201|Ga0137365_10375913 | Not Available | 1049 | Open in IMG/M |
3300012203|Ga0137399_10764539 | Not Available | 813 | Open in IMG/M |
3300012206|Ga0137380_10366481 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
3300012209|Ga0137379_11124093 | Not Available | 691 | Open in IMG/M |
3300012917|Ga0137395_11157581 | Not Available | 544 | Open in IMG/M |
3300012918|Ga0137396_10204864 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300012922|Ga0137394_10225657 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
3300012923|Ga0137359_10430672 | Not Available | 1168 | Open in IMG/M |
3300012925|Ga0137419_10531070 | Not Available | 938 | Open in IMG/M |
3300012927|Ga0137416_11505635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300012944|Ga0137410_10040562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3285 | Open in IMG/M |
3300012976|Ga0134076_10019291 | All Organisms → cellular organisms → Bacteria | 2406 | Open in IMG/M |
3300014152|Ga0181533_1012872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6117 | Open in IMG/M |
3300014155|Ga0181524_10265585 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300015051|Ga0137414_1146221 | Not Available | 858 | Open in IMG/M |
3300015054|Ga0137420_1474921 | All Organisms → cellular organisms → Bacteria | 2962 | Open in IMG/M |
3300015087|Ga0167637_1051678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300016404|Ga0182037_10363704 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300017654|Ga0134069_1385250 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300017822|Ga0187802_10427841 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300017934|Ga0187803_10098914 | Not Available | 1146 | Open in IMG/M |
3300017934|Ga0187803_10241365 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300017936|Ga0187821_10293023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300017942|Ga0187808_10338826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300017943|Ga0187819_10414852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 773 | Open in IMG/M |
3300017961|Ga0187778_10580023 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300017973|Ga0187780_10419204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
3300018006|Ga0187804_10022787 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
3300020010|Ga0193749_1095074 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 535 | Open in IMG/M |
3300020170|Ga0179594_10301534 | Not Available | 607 | Open in IMG/M |
3300020579|Ga0210407_10350459 | Not Available | 1155 | Open in IMG/M |
3300020580|Ga0210403_11198433 | Not Available | 585 | Open in IMG/M |
3300020581|Ga0210399_11034313 | Not Available | 660 | Open in IMG/M |
3300021168|Ga0210406_11260827 | Not Available | 534 | Open in IMG/M |
3300021170|Ga0210400_10586442 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300021401|Ga0210393_11508135 | Not Available | 535 | Open in IMG/M |
3300021407|Ga0210383_11702790 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300021474|Ga0210390_10670840 | Not Available | 865 | Open in IMG/M |
3300021478|Ga0210402_11530098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300021479|Ga0210410_10472240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
