Metagenome Family F073909

Basic Information
Family ID	F073909
Family Type	Metagenome
Number of Sequences	120
Average Sequence Length	37 residues
Representative Sequence	MGTTLHTFSERVQLTLAIALLVACAANVALVWAFL
Number of Associated Samples	97
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	49.17 %
% of genes near scaffold ends (potentially truncated)	11.67 %
% of genes from short scaffolds (< 2000 bps)	75.83 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Most Common Taxonomy
Group	Bacteria (94.167 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.000 % of family members)
Environment Ontology (ENVO)	Unclassified (24.167 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (50.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF13505	OMP_b-brl	16.67
PF00561	Abhydrolase_1	5.83
PF12697	Abhydrolase_6	1.67
PF12146	Hydrolase_4	1.67
PF07883	Cupin_2	0.83
PF01075	Glyco_transf_9	0.83
PF13424	TPR_12	0.83
PF13450	NAD_binding_8	0.83
PF01636	APH	0.83
PF00144	Beta-lactamase	0.83
PF00528	BPD_transp_1	0.83
PF01627	Hpt	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG0859	ADP-heptose:LPS heptosyltransferase	Cell wall/membrane/envelope biogenesis [M]	0.83
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.83
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.83
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	94.17 %
Unclassified	root	N/A	5.83 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	94.17 %
Unclassified	root	N/A	5.83 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	94.17 %
Unclassified	root	N/A	5.83 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	92.50 %
Unclassified	root	N/A	5.83 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	90.83 %
Unclassified	root	N/A	5.83 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	87.50 %
Unclassified	root	N/A	5.83 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	87.50 %
Unclassified	root	N/A	5.83 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	80.83 %
Unclassified	root	N/A	5.83 %

Name	Rank	Taxonomy	Distribution
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	14.17 %
Unclassified	root	N/A	5.83 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1.67 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.83 %
Bradyrhizobium canariense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense	0.83 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobium sp. Tv2a-2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	8.33 %
Unclassified	root	N/A	5.83 %
Bradyrhizobium sp. ARR65	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	3.33 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	1.67 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1.67 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.83 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.83 %
Bradyrhizobium canariense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459017\|G14TP7Y02GJ029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	591	Open in IMG/M
3300001867\|JGI12627J18819_10001990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	7329	Open in IMG/M
3300005332\|Ga0066388_101410527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1211	Open in IMG/M
3300005332\|Ga0066388_104166796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	737	Open in IMG/M
3300005434\|Ga0070709_10025520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3493	Open in IMG/M
3300005529\|Ga0070741_10000314	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	184158	Open in IMG/M
3300005531\|Ga0070738_10001234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	55024	Open in IMG/M
3300005532\|Ga0070739_10420135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	617	Open in IMG/M
3300005533\|Ga0070734_10015881	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	5169	Open in IMG/M
3300005534\|Ga0070735_10176356	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1316	Open in IMG/M
3300005598\|Ga0066706_10073356	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2403	Open in IMG/M
3300005764\|Ga0066903_100713932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	1771	Open in IMG/M
3300005944\|Ga0066788_10061261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	897	Open in IMG/M
