NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073910

Metagenome / Metatranscriptome Family F073910

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073910
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 53 residues
Representative Sequence GGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLKVPAKL
Number of Associated Samples 112
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.71 %
% of genes near scaffold ends (potentially truncated) 95.00 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.167 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.500 % of family members)
Environment Ontology (ENVO) Unclassified
(27.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.333 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.74%    β-sheet: 0.00%    Coil/Unstructured: 80.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF00005ABC_tran 47.50
PF02608Bmp 40.83
PF02653BPD_transp_2 1.67
PF01434Peptidase_M41 0.83
PF01695IstB_IS21 0.83
PF00308Bac_DnaA 0.83
PF03575Peptidase_S51 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG1744Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupNSignal transduction mechanisms [T] 40.83
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 1.67
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 0.83
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.17 %
UnclassifiedrootN/A15.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002568|C688J35102_120178102Not Available913Open in IMG/M
3300004006|Ga0055453_10174239All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300004091|Ga0062387_100206375All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300004153|Ga0063455_100030697All Organisms → cellular organisms → Bacteria1611Open in IMG/M
3300004479|Ga0062595_101538562All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005336|Ga0070680_100478987All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300005436|Ga0070713_100168895All Organisms → cellular organisms → Bacteria1958Open in IMG/M
3300005439|Ga0070711_100680881All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300005454|Ga0066687_10111212All Organisms → cellular organisms → Bacteria1397Open in IMG/M
3300005471|Ga0070698_101562912All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300005529|Ga0070741_10799556All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300005564|Ga0070664_100883052All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005568|Ga0066703_10864743All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005575|Ga0066702_10534926All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300005575|Ga0066702_10847110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300005617|Ga0068859_101646665All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300005764|Ga0066903_100095858All Organisms → cellular organisms → Bacteria3976Open in IMG/M
3300005840|Ga0068870_10742656All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300005905|Ga0075269_10031368All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300006173|Ga0070716_101043854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin506649Open in IMG/M
3300006354|Ga0075021_10481461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia785Open in IMG/M
3300006576|Ga0074047_11887620All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300006604|Ga0074060_11632676All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300006791|Ga0066653_10193595All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300006797|Ga0066659_11332500All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300006854|Ga0075425_100108852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3158Open in IMG/M