3300021559|Ga0210409_10629690 | Not Available | 942 | Open in IMG/M |
3300024181|Ga0247693_1030705 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300024290|Ga0247667_1099400 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300025501|Ga0208563_1110104 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300026296|Ga0209235_1191093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300026304|Ga0209240_1027528 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
3300026310|Ga0209239_1127683 | Not Available | 1046 | Open in IMG/M |
3300026359|Ga0257163_1081526 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 524 | Open in IMG/M |
3300026537|Ga0209157_1069728 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
3300026555|Ga0179593_1050939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2481 | Open in IMG/M |
3300026557|Ga0179587_10518731 | Not Available | 782 | Open in IMG/M |
3300026557|Ga0179587_10845582 | Not Available | 603 | Open in IMG/M |
3300026817|Ga0207775_106594 | Not Available | 920 | Open in IMG/M |
3300027432|Ga0209421_1085695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300027643|Ga0209076_1036533 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300027663|Ga0208990_1162875 | Not Available | 584 | Open in IMG/M |
3300027701|Ga0209447_10215511 | Not Available | 524 | Open in IMG/M |
3300027737|Ga0209038_10233270 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300027738|Ga0208989_10259934 | Not Available | 563 | Open in IMG/M |
3300027842|Ga0209580_10024713 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
3300027846|Ga0209180_10316323 | Not Available | 893 | Open in IMG/M |
3300027889|Ga0209380_10711352 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300027889|Ga0209380_10783989 | Not Available | 541 | Open in IMG/M |
3300027910|Ga0209583_10457655 | Not Available | 621 | Open in IMG/M |
3300028536|Ga0137415_10049450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4083 | Open in IMG/M |
3300028536|Ga0137415_11064044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300029636|Ga0222749_10615680 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300030706|Ga0310039_10045376 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
3300030916|Ga0075386_12132799 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300031128|Ga0170823_10334718 | Not Available | 551 | Open in IMG/M |
3300031681|Ga0318572_10796536 | Not Available | 562 | Open in IMG/M |
3300031720|Ga0307469_10568783 | Not Available | 1007 | Open in IMG/M |
3300031754|Ga0307475_10977858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
3300031754|Ga0307475_11049530 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300031962|Ga0307479_10574494 | Not Available | 1109 | Open in IMG/M |
3300031962|Ga0307479_10594931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1088 | Open in IMG/M |
3300031962|Ga0307479_10754052 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300032001|Ga0306922_10500708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