3300005995\|Ga0066790_10047045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	1869	Open in IMG/M
3300006050\|Ga0075028_100017867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3079	Open in IMG/M
3300006173\|Ga0070716_101057482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	645	Open in IMG/M
3300006804\|Ga0079221_10142807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1241	Open in IMG/M
3300006852\|Ga0075433_11525122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	577	Open in IMG/M
3300007265\|Ga0099794_10569729	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	598	Open in IMG/M
3300009038\|Ga0099829_10975739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	703	Open in IMG/M
3300009090\|Ga0099827_10033749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3720	Open in IMG/M
3300009137\|Ga0066709_100464650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1773	Open in IMG/M
3300009792\|Ga0126374_10034320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	2417	Open in IMG/M
3300009792\|Ga0126374_10719961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	753	Open in IMG/M
3300009826\|Ga0123355_11164332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	792	Open in IMG/M
3300010043\|Ga0126380_11279901	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300010043\|Ga0126380_11534788	Not Available	591	Open in IMG/M
3300010048\|Ga0126373_10764233	Not Available	1027	Open in IMG/M
3300010049\|Ga0123356_10267182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1798	Open in IMG/M
3300010049\|Ga0123356_13391111	Not Available	553	Open in IMG/M
3300010049\|Ga0123356_13477771	Not Available	546	Open in IMG/M
3300010159\|Ga0099796_10528527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	529	Open in IMG/M
3300010361\|Ga0126378_13404291	Not Available	505	Open in IMG/M
3300010362\|Ga0126377_10760554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1025	Open in IMG/M
3300010376\|Ga0126381_101665459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	922	Open in IMG/M
3300010376\|Ga0126381_102895175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	683	Open in IMG/M
3300010376\|Ga0126381_103206196	Not Available	647	Open in IMG/M
3300010376\|Ga0126381_103730239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	596	Open in IMG/M
3300010376\|Ga0126381_104930435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	512	Open in IMG/M
3300011269\|Ga0137392_10432885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1092	Open in IMG/M
3300011418\|Ga0153954_1006495	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3858	Open in IMG/M
3300012096\|Ga0137389_10251213	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1486	Open in IMG/M
3300012199\|Ga0137383_10005810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	7972	Open in IMG/M
3300012202\|Ga0137363_10259375	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1415	Open in IMG/M
3300012203\|Ga0137399_10192987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1650	Open in IMG/M
3300012357\|Ga0137384_10597670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	901	Open in IMG/M
3300012359\|Ga0137385_10738480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	820	Open in IMG/M
3300012685\|Ga0137397_10205256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1466	Open in IMG/M
3300012929\|Ga0137404_10423156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1178	Open in IMG/M
3300012930\|Ga0137407_10182998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1871	Open in IMG/M
3300012930\|Ga0137407_11067403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	765	Open in IMG/M
3300012930\|Ga0137407_11510528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	639	Open in IMG/M
3300012944\|Ga0137410_10021069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4488	Open in IMG/M
3300012971\|Ga0126369_10608895	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1163	Open in IMG/M
3300016341\|Ga0182035_10537969	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1002	Open in IMG/M
3300016341\|Ga0182035_10742419	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	858	Open in IMG/M
3300017947\|Ga0187785_10161236	All Organisms → cellular organisms → Bacteria → Proteobacteria	950	Open in IMG/M