3300006881|Ga0068865_101933617All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300009038|Ga0099829_10658098Not Available871Open in IMG/M
3300009174|Ga0105241_12242769Not Available542Open in IMG/M
3300009840|Ga0126313_11424594All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300010036|Ga0126305_11059713All Organisms → cellular organisms → Bacteria → Terrabacteria group557Open in IMG/M
3300010041|Ga0126312_10140624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1671Open in IMG/M
3300010364|Ga0134066_10159846Not Available715Open in IMG/M
3300010379|Ga0136449_101381622Not Available1089Open in IMG/M
3300010400|Ga0134122_11490246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300010999|Ga0138505_100010069Not Available1078Open in IMG/M
3300012189|Ga0137388_11193955All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300012207|Ga0137381_11350996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300012210|Ga0137378_11224912All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300012469|Ga0150984_113189788All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012510|Ga0157316_1038537All Organisms → cellular organisms → Bacteria → Terrabacteria group613Open in IMG/M
3300012511|Ga0157332_1005819All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300012948|Ga0126375_11346310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300012971|Ga0126369_11644565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium732Open in IMG/M
3300012975|Ga0134110_10559684Not Available527Open in IMG/M
3300012976|Ga0134076_10512909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300012984|Ga0164309_10741475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium784Open in IMG/M
3300012986|Ga0164304_10232479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1225Open in IMG/M
3300012988|Ga0164306_11612368All Organisms → cellular organisms → Bacteria → Terrabacteria group560Open in IMG/M
3300013297|Ga0157378_11590984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium699Open in IMG/M
3300013308|Ga0157375_10332020All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300013308|Ga0157375_10368115All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300014502|Ga0182021_12345270Not Available642Open in IMG/M
3300014745|Ga0157377_11215640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300015160|Ga0167642_1044847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300015359|Ga0134085_10330688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces afghaniensis → Streptomyces afghaniensis 772674Open in IMG/M
3300015372|Ga0132256_100252165All Organisms → cellular organisms → Bacteria1834Open in IMG/M
3300015372|Ga0132256_100341542All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300015373|Ga0132257_103756780All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300015374|Ga0132255_101223718Not Available1131Open in IMG/M
3300015374|Ga0132255_105880293Not Available519Open in IMG/M
3300017657|Ga0134074_1203727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300018058|Ga0187766_11193204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300018064|Ga0187773_10111478All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300018071|Ga0184618_10284269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia703Open in IMG/M