3300032001|Ga0306922_10506488 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300032076|Ga0306924_12191786 | Not Available | 564 | Open in IMG/M |
3300032174|Ga0307470_10448400 | Not Available | 927 | Open in IMG/M |
3300032174|Ga0307470_11584909 | Not Available | 547 | Open in IMG/M |
3300032205|Ga0307472_100345215 | Not Available | 1219 | Open in IMG/M |
3300032261|Ga0306920_102282888 | Not Available | 750 | Open in IMG/M |
3300032782|Ga0335082_10775869 | Not Available | 820 | Open in IMG/M |
3300032783|Ga0335079_11237823 | Not Available | 749 | Open in IMG/M |
3300032828|Ga0335080_12017800 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.17% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.50% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.33% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.50% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.50% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.67% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.67% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.83% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.83% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015087 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026817 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FG2_04772750 | 2189573004 | Grass Soil | MRENAKKIITVGVTGASGALLAQKMLDLLDRDANVERV |
JGI12636J13339_10515861 | 3300001154 | Forest Soil | MADTQKQIVALGVTGASGAILAQKTLALLEEDARVARVHL |
JGI25382J43887_102865451 | 3300002908 | Grasslands Soil | MPNREGRIITVGVTGASGALLAQAALRILEDDARVTRVHLVVSDAG |
JGI25616J43925_100377023 | 3300002917 | Grasslands Soil | MTDTQKQIVTVGVTGASGAILAQKTLVLLEEDPRVARVHL |
Ga0066681_101526831 | 3300005451 | Soil | MPDTQKQIVTVGVTGASGAILAQKTLALLEEDARVARVHL |
Ga0073909_103936352 | 3300005526 | Surface Soil | MADTQKQIVTVGVTGASGAILAQKTLALLEEDARVARVHMVVTE |
Ga0070741_114700971 | 3300005529 | Surface Soil | MESAQGQVVIVGVTGASGAILAQTALRLLNADARVSRIHL |
Ga0066692_107316081 | 3300005555 | Soil | MPNREGRIITVGVTGASGALLAQAALRILEDDARVTRVHLVVSDAGQR |
Ga0066703_100600314 | 3300005568 | Soil | MADIQKQIVTVGVTGASGAILAQKALVLLEEDPRVGRVHLVITEAGQRLF |
Ga0070766_109369221 | 3300005921 | Soil | MASTQGRIITIGVTGASGAILAQKALTLLEDDARVSRIHLVVTETGQR |
Ga0066787_100501542 | 3300005950 | Soil | MPQTQGQTVTVGVTGASGAILAQKTLALLEADARVARVH |
Ga0075024_1001788982 | 3300006047 | Watersheds | MPSTKAHIVTVGVTGASGAIFAQKILALLEDDARVA |
Ga0075028_1003826742 | 3300006050 | Watersheds | MPSTKAHIVTVGVTGASGAIFAQKILALLEDDARVARV |
Ga0075029_1005376401 | 3300006052 | Watersheds | MADTQKQIVTIGVTGASGAILAQKTLVLLEEDPRVSQVHLVLTE |
Ga0070716_1009990221 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRENARKIITVGVTGASGALLAKKMLDLLDRDANVERVHLVVS |
Ga0075014_1003764022 | 3300006174 | Watersheds | MPQAQTKIINVGVTGASGAIFAQKTLALLEDDPRVGRIY |
Ga0070712_1002377333 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLENGRKIVTVGVSGASGAVLAQKMLALLDSDSRVERVHLVVTET |
Ga0079221_106263592 | 3300006804 | Agricultural Soil | MNSDTMPPQGQIITVGVTGASGAVFAQKALMLLED |
Ga0099793_104067881 | 3300007258 | Vadose Zone Soil | MPSNKGQTITVGVTGASGAVFAQKTLSMLEDDPRVGR |
Ga0099793_104349621 | 3300007258 | Vadose Zone Soil | MPRTQGQIVTVGVTGASGAILAQKTLTLLEADDRVARVHLVVT |