3300017973\|Ga0187780_11463620	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	504	Open in IMG/M
3300018062\|Ga0187784_10406544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1101	Open in IMG/M
3300018085\|Ga0187772_10014630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4371	Open in IMG/M
3300019789\|Ga0137408_1183142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	812	Open in IMG/M
3300020170\|Ga0179594_10000840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6743	Open in IMG/M
3300020170\|Ga0179594_10113925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	981	Open in IMG/M
3300020199\|Ga0179592_10033153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2331	Open in IMG/M
3300020579\|Ga0210407_10003148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	13593	Open in IMG/M
3300020580\|Ga0210403_10605591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense	884	Open in IMG/M
3300021086\|Ga0179596_10049420	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1736	Open in IMG/M
3300021086\|Ga0179596_10231237	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	908	Open in IMG/M
3300021086\|Ga0179596_10358439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	733	Open in IMG/M
3300021168\|Ga0210406_11337264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	514	Open in IMG/M
3300021361\|Ga0213872_10367114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	588	Open in IMG/M
3300021444\|Ga0213878_10242196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	765	Open in IMG/M
3300021475\|Ga0210392_10249952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1256	Open in IMG/M
3300021560\|Ga0126371_10002917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	14883	Open in IMG/M
3300021560\|Ga0126371_10183597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2178	Open in IMG/M
3300025910\|Ga0207684_10108060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2381	Open in IMG/M
3300026215\|Ga0209849_1028965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	951	Open in IMG/M
3300026548\|Ga0209161_10190395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1146	Open in IMG/M
3300027502\|Ga0209622_1068016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65	650	Open in IMG/M
3300027548\|Ga0209523_1031357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1066	Open in IMG/M
3300027725\|Ga0209178_1420822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	510	Open in IMG/M
3300027812\|Ga0209656_10496403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	534	Open in IMG/M
3300027826\|Ga0209060_10016603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3986	Open in IMG/M
3300027826\|Ga0209060_10028438	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	2836	Open in IMG/M
3300027826\|Ga0209060_10136581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1140	Open in IMG/M
3300027869\|Ga0209579_10195141	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	1084	Open in IMG/M
3300027894\|Ga0209068_10093340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1580	Open in IMG/M
3300027965\|Ga0209062_1007677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	9207	Open in IMG/M
3300031247\|Ga0265340_10053218	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1955	Open in IMG/M
3300031543\|Ga0318516_10378640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	816	Open in IMG/M
3300031544\|Ga0318534_10312897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	905	Open in IMG/M
3300031715\|Ga0307476_10004341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	8540	Open in IMG/M
3300031719\|Ga0306917_10623605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	848	Open in IMG/M
3300031753\|Ga0307477_10394529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	948	Open in IMG/M
3300031765\|Ga0318554_10378368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	804	Open in IMG/M
3300031781\|Ga0318547_10487456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	761	Open in IMG/M
3300031879\|Ga0306919_10084937	All Organisms → cellular organisms → Bacteria	2191	Open in IMG/M
3300031890\|Ga0306925_10241283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	1948	Open in IMG/M
3300031910\|Ga0306923_12136427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	564	Open in IMG/M