3300018076|Ga0184609_10509513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300018482|Ga0066669_11222373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300019356|Ga0173481_10423038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300019361|Ga0173482_10569884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300019869|Ga0193705_1007541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2374Open in IMG/M
3300019869|Ga0193705_1008236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter2272Open in IMG/M
3300020002|Ga0193730_1104543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium787Open in IMG/M
3300020002|Ga0193730_1188760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300021363|Ga0193699_10225066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300022756|Ga0222622_10831071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium675Open in IMG/M
3300024187|Ga0247672_1010827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1446Open in IMG/M
3300024331|Ga0247668_1009099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2080Open in IMG/M
3300025898|Ga0207692_10171590Not Available1257Open in IMG/M
3300025908|Ga0207643_10248793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1094Open in IMG/M
3300025915|Ga0207693_10630687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium833Open in IMG/M
3300025916|Ga0207663_10255223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1292Open in IMG/M
3300025917|Ga0207660_10040880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter3248Open in IMG/M
3300025922|Ga0207646_11520391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300025924|Ga0207694_11135397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300025928|Ga0207700_10426678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin5061165Open in IMG/M
3300025945|Ga0207679_11839926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300025981|Ga0207640_11762639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi559Open in IMG/M
3300025986|Ga0207658_10024930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter4185Open in IMG/M
3300026035|Ga0207703_10913627All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300026078|Ga0207702_10827035Not Available916Open in IMG/M
3300026078|Ga0207702_11696670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300027894|Ga0209068_10798154Not Available556Open in IMG/M
3300028138|Ga0247684_1011554All Organisms → cellular organisms → Bacteria1380Open in IMG/M
3300028145|Ga0247663_1008557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1394Open in IMG/M
3300028710|Ga0307322_10109855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300028714|Ga0307309_10118294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300028716|Ga0307311_10280053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300028755|Ga0307316_10072880All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300028755|Ga0307316_10120448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium924Open in IMG/M
3300028768|Ga0307280_10029893Not Available1621Open in IMG/M
3300028796|Ga0307287_10422829Not Available501Open in IMG/M
3300028800|Ga0265338_10148805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1822Open in IMG/M
3300028819|Ga0307296_10476572All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300028824|Ga0307310_10043491All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300031184|Ga0307499_10101495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium789Open in IMG/M
3300031231|Ga0170824_111863864All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031344|Ga0265316_10028645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4591Open in IMG/M