Ga0066710_1010096631 | 3300009012 | Grasslands Soil | MPNREGRIITVGVTGASGALLAQAALRILEDDARVTRVHLVVSD |
Ga0099829_105710801 | 3300009038 | Vadose Zone Soil | MNPDNMPRAQGQIITVGVTGASGALLAQKALALLED |
Ga0099829_106394672 | 3300009038 | Vadose Zone Soil | MPDTQKQVVTVGVTGASGAILAQKALALLEEDPRVARIHLVV |
Ga0099792_109059661 | 3300009143 | Vadose Zone Soil | MPRTQGQIITVGVTGASGALLAQKALTLLEDDARVSR |
Ga0116105_12206111 | 3300009624 | Peatland | MPDSKPQTITVGVTGASGALLAQKALQLLDADPRVARIHL |
Ga0116132_11796201 | 3300009646 | Peatland | MSQPKEQVVTVGVTGASGAILAQKTLALLEEDARVARVLLVVTETG |
Ga0126384_115864941 | 3300010046 | Tropical Forest Soil | MTYAQNQVVTVGVTGASGAILAQKALDLLEGDSRVAR |
Ga0134109_100131231 | 3300010320 | Grasslands Soil | MADIQKQIVTVGVTGASGAILAQKALVLLEEDPRVGRVHLVITEA |
Ga0074046_109238102 | 3300010339 | Bog Forest Soil | MPDSEQLTITVGVTGASGAILAQKTLQLLEADARVGRVHL |
Ga0126370_117833721 | 3300010358 | Tropical Forest Soil | MFEANPKTITIGVTGASGAILAQKTLAQLEADPRVAKVHLAITE |
Ga0126381_1016491001 | 3300010376 | Tropical Forest Soil | MTYAQNQVVTVGVTGASGAILAQKALDLLEGDSRVARIHLVVTEAGQ |
Ga0137391_112100601 | 3300011270 | Vadose Zone Soil | MADTQKQIVTVGVTGASGAILAQKTLVLLEEDPRVARVHLV |
Ga0137388_117024693 | 3300012189 | Vadose Zone Soil | MPRAQGQIITVGVTGASGALLAQKALALLEDDARVA |
Ga0137365_103759132 | 3300012201 | Vadose Zone Soil | MPDTQKQVVTVGVTGASGAILAQKALALLEEDPRVARIHLVVT |
Ga0137399_107645392 | 3300012203 | Vadose Zone Soil | MADTQKQIVTVGVTGASGAILAQKTLALLEEDARVARVHLVVTEAG |
Ga0137380_103664811 | 3300012206 | Vadose Zone Soil | MPNREGRIITVGVTGASGALLAQAALCILEDDARVTRVHLVVSDA |
Ga0137379_111240932 | 3300012209 | Vadose Zone Soil | MPDTQKQVVTVGVTGASGAILAQKALALLEEDPRVARIHLVVTET |
Ga0137395_111575812 | 3300012917 | Vadose Zone Soil | MADKQKQTVTVGVTGASGAILAQKTLALLEEDARV |
Ga0137396_102048641 | 3300012918 | Vadose Zone Soil | MAETQKQIVTVGVTGASGAILAQKTLVLLEEDPRVARVHLV |
Ga0137394_102256571 | 3300012922 | Vadose Zone Soil | MADTQKQIVTVGVTGASGAILAQKALVLLEEDARVARVHLVVTEAGQR |
Ga0137359_104306721 | 3300012923 | Vadose Zone Soil | MPRAQAQIVTVGVTGASGAILAQKTLTLVEADDRVARVHLVVTE |
Ga0137419_105310701 | 3300012925 | Vadose Zone Soil | MGDTQKRIVTVGVTGASGVILSQKTLALLEEDVRVARVHL |
Ga0137416_115056352 | 3300012927 | Vadose Zone Soil | MADTQKQIVTVGVTGASGAILAQRTLALLEEDARVARV |
Ga0137410_100405621 | 3300012944 | Vadose Zone Soil | MADTQKQIVTVGVTGASGAILAQKALVLLEEDARVARVHLVVTEA |
Ga0134076_100192911 | 3300012976 | Grasslands Soil | MADIQKQIVTVGVTGASGAILAQKTLALLEEDQRVGRVHLVITEAGQRLF |
Ga0181533_10128727 | 3300014152 | Bog | MTSAQTQTLTVGVTGASGAIFAQKTLALLEDDPRVTRVH |
Ga0181524_102655853 | 3300014155 | Bog | MTSAQTQTLTVGVTGASGAIFAQKTLALLEDDPRVT |
Ga0137414_11462212 | 3300015051 | Vadose Zone Soil | MADTQKQIVTVGVTGASGAILAQKMLALLEEDVRVARVHLV |
Ga0137420_14749211 | 3300015054 | Vadose Zone Soil | MNPDIMPRAQGQIITVGVTGASGAVLAQKALILLGR* |
Ga0167637_10516782 | 3300015087 | Glacier Forefield Soil | MHPQIAELQMTHDEKQIVTVGVTGASGAILAQKALELLEADPRVDKIHLVITETGQ |
Ga0182037_103637043 | 3300016404 | Soil | MAATEGRIITIGVTGASGALFAQKALALLEEDPRVSRIHLV |
Ga0134069_13852502 | 3300017654 | Grasslands Soil | MPDTQKQVVTVGVTGASGAILAQKALALLEEDPRVARIHLVVTETGQ |
Ga0187802_104278412 | 3300017822 | Freshwater Sediment | MAAQGRIITIGVTGASGAIFAQKTLALLEDDARVSRVHLVVTET |