3300031910\|Ga0306923_12439411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	517	Open in IMG/M
3300031912\|Ga0306921_10094468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3458	Open in IMG/M
3300031912\|Ga0306921_10315635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1829	Open in IMG/M
3300031945\|Ga0310913_10028797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3522	Open in IMG/M
3300031946\|Ga0310910_10518960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	946	Open in IMG/M
3300031954\|Ga0306926_10479956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1530	Open in IMG/M
3300031954\|Ga0306926_11814419	All Organisms → cellular organisms → Bacteria → Proteobacteria	692	Open in IMG/M
3300031962\|Ga0307479_11005255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	803	Open in IMG/M
3300031981\|Ga0318531_10194048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	915	Open in IMG/M
3300032008\|Ga0318562_10875267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	513	Open in IMG/M
3300032039\|Ga0318559_10106643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	1245	Open in IMG/M
3300032042\|Ga0318545_10392812	Not Available	501	Open in IMG/M
3300032174\|Ga0307470_10163424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1379	Open in IMG/M
3300032770\|Ga0335085_10010556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	13790	Open in IMG/M
3300032829\|Ga0335070_10562911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	1075	Open in IMG/M
3300032829\|Ga0335070_11871404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	542	Open in IMG/M
3300032892\|Ga0335081_10310379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2083	Open in IMG/M
3300032897\|Ga0335071_10954260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	805	Open in IMG/M
3300032897\|Ga0335071_11576368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	601	Open in IMG/M
3300032954\|Ga0335083_11042227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	642	Open in IMG/M
3300033983\|Ga0371488_0066112	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2141	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.50%
Host-Associated	Host-Associated	6.67%
Engineered	Engineered	0.83%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	90.00%
Arthropoda	Host-Associated → Arthropoda	3.33%
Aquatic	Environmental → Aquatic	2.50%
Plants	Host-Associated → Plants	2.50%
Fungi	Host-Associated → Fungi	0.83%
Solid Waste	Engineered → Solid Waste	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	89.17%
Digestive System	Host-Associated → Arthropoda → Digestive System	3.33%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.50%
Sediment	Environmental → Aquatic → Sediment	1.67%
Freshwater	Environmental → Aquatic → Freshwater	0.83%
Peat	Environmental → Terrestrial → Peat	0.83%
Mycelium	Host-Associated → Fungi → Mycelium	0.83%
Grass	Engineered → Solid Waste → Grass	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	70.00%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	11.67%
Loam	Environmental → Terrestrial → Soil → Loam	7.50%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	3.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.67%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.83%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.83%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.83%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.83%
Composting	Engineered → Solid Waste → Grass → Composting	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	41.67%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	24.17%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	9.17%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.00%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	3.33%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.50%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.67%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.67%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.83%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.83%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.83%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.83%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	20.00%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	12.