3300031711|Ga0265314_10162766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Oceanicola → Oceanicola granulosus → Oceanicola granulosus HTCC25161356Open in IMG/M
3300031740|Ga0307468_101243111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium674Open in IMG/M
3300031754|Ga0307475_10190719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin5061637Open in IMG/M
3300031854|Ga0310904_11158960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300031892|Ga0310893_10264036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300031908|Ga0310900_11418899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300032002|Ga0307416_100804043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1036Open in IMG/M
3300032160|Ga0311301_11021530Not Available1090Open in IMG/M
3300032256|Ga0315271_10020563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4508Open in IMG/M
3300032828|Ga0335080_11148079All Organisms → cellular organisms → Bacteria783Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.33%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.50%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.50%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.67%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.67%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.83%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.83%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.83%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.83%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012510Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610Host-AssociatedOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015160Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river))EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J35102_12017810213300002568SoilEKAGKFKGGGDLLFNLKNGGMSVGKINPSVPKAYIKLMNSYKARIIAGKLKVPASL*
Ga0055453_1017423913300004006Natural And Restored WetlandsGNLLFNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKKKLKVPTKL*
Ga0062387_10020637513300004091Bog Forest SoilDLVFNLKNHGVGVGKISPDVPASWINLMNSYRAKIVAGTLMIPTALP*
Ga0063455_10003069733300004153SoilKNGGFRGGGNLLFNLKNGGMGVGKINPAVPKKFITAMNKIKVKIIKGQLKVKTKV*
Ga0062595_10153856213300004479SoilNLLFNLKNKGMGVGKMNPAVPKAYIKLMNTYKTKIIKKKLKVPTKLS*
Ga0070680_10047898723300005336Corn RhizosphereAAAGQFKGGSDLLLNLKNNGVGVGKVSPSVPSSWIKLMNSYRAKIIAGKLKPPAALGK*
Ga0070713_10016889533300005436Corn, Switchgrass And Miscanthus RhizosphereKGFKGGGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS*
Ga0070711_10068088123300005439Corn, Switchgrass And Miscanthus RhizosphereSGVKRVDNGVYQAIQKAQSGKGFKGGGNLLFNLKNGGMSVGKINPTVPKAYIKLMNAYKTKIIKKKLTVPTKL*
Ga0066687_1011121213300005454SoilLFNLKNGGMSVGKINPSVPKKFITAMNKIKVKIIKKQLRVPAKL*
Ga0070698_10156291213300005471Corn, Switchgrass And Miscanthus RhizosphereAIQQASAGQFKGGSDLVFNLKNNGMGVGRINPSVPKAWITLMNGYKAKIIAGTLKVPSAL
Ga0070741_1079955613300005529Surface SoilKQGKWNGGHDLVFDLKNGGMGLGKINPAVPKADIALMNQYKAKIIAGKLKVPTTLAP*
Ga0070664_10088305213300005564Corn RhizosphereGVKRVDNGVYQAIQKTQAKKGFKGGGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS*
Ga0066703_1086474323300005568SoilDLLFNLKNGGMSVGKINPAVPKAFIDEMNMYKQQIINGTLKVPSAL*
Ga0066702_1053492623300005575SoilSAAAGQFKGGTDLVFNLKNHGVGVGRISPVVPASWIKLMNSYRTKIVAGTLKVPTGL*
Ga0066702_1084711023300005575SoilGQFKGGTDLVFNLKNHGVGVGKINPVVPASWIKLMNQYRSKIVAGTLKVPSALG*
Ga0068859_10164666523300005617Switchgrass RhizosphereQFTLKNGGMGIGKINPTVPKKFITAMNKIKAKIILGKLKIPTKLS*