Ga0187803_100989143 | 3300017934 | Freshwater Sediment | MANAEKQTVTVGVTGASGAILAQKALALLEEDVRVARVHLVVTETGQ |
Ga0187803_102413652 | 3300017934 | Freshwater Sediment | MSSAHTKTITVGVTGASGAIFAQKTLALLEDDPGVARVHLVVT |
Ga0187821_102930231 | 3300017936 | Freshwater Sediment | MSDAQKQTVTVGVTGASGALLAQKVVALLEDDPRVARIHLV |
Ga0187808_103388262 | 3300017942 | Freshwater Sediment | MAAQGRIITIGVTGASGAIFAQKALALLEDDPRVF |
Ga0187819_104148523 | 3300017943 | Freshwater Sediment | MPEAQKQIVTVGVTGASGAILAQKILTLLEEDPRVVRI |
Ga0187778_105800231 | 3300017961 | Tropical Peatland | MATTQARIITIGVTGASGAILAQKALTLLDSDSRVARIHLVVS |
Ga0187780_104192041 | 3300017973 | Tropical Peatland | MPKAITEERIITVGVTGASGAIYAQALLRLLEADAR |
Ga0187804_100227871 | 3300018006 | Freshwater Sediment | MVATQGRIITIGVTGASGAILAQKALALLEDDSRVSRIHLVVTET |
Ga0193749_10950742 | 3300020010 | Soil | MRENDKKIVTVGVTGASGAVHAQKMLALLDSDPRVER |
Ga0179594_103015342 | 3300020170 | Vadose Zone Soil | MADTQKQIVTVGVTGASGAILAQKTLALLEEDPRVAR |
Ga0210407_103504591 | 3300020579 | Soil | MSQSENQIVTVGVTGASGAVLAQKTLGLLEQDARVAR |
Ga0210403_111984331 | 3300020580 | Soil | MNPNNMPRAQGQIITVGVTGASGALLAQKALALLEDDARVARVHLVVTEAGQ |
Ga0210399_110343131 | 3300020581 | Soil | MPDTLKQVVTVGVTGASGALLAQKTLSLLEEDARVARVHVVVTE |
Ga0210406_112608272 | 3300021168 | Soil | MNPNNMPRAQGQIITVGVTGASGALLAQKALALLEDDAR |
Ga0210400_105864421 | 3300021170 | Soil | MNPDTMPPQGQIITVGVTGASGALFAQKALALLEDDARVARVHLVVTETGQ |
Ga0210393_115081351 | 3300021401 | Soil | MSSTKGQIITVGVTGASGAIYAQKTLALLEDDSRVERVHLVVT |
Ga0210383_117027901 | 3300021407 | Soil | MPHAQGQTVTVGVTGASGAILAQKTLALLEADARVA |
Ga0210390_106708402 | 3300021474 | Soil | MHDTQKQVVTVGVTGASGAVLAQKALDLLEKDPRVAR |
Ga0210402_115300982 | 3300021478 | Soil | MPSTKAHIVTVGVTGASGAIFAQKMLSLLEDDARVG |
Ga0210410_104722403 | 3300021479 | Soil | MADTQKQIVTVGVTGASGAVLAQKTLSLLEQDERV |
Ga0210409_106296901 | 3300021559 | Soil | MSQAEKQTVTVGVTGASGAILAQKTLELLEQDARVARI |
Ga0247693_10307051 | 3300024181 | Soil | MPSNKGQTITVGVTGASGAVFAQKTLAMLEDDPRVGR |
Ga0247667_10994002 | 3300024290 | Soil | MVDTQKQVVTIGVTGASGAILAQKTLSILEADSRVPRIHLVVTEAGQRLFS |
Ga0208563_11101041 | 3300025501 | Peatland | MSQPKEQVVTVGVTGASGAILAQKTLALLEEDARVA |
Ga0209235_11910932 | 3300026296 | Grasslands Soil | MPNREGHIITVGVTGASGALLAQAALRILEDDARVTRVHLVVSDAGQR |
Ga0209240_10275281 | 3300026304 | Grasslands Soil | MTDTQKQIVTVGVTGASGAILAQKTLVLLEEDPRVARVHLVITE |
Ga0209239_11276832 | 3300026310 | Grasslands Soil | MADTQKQIVTVGVTGASGAILAQKMLVMLEEDPRVTCIHLVV |
Ga0257163_10815261 | 3300026359 | Soil | MADTQKQIVTIGVTGASGAILAQKTLALLEEDVRV |
Ga0209157_10697281 | 3300026537 | Soil | MTEIQKQIVTVGVTGASGAILAQKTLALLEEDQRVGRVH |
Ga0179593_10509394 | 3300026555 | Vadose Zone Soil | MNPDNMPRAQGQIITVGVTGASGAVLAQKALTLLEDDARVARV |
Ga0179587_105187311 | 3300026557 | Vadose Zone Soil | MTETQKQIVTVGVTGASGAILAQKALVLLEEDRRVGCVHLVITA |
Ga0179587_108455822 | 3300026557 | Vadose Zone Soil | MPSNKGQTITVGVTGASGAVFAQKTLAMLEEDSRVG |
Ga0207775_1065942 | 3300026817 | Tropical Forest Soil | MAGIQGQIITVGVTGASGAIFAQKALALLEEDQRV |
Ga0209421_10856951 | 3300027432 | Forest Soil | MPSTKGQIITIGVTGASGAILAQKTLALLEDDPRVSRVHLVVTETGQ |