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	9.17%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	8.33%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	5.83%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.33%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	3.33%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	3.33%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	2.50%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.50%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.50%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.67%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.83%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.83%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.83%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.83%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.83%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.83%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.83%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.83%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459017	Litter degradation ZMR4	Engineered	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental	Open in IMG/M
3300005532	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005944	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048	Environmental	Open in IMG/M
3300005995	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Host-Associated	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011418	Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG	Host-Associated	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018085	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Host-Associated	Open in IMG/M
3300021444	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026215	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300027502	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027548	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental	Open in IMG/M
3300027812	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027965	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Host-Associated	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300031981	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25	Environmental	Open in IMG/M
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032042	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M
3300033983	Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F073909

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
4ZMR_05443660	2170459017	Switchgrass, Maize And Mischanthus Litter	MFPAMGTTLHTFSERVLLTLAIGLLVACAANVALVWAFL
JGI12627J18819_1000199010	3300001867	Forest Soil	MGTMLHTFCERAQLTLAVGLLAACAANVALVWVFL*
Ga0066388_1014105272	3300005332	Tropical Forest Soil	MLRPMGTMLHTSCEGMHLKLALGLLMACAANVVLVCAFL*
Ga0066388_1041667962	3300005332	Tropical Forest Soil	MFPAMGTGVHTFSERTQLTLAVGLFVACMANVALVWAFL*
Ga0070709_100255203	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MVLTMGTGLHTFCERTQLTLAIGLFVACAANVALVLAFL*
Ga0070741_1000031470	3300005529	Surface Soil	MGTWLHTFCERAQLTLAVGLLAACAANVALVWAFL*
Ga0070738_100012344	3300005531	Surface Soil	MGTRLHTFCERVQLTLAVGLLVACAANVALVWVFL*
Ga0070739_104201352	3300005532	Surface Soil	MVPAMGTILHTFCGRVQLTLAVGLLAACAANVALVWAFL*
Ga0070734_100158816	3300005533	Surface Soil	MGTMLHTFCERVQLNLAIGLLMACAANVALVWAFL*
Ga0070735_101763562	3300005534	Surface Soil	MVWAMGTTLQTASERMQLGLTIALLGACAANVALVWAFL*
Ga0066706_100733565	3300005598	Soil	MGSTLHTFCERIQLTLAIGLLVACTANVALVWAFL*
Ga0066903_1007139322	3300005764	Tropical Forest Soil	METTPYTFCERVQLTLAVGLFAACAANVALVFAFL*
Ga0066788_100612613	3300005944	Soil	MFPAMGSTLHTFSERVQLTLAVALLAACAANVALVWTFL*
Ga0066790_100470451	3300005995	Soil	MGSTLHTFSERVQLTLAVALLAACAANVALVWTFL*
Ga0075028_1000178674	3300006050	Watersheds	MGTTPHTASDRVQLSLTVALLAACAANVALVFAWL*
Ga0070716_1010574821	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MFPGMGTGLRTLSERTLLTLAVGLFIACVANVALVWAFL*
Ga0079221_101428073	3300006804	Agricultural Soil	MGTTLHTFGERVQLTLAVGLLAACAANLALVWAFF*
Ga0075433_115251221	3300006852	Populus Rhizosphere	MGTMLHTARERVELTLAIALLIACAANVALVCAFL*
Ga0099794_105697292	3300007265	Vadose Zone Soil	MFPAMGTTLHTFSERGIQLTLAIGLLVACAANVALVWAFP*