Ga0066903_10009585853300005764Tropical Forest SoilVQDGKWNGGHDLVFNLENGGMGLGRINPAVPPSDIRLMSRYKAEIIAGKLKVPSTL*
Ga0068870_1074265623300005840Miscanthus RhizosphereFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS*
Ga0075269_1003136813300005905Rice Paddy SoilSGHFKGGQNLVFDLKNQGMGIGKINPAVPKSWITLMNNYKAQIISGKLKVPTTLG*
Ga0070716_10104385413300006173Corn, Switchgrass And Miscanthus RhizosphereGVGVGKISPKVPKSWITLMKSYKTKIIKGKLKPPAVLH*
Ga0075021_1048146123300006354WatershedsGIFQAVQQAATGKFLGGSDLLFNLKNGGMSVGKINPSVPPAYITLMNSYKAKIIAGTLKVPTAL*
Ga0074047_1188762023300006576SoilGGKNVLYNLANGGMSVGKINPTVPKLFIKRMNNLKKLIIKHKVKPPKTL*
Ga0074060_1163267613300006604SoilGGGNLLFNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKHKLKVPAKL*
Ga0066653_1019359513300006791SoilKGGSDLNFNLKNDGMSVGKINPAVPQKFIDEMNDYKKQIIRGRLKVPSAL*
Ga0066659_1133250023300006797SoilYDAIQQAAAGQFKGGTDLLFNLKNNGMGVGRINPSVPAAWVTLMNNYKKRIIAGTFKVPSALK*
Ga0075425_10010885213300006854Populus RhizosphereGFKGGGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS*
Ga0068865_10193361723300006881Miscanthus RhizosphereGGNLLFNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKHKLKVPAKL*
Ga0099829_1065809813300009038Vadose Zone SoilKFAGGTNLLFNLKNNGMSVGRINPSVPKAFVATMNKYKAQIIAGTLKVPSAL*
Ga0105241_1224276923300009174Corn RhizosphereMSDWEDIEAIKQVKAGQFNGGHDLLFNLKNGGMGVGKINPSVPKSDIALMNSYKAKIIAGTLKLPSSLG*
Ga0126313_1142459413300009840Serpentine SoilGVYQAINKAKNGGFKRGGNLLFNLKNKGMGVGKMNPAVPKAYIKLMNTYKTRIIKKQLKVPSKL*
Ga0126305_1105971313300010036Serpentine SoilNLLFNLKNKGMGVGKMNPAVPKAYIKLMNTYKTRIIKKQLKVPTKL*
Ga0126312_1014062413300010041Serpentine SoilGGFKRGGNLLFNLKNKGMGVGKMNPAVPKAYITLMNTYKTKIIKKQLKVPTKL*
Ga0134070_1042549313300010301Grasslands SoilDVGVYSAAKQVKVGKFNGGADLNFTLKNGGMGVGKINPAVPKSDIALMNSYKAKIIAGTLKVPAALS*
Ga0134080_1009975813300010333Grasslands SoilDLGIIKIAQAVKLGKFKANTDLVFTLKNGGMSVGRINPAVPKAYIKIMNAYKARIIAGKLKVPTTLS*
Ga0134066_1015984623300010364Grasslands SoilVYQAVAQVKAGHFKGGTNLLFNLKNGGMSVGKINPSVPKKFITAMNKIKVKIIKKKLKVPAKL*
Ga0136449_10138162213300010379Peatlands SoilQFKGGQDLVFNLKNHGVGVGKISPDVPASWINLMNQYRARIVAGTLKVPTALP*
Ga0134122_1149024613300010400Terrestrial SoilNLLFNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKHKLKVPAKL*
Ga0138505_10001006923300010999SoilFKRGGNLLFNLKNKGMGVGKVHPAVPKAYITLMNSYKTKIINKKLKVPTKL*
Ga0137388_1119395533300012189Vadose Zone SoilFQAAQQEQQGRFAGATDLLFNLKNGGMSVGRINPSVPASFVKLMNTYKAQIIAGSLQVPTAL*
Ga0137381_1135099623300012207Vadose Zone SoilFKGGADLNFNLKNDGKGIGKINPTVPKAYIALMNSYKKRIIAGTLKVPAALK*
Ga0137378_1122491213300012210Vadose Zone SoilKFAGGSDLVFNLKNGGMSVGRINPSVPAAYVKLMKSYKARIIAGTLKVPAAL*
Ga0150984_11318978823300012469Avena Fatua RhizosphereAGQFKGGHDLVFNLKNGGMGVGKINPAVPASDIQLMNSYRSKIIAGTLKIPTSIS*
Ga0157316_103853723300012510Arabidopsis RhizosphereGVYQAIQKTQAKKGFKGGGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS*
Ga0157332_100581923300012511SoilMSVGKINPAVPKKFITAMNKIKTRIIKGKLKVPTKLT*
Ga0126375_1134631023300012948Tropical Forest SoilLLFNLKNNGMSVGKINPAVPKAYIDEMNKYKQEIIAGTLHVPSAL*
Ga0126369_1164456523300012971Tropical Forest SoilVGKINPAVPKAYITLMNTYKTNIIKKKLHVPTKLS*
Ga0134110_1055968413300012975Grasslands SoilKFKANTDLVFTLKNGGMSVGKINPAVPKAYIKIMNAYKARIIAGKLKVPTTLS*
Ga0134076_1051290923300012976Grasslands SoilAGQFKGGQDLVFNLKNHGMGVGKISPVVPASWIKLMNQYRANIIAGTLKVPASLG*
Ga0164309_1074147523300012984SoilGVFSVAQQELQGKFRGGTDLNFNLKNGGMGIGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS*
Ga0164304_1023247923300012986SoilLLFNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKHKLKVPAKL*