Ga0209076_10365331 | 3300027643 | Vadose Zone Soil | MNPNNMPRTQGQIITVGVTGASGALLAQKALALLEDDA |
Ga0208990_11628751 | 3300027663 | Forest Soil | MADTQKQIVTVGVTGASGALLAQKILVLLEKDPRVERVHLVVTEAG |
Ga0209447_102155111 | 3300027701 | Bog Forest Soil | MNEAKSQNVTVGVTGASGAILAQKTLELLDTDFRVARVHLV |
Ga0209038_102332701 | 3300027737 | Bog Forest Soil | MAHAQGQTVTVGVTGASGAILALKTLALLEADARVTRIHLVVTETG |
Ga0208989_102599341 | 3300027738 | Forest Soil | MNPDNMPRAQGQIITVGVTGASGALLAQKALTLLE |
Ga0209580_100247134 | 3300027842 | Surface Soil | MLDTQKQVVTIGVTGASGAVLAQKTLSLLEQDARVARIH |
Ga0209180_103163231 | 3300027846 | Vadose Zone Soil | MPDTQKQIVTVGVTGASGAILAQKTLALLEEDTRVPRVYL |
Ga0209380_107113522 | 3300027889 | Soil | MAETQKHIVTVSVTGASGAILAQKTLVLLEEDSRVARVHLVVTE |
Ga0209380_107839891 | 3300027889 | Soil | MASTQGRIITIGVTGASGAILAQKALTLLEDDARVSRIHLVVTETG |
Ga0209583_104576552 | 3300027910 | Watersheds | MADTQKQIVTIGVTGASGAILAQKTLALLEEDPRVAQVHLVVT |
Ga0137415_100494501 | 3300028536 | Vadose Zone Soil | MADTQKQIVTVGVTGASGVILAQKTLALLEEDARVARVHLVVTEAGQR |
Ga0137415_110640441 | 3300028536 | Vadose Zone Soil | MADTQKQIVTVGVTGASGAILAQRTLALLEEDARVARVHLVV |
Ga0222749_106156801 | 3300029636 | Soil | MNPDTMPPQGQIITVGVTGASGALLAQKALALLDEDARVARVHLVV |
Ga0310039_100453765 | 3300030706 | Peatlands Soil | MTAAQTQTITVAVTGASGAIFAQKTLALLEDDPRVTRVHLVVTE |
Ga0075386_121327992 | 3300030916 | Soil | MPSTKASILTVGVTGASGAIFAQKTLSLLENDSRVSRI |
Ga0170823_103347182 | 3300031128 | Forest Soil | MTQLENQVVTVGVTGASGAVLAQKTLDLLDRDARVSR |
Ga0318572_107965361 | 3300031681 | Soil | MLRPKYMTSAKGQIVTVGVTGASGAILAQKTLELLGAD |
Ga0307469_105687832 | 3300031720 | Hardwood Forest Soil | MADAQKQIITVGVTGASGAILAQKMLALLEEDARVARVHL |
Ga0307475_109778581 | 3300031754 | Hardwood Forest Soil | MPSIKGQTITVGVTGASGAVFAQKTLAMLEDDPRVGRVH |
Ga0307475_110495302 | 3300031754 | Hardwood Forest Soil | MADTQKQIVTVGVTGASGAVLAQKTLSVLEQDARVER |
Ga0307479_105744942 | 3300031962 | Hardwood Forest Soil | MNPDNMPRAQGQIITVGVTGASGALLAQKALALLEEDARVARVHVVVTETGQR |
Ga0307479_105949313 | 3300031962 | Hardwood Forest Soil | MNLDTMPPPGQIITVGVTGASGALLAQKALALLDEDARVARVHLVVT |
Ga0307479_107540521 | 3300031962 | Hardwood Forest Soil | MNPNNMPRAQGQIITVGVTGASGALLAQKALALLEDDARVARVHLVVTET |
Ga0306922_105007083 | 3300032001 | Soil | MPSTKASIITVGVTGASGAIFAKKTLALLESDSRVSRI |
Ga0306922_105064883 | 3300032001 | Soil | MAATEGRIITIGVTGASGALFAQKALTLLEEDPRV |
Ga0306924_121917862 | 3300032076 | Soil | MPSTKASIITVGVTGASGAIFAQKTLALLENDARVSRIHLVTT |
Ga0307470_104484002 | 3300032174 | Hardwood Forest Soil | MHENGKKVITVGVTGASGALLAQKMLALLDSDPHVERVHLVV |
Ga0307470_115849092 | 3300032174 | Hardwood Forest Soil | MNPNNMPRAQGQIITVGVTGASGALLAQKVLALLEDDARVARVHLVVT |
Ga0307472_1003452151 | 3300032205 | Hardwood Forest Soil | MAETQKQIVTVGVTGASGAILAQKTLALLEEDARVA |
Ga0306920_1022828881 | 3300032261 | Soil | MPETEHKTITVGVTGASGALLAQKMLALLDADSRVR |
Ga0335082_107758691 | 3300032782 | Soil | MSSTRQVVTVGVTGASGALLAQKALILLNADSRVERIHLVVTEAGQRLFS |
Ga0335079_112378231 | 3300032783 | Soil | MANTQGRIITIGVTGASGTILAQKTLSLLEEDTRVARVHLVVTET |
Ga0335080_120178002 | 3300032828 | Soil | MHPPKIMPSTKSFTITVGVTGASGAIFAQKTLALLENDTRVSRIHL |
⦗Top⦘ |