Ga0099829_109757391	3300009038	Vadose Zone Soil	MFPAMGTTLHTFSERVQLTLAIGLLVACAANVALVWAFL*
Ga0099827_100337495	3300009090	Vadose Zone Soil	MFPAMGTTLHTFSERGVQLTLAIGLLVACAANVALVWAFL*
Ga0066709_1004646504	3300009137	Grasslands Soil	MFPAMGSTLHTFCERIQLTLAIGLLVACAANVALVWDFL*
Ga0126374_100343203	3300009792	Tropical Forest Soil	MFPGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI*
Ga0126374_107199612	3300009792	Tropical Forest Soil	MLPAMETTLHTFCERVQLNLAIGLLIACAANVALVWSFL*
Ga0123355_111643322	3300009826	Termite Gut	MDTTPHTFCDRVQLSLAVGLFAACAANVVLVLVFL*
Ga0126380_112799011	3300010043	Tropical Forest Soil	MGTGLRTFSERTQLSLAIGLFVACAANIALVLTFL*
Ga0126380_115347882	3300010043	Tropical Forest Soil	MDTTPHTFCDRVQLTLAVGLFAACAANVVLVLVFL*
Ga0126373_107642333	3300010048	Tropical Forest Soil	MFLLMEAMSRTFCERVQLTLAAGLFAACAANVALVWAFLF*
Ga0123356_102671823	3300010049	Termite Gut	MDTTPHTFCNRVQLSLAVGLFAACAANVVLVLVFL*
Ga0123356_133911112	3300010049	Termite Gut	PMDTTPHTFCDRVQLTLAVGLFAACAANVVLVLVFL*
Ga0123356_134777711	3300010049	Termite Gut	MVLPMDTTRPTFCDRVQLTLAVGLFAACAANVVLVFVFL*
Ga0099796_105285272	3300010159	Vadose Zone Soil	MFPAMGTTLHTFSERGIQLTLAIGLLVACAANVALVWAFL*
Ga0126378_134042911	3300010361	Tropical Forest Soil	MFPAMGTSLHTFCERVQFHLAIGLFVACAANVALVWSFL*
Ga0126377_107605542	3300010362	Tropical Forest Soil	MGTTLHTASERVELTLAIGLLIACAANVALVCAFL*
Ga0126381_1016654592	3300010376	Tropical Forest Soil	METTSRTFCERVQLTLAAGLFAACAANVALVWAFLF*
Ga0126381_1028951752	3300010376	Tropical Forest Soil	MFLPMETMSRTFSECVQLTLAAGLFAACAANVALVWAFLF*
Ga0126381_1032061963	3300010376	Tropical Forest Soil	METTPYIFCERVQLTLAVGLFAACAANVALVFAFL*
Ga0126381_1037302391	3300010376	Tropical Forest Soil	METMLHTFCERVQLPLAVGLFAACAANVALVWAFL*
Ga0126381_1049304351	3300010376	Tropical Forest Soil	MLPAMGTTLQTFCERVQLNLAIGLLMACTANVALVWAF
Ga0137392_104328852	3300011269	Vadose Zone Soil	MGTTLHTFSERVQLTLAIALLVACAANVALVWAFL*
Ga0153954_10064952	3300011418	Attine Ant Fungus Gardens	METMNEIASERMHLRLTVGLLLACVANVALVCAFL*
Ga0137389_102512132	3300012096	Vadose Zone Soil	MFPAMGTTLHAFSERVQLTLAIGLLVACAANVALVWAFL*
Ga0137383_1000581010	3300012199	Vadose Zone Soil	MFPAMGSTLHTFCERIQLTLAIGLLVACTANVALVWAFL*
Ga0137363_102593753	3300012202	Vadose Zone Soil	MFPAMGTTLHTFSERGVRLTLAIGLLVACAANVALVWAFL*
Ga0137399_101929871	3300012203	Vadose Zone Soil	MGTTLHTFSERGVQLTLAIGLLVACAANVALVWAFL*
Ga0137384_105976702	3300012357	Vadose Zone Soil	MFPAMGSTLHTFSGRVQVTLAVALLVACAANVALVWAFL*
Ga0137385_107384801	3300012359	Vadose Zone Soil	MGTTLHTFSERIQLTLAIALLVACAANVALVWAFL*
Ga0137397_102052563	3300012685	Vadose Zone Soil	MFPSMGSTLHTFSERVQLTLAIALLVACAANVALVWAFL*
Ga0137404_104231561	3300012929	Vadose Zone Soil	MFSAMGTSLHTFSGRVQLTLAIGLLVACAANVALV
Ga0137407_101829984	3300012930	Vadose Zone Soil	MFPSMGSTLHTFSERVRLTLAIALLVACAANVALVWAFL*
Ga0137407_110674031	3300012930	Vadose Zone Soil	MFSAMGTSLHTFSGRVQLTLAIGLLVACAANVALVCAFL*
Ga0137407_115105282	3300012930	Vadose Zone Soil	MGTTLHTFSERVQLTLAIALLVACAANVTLVWAFL*
Ga0137410_100210697	3300012944	Vadose Zone Soil	MFPAMGTTLHTFSEHGVQLTLAIGLLVACAANVALVWAFL*
Ga0126369_106088952	3300012971	Tropical Forest Soil	MGTSLHTFCQRVQLNLAIGLLMACAANVALVWSFL*
Ga0182035_105379691	3300016341	Soil	RMFPGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI
Ga0182035_107424191	3300016341	Soil	MGTSLHTFCQRLQLNLAIGLLMACAANVALVWSFL
Ga0187785_101612362	3300017947	Tropical Peatland	MGTSLHTFCERVQFHLAIGLFVACAANVALVWSFLS
Ga0187780_114636202	3300017973	Tropical Peatland	RRMVPPMGSMLHTFCERVQLTLAVGLLAACAANVALVWAFL
Ga0187784_104065442	3300018062	Tropical Peatland	MGTSLHSFCERVQLNLAIGLLMACAANVALVWAFL
Ga0187772_100146305	3300018085	Tropical Peatland	MGTGLHTFSERVQLNLAIGLLMACAANVALVWAFL
Ga0137408_11831423	3300019789	Vadose Zone Soil	MFPSMGSTLHTFSERVQLTLAIALLVACAANVALVWAFL
Ga0179594_100008402	3300020170	Vadose Zone Soil	MGTTLHTFSERGVQLTLAIGLLVACAANVALVWAFL
Ga0179594_101139251	3300020170	Vadose Zone Soil	MFPAMGSTLHTFCERIQLTLAIGLLVACAANVALVWAFL
Ga0179592_100331534	3300020199	Vadose Zone Soil	MGSTLHTFSERVQLTLAIALLVACAANVALVWAFL
Ga0210407_100031485	3300020579	Soil	MGTGLRTLSERTLLTLAVGLFIACVANVALVWAFL
Ga0210403_106055912	3300020580	Soil	MFPGMGTGLRTLSERTLLTLAVGLFIACVANVALVWAFL
Ga0179596_100494204	3300021086	Vadose Zone Soil	MGTTLYTFSERVQLTLAIGLLVACAANVALVWAFL
Ga0179596_102312371	3300021086	Vadose Zone Soil	MGTTLHTFSERVQLTLAIALLVACAANVALVWAFL