Ga0164306_1161236823300012988SoilKGKFKGGKNLKFNLKNNGIGVGKISPTVPKSWITLMNTYKTKIIKKKLKLPADLP*
Ga0157378_1159098423300013297Miscanthus RhizosphereLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKKKLKVPAKL*
Ga0157375_1033202013300013308Miscanthus RhizosphereQAVDKAKNGGFKGGGNLLFNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKHKLKVPAKL*
Ga0157375_1036811533300013308Miscanthus RhizosphereVDNGVFQAVDKAKNGGFKGGGNLLFNLKNGGMSVGKINPTVPKAYIKLMNAYKTKIIKKKLKVPTKL*
Ga0120109_105957413300014052PermafrostMHLPVNPPVAPMLAKAVKDGTFKGNTDLLFTLANGGMSVGKINPSVPKSDIATMNKYKADIISGKLVVPATL*
Ga0182021_1234527013300014502FenKFQGGSDLVFDLKNGGMGVGKINPSVPASWVALMNSYKAKIIAGTFKVPTAIG*
Ga0157377_1121564013300014745Miscanthus RhizosphereKNGGFKGGGNLLFNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKKKLKVPAKL*
Ga0167642_104484723300015160Glacier Forefield SoilNGGIGVGKISPTVPKSWIRLMNSYKTKIIKGKLKLPADLP*
Ga0134085_1033068813300015359Grasslands SoilAVKQVKDNKFKSGDLLFNLKNKGMDVGKINPSVPKAFINLMNSYKTRIINGSLKVPTGL*
Ga0132256_10025216513300015372Arabidopsis RhizosphereAKKGFKGGGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS*
Ga0132256_10034154233300015372Arabidopsis RhizosphereLKNGGMSVGKINPAVPKAYIKLMNSYKTKIIKKKLKVPTKL*
Ga0132257_10375678023300015373Arabidopsis RhizosphereATQEKAGKFKGGTDVNFNLKNGGIGLGKISPAVPKASIAKANQYKALIIAGKLEVPTSL*
Ga0132255_10122371813300015374Arabidopsis RhizosphereNGGMSVGKINPTVPKAYIKLMNTYKTNIIKKKLKVPAKL*
Ga0132255_10588029313300015374Arabidopsis RhizosphereIEKAKNGGFKRGGNLLFNLKNKGMGVGKINPAVPKAYIKLMNQYKARIIAKKLKVPTKL*
Ga0134074_120372723300017657Grasslands SoilQFTLANHGMSVGKINPAVPKKFITAMNKIKTRIIKGKLKVPTKLT
Ga0187766_1119320423300018058Tropical PeatlandAGKFKGGQDLVFDLKNGGMGVGKISPDVPASWIKLMNQYRARIVAGTLKVPTALP
Ga0187773_1011147823300018064Tropical PeatlandFQAAAQEQQGKFAAGSDLVFNLKNGGMDVGKINPSVPKSWIALMNSYKAKIIAGTLKVPAAL
Ga0184618_1028426923300018071Groundwater SedimentFKGGSDLLFNLKNKGMGVGRINPAVPASFKALMNSYKAKIIKGTLKVPAAL
Ga0184609_1050951323300018076Groundwater SedimentGNLLFNLKNGGMSVGKINPAVPKKFITAMNAVKVKIIKHKLKVPTKL
Ga0066669_1122237313300018482Grasslands SoilNGWFKCGGKLPFNLKNGGMSVGTLTPTVPKAYIKRMNSYKTKIIKKQLKVPAKL
Ga0173481_1042303823300019356SoilGNLLFNLKNKGMGVGKINPAVPKAYVTLMNSYKTKIIKKKLKVPTKLS
Ga0173482_1056988413300019361SoilKNGGMSVGKINPSVPKAYITLMNTYKTNIIKGKLHVPAKIK
Ga0193705_100754113300019869SoilGVYQAVQKVQNGKFVGGGNLLFNLKNGGMSVGKINPAVPKRFITGMNAVKAKIIKKQLKVPTKL
Ga0193705_100823633300019869SoilNGGNLLFNLKNGGMSVGKINPAVPKKFITAMNAVKVKIIKHKLKVPTKL
Ga0193730_110454313300020002SoilGVKRVDNGVFQAIDKAKNGGFKGGGNLLFNLKNGGMSVGKINPSVPKAYIKLMNTYKTNIIKHKLKVPAKL
Ga0193730_118876013300020002SoilNLLFNLKNGGMSVGKINPAVPKKFITAMNAVKVKIIKHKLKVPTKL
Ga0193699_1022506613300021363SoilNGGMSVGKINPTVPKAYIKLMNTYKTNIIKHKLKVPAKL
Ga0222622_1083107113300022756Groundwater SedimentKNGGMSVGKINPTVPKAYITLMNSYKTKIIKHKLKVPAKL
Ga0247672_101082713300024187SoilQAIQKTQAKKGFKGGGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS
Ga0247668_100909913300024331SoilGGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLKVPAKL
Ga0207692_1017159013300025898Corn, Switchgrass And Miscanthus RhizosphereGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS
Ga0207643_1024879313300025908Miscanthus RhizosphereFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS
Ga0207693_1063068713300025915Corn, Switchgrass And Miscanthus RhizosphereAKKGFKGGGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS
Ga0207663_1025522323300025916Corn, Switchgrass And Miscanthus RhizosphereKGFKGGGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS
Ga0207660_1004088013300025917Corn RhizosphereGVFQAIDKAKNGGFKPGGNLLFNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKKKLKVPAKL
Ga0207646_1152039123300025922Corn, Switchgrass And Miscanthus RhizosphereHDLQFTLKNGGMSVGKINPSVPKRFITAMNKIKTRIIKGKLKVPIKLT
Ga0207694_1113539713300025924Corn RhizosphereLLFNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKHKLKVPAKL
Ga0207700_1042667823300025928Corn, Switchgrass And Miscanthus RhizosphereNGVGVGKISPKVPKSWITLMQSYKTKIIKGKLKPPTVVH
Ga0207679_1183992623300025945Corn RhizosphereGKFQGGSDLKLNLKNNGVGVGKIHPSVPASWIKLMNSYRAKIIAGTLKPPASLGK
Ga0207640_1176263913300025981Corn RhizosphereKGGSDLNFDLKNDGMSVGKINPAVPQDFIDEMNDYKKQIIRGRLKVPSAL
Ga0207658_1002493013300025986Switchgrass RhizosphereGVCQAIAQEKAGKFAGGSDLVFNLKNGGMGVGKISPSVPKAFVTLMNGYKAKIIAGTLKVPASL
Ga0207703_1091362713300026035Switchgrass RhizosphereQAIAQEKAGKFAGGSDLVFNLKNGGMGVGKISPSVPKAFVTLMNGYKAKIIAGTLKVPAS
Ga0207702_1082703523300026078Corn RhizosphereFQGGSDLLFNLKNNGMSVGKINPAVPKAYIDEMNKYKQQIISGQLKVPAAL
Ga0207702_1169667023300026078Corn RhizosphereELAGKFKGGTDLNFNLKNGGIGIGKINPSVPKAFITLMNSYKAKIIAGKLKVPTAL
Ga0209068_1079815413300027894WatershedsQNAVTGHWKGGKDLLFNLKNNGVGVGKISPAVQKAWITLMNSYKAKIIAGTLKPPAACSGGC
Ga0247684_101155413300028138SoilSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS
Ga0247663_100855713300028145SoilGGNLLFNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKKKLHVPTKLS
Ga0307322_1010985513300028710SoilGNLLFNLKNGGMSVGKINPAVPKRFITGMNAVKAKIIKKQLKVPTKL
Ga0307309_1011829413300028714SoilVKRVDNGVFQAIQKAKTGHFKNGGNLLFNLKNGGMSVGKINPTVPKSYIKLMNTYKTNIIKKKLKVPAKL
Ga0307311_1028005323300028716SoilLLFNLKNGGMSVGKINPAVPKRFITGMNAVKAKIIKKQLKVPTKL
Ga0307316_1007288013300028755SoilEKAGKFKAGGDLLFNLKNGGMSVGKINPSVPKAYIKLMNTYKARIIAGKLKVPAAL
Ga0307316_1012044813300028755SoilVDNGVFQAIDKAKNGGFKGGGNLLFNLKNGGMSVGKINPTVPKSYIKLMNTYKTNIIKKKLKVPAKL
Ga0307280_1002989333300028768SoilMSVGKINPTVPKAYIKLMNTYKTNIIKKKLKVPAKL
Ga0307287_1042282913300028796SoilNGKFLAGGNLLFNLKNGGMSVGKINPAVPKRFITGMNAVKAKIIKKQLKVPTKL
Ga0265338_1014880523300028800RhizosphereVDTGVYDAIQQAQAGQFKGGQDLVFDLKNHGMGIGKINPVVPASWLKLMNSYRARIIAGTLKVPTGL
Ga0307296_1047657213300028819SoilSDLLFNLKNNGMSVGKINPAVPKAFITEMNGYKQKIIAGTLKVPTAL
Ga0307310_1004349113300028824SoilRVDNGVFQAIDKAKNGGFKGGGNLLFNLKNGGMSVGKINPTVPKSYIKLMNTYKTNIIKKKLKVPAKL
Ga0307499_1010149513300031184SoilNLKNGGMSVGKINPTVPKAYIKLMNTYKTNIIKHKLKVPAKL
Ga0170824_11186386423300031231Forest SoilFKGGTDLNFNLKNGGMGLGKISPTVPAGDIALMNSYKKRIIAGTLKVPTAIS
Ga0265316_1002864553300031344RhizosphereDTGVYDAIQQAQAGQFKGGQDLVFDLKNHGMGIGRINPVVPASWIKLMNQYRARIIAGTLKVPTGL
Ga0265314_1016276613300031711RhizosphereIQQAEAGQFKGGQDLVFDLKNHGMGIGKINPVVPASWLKLMNSYRARIIAGTLKVPTGL
Ga0307468_10124311123300031740Hardwood Forest SoilLLFNLKNKGMGVGKINPAVPKAYIKLMNQYKTKIINKKLKVPTKL
Ga0307475_1019071923300031754Hardwood Forest SoilGQDLVFDLKNHGMGVGKISPVVPASWIKLMNSYRSQIVAGTLKVPTALG
Ga0310904_1115896013300031854SoilKAKNGGFKRGGNLLFNLKNGGMGVGKINPAVPKAYIKLMNQYKTKIINKKLKVPTKL
Ga0310893_1026403613300031892SoilLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS
Ga0310900_1141889913300031908SoilSGVKRVDNGVYQAIQKTQAKKGFKGGGNLLFNLKNGGMSVGKINPSVPKAYITLMNTYKTNIIKKKLHVPTKLS
Ga0307416_10080404323300032002RhizosphereQAINKAKNGGFKRGGNLLFNLKNKGMGVGKMNPAVPKAYITLMNTYKTRIIRKQLKVPTK
Ga0311301_1102153013300032160Peatlands SoilQFKGGQDLVFNLKNHGVGVGKISPDVPASWINLMNQYRARIVAGTLKVPTALP
Ga0315271_1002056313300032256SedimentVGGADLLFNLKNGGMSVGKINPAVSKAAIATMNKYKARIIAGTLKVPTGL
Ga0335080_1114807913300032828SoilQAGQFQGGSDLLFNLKNHGVGVGKISPNVPASWIKLMNQYRARIVAGTLKVPSSLG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.