Ga0179596_103584392	3300021086	Vadose Zone Soil	MFPAMGSTLHTFSGRVQMTLAVALLVACAANVALVWAFL
Ga0210406_113372641	3300021168	Soil	MGTSLHTFCERVQFHLAIGLFVACAANVALVWSFL
Ga0213872_103671141	3300021361	Rhizosphere	LMVPSMESLFHTFCERAQLTLAVGLLAACAANIALVWAFL
Ga0213878_102421962	3300021444	Bulk Soil	MLASMGTLLHTFCERAQLTLAVGLLAACAANVALVWAFL
Ga0210392_102499521	3300021475	Soil	LTMGTGLHTFCERTQLTLAIGLFVACAANVALVLAFL
Ga0126371_1000291711	3300021560	Tropical Forest Soil	MGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI
Ga0126371_101835974	3300021560	Tropical Forest Soil	MEATPYTFCERVQLTLAVGLFAACAANVALVFAFL
Ga0207684_101080605	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MFPAMGTSLHTFSRRVQLTLAIGLLVACAANVALVWAFL
Ga0209849_10289652	3300026215	Soil	MFPAMGSTLHTFSERVQLTLAVALLAACAANVALVWTFL
Ga0209161_101903953	3300026548	Soil	MFPAMGSTLHTFCERIQLTLAIGLLVACTANVALVWAFL
Ga0209622_10680162	3300027502	Forest Soil	MGTMLHTFCERVQLTLAVGLLAACAANVALVWVFL
Ga0209523_10313572	3300027548	Forest Soil	MGNLLHTFCERAQLTLAVGLFAACAANVALVWAFL
Ga0209178_14208222	3300027725	Agricultural Soil	MGTTLHTFGERVQLTLAVGLLAACAANLALVWAFF
Ga0209656_104964031	3300027812	Bog Forest Soil	METMPHTFCERVQLTLALGLLAACAANVALVWVFL
Ga0209060_100166033	3300027826	Surface Soil	MGTMLHTFCERVQLNLAIGLLMACAANVALVWAFL
Ga0209060_100284384	3300027826	Surface Soil	MGTRLHTFCERVQLTLAVGLLVACAANVALVWVFL
Ga0209060_101365813	3300027826	Surface Soil	MGTMLHTFCERVQVNLAIGLLMACAANVALVWAFL
Ga0209579_101951412	3300027869	Surface Soil	MFLRMGTLLHTFCERAQLTLAVGLLAGCAANVALVWAFL
Ga0209068_100933403	3300027894	Watersheds	MGTTPHTASDRVQLSLTVALLAACAANVALVFAWL
Ga0209062_10076777	3300027965	Surface Soil	MGTWLHTFCERAQLTLAVGLLAACAANVALVWAFL
Ga0265340_100532184	3300031247	Rhizosphere	MVAGMGTMLHTFCERVQLTLAIGLLMACAANVVLVCAFL
Ga0318516_103786402	3300031543	Soil	APPMGTMLHTSCEGMHLKLALGLLIACAANVALVCAFL
Ga0318534_103128972	3300031544	Soil	MGTSLHTFCQRVQLNLAIGLLMACAANVALVWSFL
Ga0307476_100043412	3300031715	Hardwood Forest Soil	MGTMLHTFCERAQLTLAVGLLAACAANVALVWVFL
Ga0306917_106236052	3300031719	Soil	MFPGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI
Ga0307477_103945292	3300031753	Hardwood Forest Soil	MGNLLHTFCERAQLTLAAGLLAACAANVALVWAFL
Ga0318554_103783683	3300031765	Soil	PVMERMLHTFCERVQLPLAVALFAACAANVVLVWAFL
Ga0318547_104874562	3300031781	Soil	MERILHTFCERVQLPLAVALFAACAANVALVWAFL
Ga0306919_100849373	3300031879	Soil	MGTMLHTSCEGMHLKLALGLLIACAANVALVCAFL
Ga0306925_102412833	3300031890	Soil	MERMLHTFCERVQLPLAVALFAACAANVALVWAFL
Ga0306923_121364272	3300031910	Soil	MGTTLHTFCGRVQLTLAAGLLAACLANAALVWAHL
Ga0306923_124394112	3300031910	Soil	CRMGTSLHTFCQRVQLNLAIGLLMACAANVALVWSFL
Ga0306921_100944686	3300031912	Soil	MGTMLHTSCEGMQLKLALGLLMACAANVALVCAFL
Ga0306921_103156353	3300031912	Soil	MFPDMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI
Ga0310913_100287972	3300031945	Soil	MGTMLHTSCEGMHLKLALGLLIACAANVVLVCAFL
Ga0310910_105189602	3300031946	Soil	MFPGMGTGLRTFSERTLLTLAIGLFIACVANVALVWAFI
Ga0306926_104799563	3300031954	Soil	PGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI
Ga0306926_118144192	3300031954	Soil	MFPAMGTSLHTFCERVQFHLAIGLFVACAANVALVWSFL
Ga0307479_110052552	3300031962	Hardwood Forest Soil	MLPAMETTLHTFCERVQLNLAIGLLIACAANVALVWSFL
Ga0318531_101940482	3300031981	Soil	MERMLHTFCERVQLPLAVALFAACAANVVLVWAFL
Ga0318562_108752672	3300032008	Soil	METLFHTFCERAQLTLAVGLLAACAANVALVWAFL
Ga0318559_101066431	3300032039	Soil	MERILHTFCERVQLPLAVALFAACAANVVLVWAFL
Ga0318545_103928122	3300032042	Soil	MERTLHTFCERVQLPLAVALFAACAANVALVWAFL
Ga0307470_101634244	3300032174	Hardwood Forest Soil	MVLAMGTGLHTFCERTQLTLAIGLFVACAANVALVLAFL
Ga0335085_100105565	3300032770	Soil	MVLPMGTLRHSSCELVQLTLAIGLLAACAANIALVWAFL
Ga0335070_105629112	3300032829	Soil	MGTLLQTFCKRAQLTLAIGLLAGCAANVVLVWAFL
Ga0335070_118714041	3300032829	Soil	MGSMLHTFCERVQLTLAVGLLAACAANVVLVWAFL
Ga0335081_103103793	3300032892	Soil	MGTTLHTFCGRVQLNLAIGLLMACTANVALVWAFL
Ga0335071_109542602	3300032897	Soil	MGTLLHTFCERVQLTLVVGLAAACAANVALVWVFL
Ga0335071_115763682	3300032897	Soil	MGTLHHTFCEHVQLTLAVGLLAACAANVALVCLFL
Ga0335083_110422272	3300032954	Soil	MVLPMGTGLQTFSGRTQLTLAIGLFAACAANVALVLVFL
Ga0371488_0066112_803_922	3300033983	Peat Soil	MFPAMGTMLHTSSERVQLTLTVGLLVACAANVALVLAFL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign