| Basic Information | |
|---|---|
| Family ID | F073909 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MGTTLHTFSERVQLTLAIALLVACAANVALVWAFL |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 49.17 % |
| % of genes near scaffold ends (potentially truncated) | 11.67 % |
| % of genes from short scaffolds (< 2000 bps) | 75.83 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.167 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.167 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF13505 | OMP_b-brl | 16.67 |
| PF00561 | Abhydrolase_1 | 5.83 |
| PF12697 | Abhydrolase_6 | 1.67 |
| PF12146 | Hydrolase_4 | 1.67 |
| PF07883 | Cupin_2 | 0.83 |
| PF01075 | Glyco_transf_9 | 0.83 |
| PF13424 | TPR_12 | 0.83 |
| PF13450 | NAD_binding_8 | 0.83 |
| PF01636 | APH | 0.83 |
| PF00144 | Beta-lactamase | 0.83 |
| PF00528 | BPD_transp_1 | 0.83 |
| PF01627 | Hpt | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.83 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.17 % |
| Unclassified | root | N/A | 5.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459017|G14TP7Y02GJ029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 591 | Open in IMG/M |
| 3300001867|JGI12627J18819_10001990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 7329 | Open in IMG/M |
| 3300005332|Ga0066388_101410527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1211 | Open in IMG/M |
| 3300005332|Ga0066388_104166796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 737 | Open in IMG/M |
| 3300005434|Ga0070709_10025520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3493 | Open in IMG/M |
| 3300005529|Ga0070741_10000314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 184158 | Open in IMG/M |
| 3300005531|Ga0070738_10001234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 55024 | Open in IMG/M |
| 3300005532|Ga0070739_10420135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 617 | Open in IMG/M |
| 3300005533|Ga0070734_10015881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5169 | Open in IMG/M |
| 3300005534|Ga0070735_10176356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1316 | Open in IMG/M |
| 3300005598|Ga0066706_10073356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2403 | Open in IMG/M |
| 3300005764|Ga0066903_100713932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 1771 | Open in IMG/M |
| 3300005944|Ga0066788_10061261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 897 | Open in IMG/M |
| 3300005995|Ga0066790_10047045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1869 | Open in IMG/M |
| 3300006050|Ga0075028_100017867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3079 | Open in IMG/M |
| 3300006173|Ga0070716_101057482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 645 | Open in IMG/M |
| 3300006804|Ga0079221_10142807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1241 | Open in IMG/M |
| 3300006852|Ga0075433_11525122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 577 | Open in IMG/M |
| 3300007265|Ga0099794_10569729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 598 | Open in IMG/M |
| 3300009038|Ga0099829_10975739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 703 | Open in IMG/M |
| 3300009090|Ga0099827_10033749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3720 | Open in IMG/M |
| 3300009137|Ga0066709_100464650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1773 | Open in IMG/M |
| 3300009792|Ga0126374_10034320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 2417 | Open in IMG/M |
| 3300009792|Ga0126374_10719961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 753 | Open in IMG/M |
| 3300009826|Ga0123355_11164332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 792 | Open in IMG/M |
| 3300010043|Ga0126380_11279901 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010043|Ga0126380_11534788 | Not Available | 591 | Open in IMG/M |
| 3300010048|Ga0126373_10764233 | Not Available | 1027 | Open in IMG/M |
| 3300010049|Ga0123356_10267182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1798 | Open in IMG/M |
| 3300010049|Ga0123356_13391111 | Not Available | 553 | Open in IMG/M |
| 3300010049|Ga0123356_13477771 | Not Available | 546 | Open in IMG/M |
| 3300010159|Ga0099796_10528527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 529 | Open in IMG/M |
| 3300010361|Ga0126378_13404291 | Not Available | 505 | Open in IMG/M |
| 3300010362|Ga0126377_10760554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1025 | Open in IMG/M |
| 3300010376|Ga0126381_101665459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 922 | Open in IMG/M |
| 3300010376|Ga0126381_102895175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
| 3300010376|Ga0126381_103206196 | Not Available | 647 | Open in IMG/M |
| 3300010376|Ga0126381_103730239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 596 | Open in IMG/M |
| 3300010376|Ga0126381_104930435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 512 | Open in IMG/M |
| 3300011269|Ga0137392_10432885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1092 | Open in IMG/M |
| 3300011418|Ga0153954_1006495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3858 | Open in IMG/M |
| 3300012096|Ga0137389_10251213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1486 | Open in IMG/M |
| 3300012199|Ga0137383_10005810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7972 | Open in IMG/M |
| 3300012202|Ga0137363_10259375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1415 | Open in IMG/M |
| 3300012203|Ga0137399_10192987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1650 | Open in IMG/M |
| 3300012357|Ga0137384_10597670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 901 | Open in IMG/M |
| 3300012359|Ga0137385_10738480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 820 | Open in IMG/M |
| 3300012685|Ga0137397_10205256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1466 | Open in IMG/M |
| 3300012929|Ga0137404_10423156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1178 | Open in IMG/M |
| 3300012930|Ga0137407_10182998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1871 | Open in IMG/M |
| 3300012930|Ga0137407_11067403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 765 | Open in IMG/M |
| 3300012930|Ga0137407_11510528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 639 | Open in IMG/M |
| 3300012944|Ga0137410_10021069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4488 | Open in IMG/M |
| 3300012971|Ga0126369_10608895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1163 | Open in IMG/M |
| 3300016341|Ga0182035_10537969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1002 | Open in IMG/M |
| 3300016341|Ga0182035_10742419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 858 | Open in IMG/M |
| 3300017947|Ga0187785_10161236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
| 3300017973|Ga0187780_11463620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300018062|Ga0187784_10406544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1101 | Open in IMG/M |
| 3300018085|Ga0187772_10014630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4371 | Open in IMG/M |
| 3300019789|Ga0137408_1183142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 812 | Open in IMG/M |
| 3300020170|Ga0179594_10000840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6743 | Open in IMG/M |
| 3300020170|Ga0179594_10113925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 981 | Open in IMG/M |
| 3300020199|Ga0179592_10033153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2331 | Open in IMG/M |
| 3300020579|Ga0210407_10003148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 13593 | Open in IMG/M |
| 3300020580|Ga0210403_10605591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 884 | Open in IMG/M |
| 3300021086|Ga0179596_10049420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1736 | Open in IMG/M |
| 3300021086|Ga0179596_10231237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 908 | Open in IMG/M |
| 3300021086|Ga0179596_10358439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 733 | Open in IMG/M |
| 3300021168|Ga0210406_11337264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300021361|Ga0213872_10367114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 588 | Open in IMG/M |
| 3300021444|Ga0213878_10242196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 765 | Open in IMG/M |
| 3300021475|Ga0210392_10249952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1256 | Open in IMG/M |
| 3300021560|Ga0126371_10002917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 14883 | Open in IMG/M |
| 3300021560|Ga0126371_10183597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2178 | Open in IMG/M |
| 3300025910|Ga0207684_10108060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2381 | Open in IMG/M |
| 3300026215|Ga0209849_1028965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 951 | Open in IMG/M |
| 3300026548|Ga0209161_10190395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1146 | Open in IMG/M |
| 3300027502|Ga0209622_1068016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 650 | Open in IMG/M |
| 3300027548|Ga0209523_1031357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1066 | Open in IMG/M |
| 3300027725|Ga0209178_1420822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 510 | Open in IMG/M |
| 3300027812|Ga0209656_10496403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 534 | Open in IMG/M |
| 3300027826|Ga0209060_10016603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3986 | Open in IMG/M |
| 3300027826|Ga0209060_10028438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 2836 | Open in IMG/M |
| 3300027826|Ga0209060_10136581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1140 | Open in IMG/M |
| 3300027869|Ga0209579_10195141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 1084 | Open in IMG/M |
| 3300027894|Ga0209068_10093340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1580 | Open in IMG/M |
| 3300027965|Ga0209062_1007677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 9207 | Open in IMG/M |
| 3300031247|Ga0265340_10053218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1955 | Open in IMG/M |
| 3300031543|Ga0318516_10378640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 816 | Open in IMG/M |
| 3300031544|Ga0318534_10312897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 905 | Open in IMG/M |
| 3300031715|Ga0307476_10004341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 8540 | Open in IMG/M |
| 3300031719|Ga0306917_10623605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 848 | Open in IMG/M |
| 3300031753|Ga0307477_10394529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 948 | Open in IMG/M |
| 3300031765|Ga0318554_10378368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 804 | Open in IMG/M |
| 3300031781|Ga0318547_10487456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 761 | Open in IMG/M |
| 3300031879|Ga0306919_10084937 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300031890|Ga0306925_10241283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 1948 | Open in IMG/M |
| 3300031910|Ga0306923_12136427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 564 | Open in IMG/M |
| 3300031910|Ga0306923_12439411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 517 | Open in IMG/M |
| 3300031912|Ga0306921_10094468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3458 | Open in IMG/M |
| 3300031912|Ga0306921_10315635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1829 | Open in IMG/M |
| 3300031945|Ga0310913_10028797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3522 | Open in IMG/M |
| 3300031946|Ga0310910_10518960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 946 | Open in IMG/M |
| 3300031954|Ga0306926_10479956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1530 | Open in IMG/M |
| 3300031954|Ga0306926_11814419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300031962|Ga0307479_11005255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 803 | Open in IMG/M |
| 3300031981|Ga0318531_10194048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 915 | Open in IMG/M |
| 3300032008|Ga0318562_10875267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 513 | Open in IMG/M |
| 3300032039|Ga0318559_10106643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 1245 | Open in IMG/M |
| 3300032042|Ga0318545_10392812 | Not Available | 501 | Open in IMG/M |
| 3300032174|Ga0307470_10163424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1379 | Open in IMG/M |
| 3300032770|Ga0335085_10010556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 13790 | Open in IMG/M |
| 3300032829|Ga0335070_10562911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 1075 | Open in IMG/M |
| 3300032829|Ga0335070_11871404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
| 3300032892|Ga0335081_10310379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2083 | Open in IMG/M |
| 3300032897|Ga0335071_10954260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 805 | Open in IMG/M |
| 3300032897|Ga0335071_11576368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 601 | Open in IMG/M |
| 3300032954|Ga0335083_11042227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 642 | Open in IMG/M |
| 3300033983|Ga0371488_0066112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2141 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.33% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.67% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.83% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011418 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4ZMR_05443660 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MFPAMGTTLHTFSERVLLTLAIGLLVACAANVALVWAFL |
| JGI12627J18819_1000199010 | 3300001867 | Forest Soil | MGTMLHTFCERAQLTLAVGLLAACAANVALVWVFL* |
| Ga0066388_1014105272 | 3300005332 | Tropical Forest Soil | MLRPMGTMLHTSCEGMHLKLALGLLMACAANVVLVCAFL* |
| Ga0066388_1041667962 | 3300005332 | Tropical Forest Soil | MFPAMGTGVHTFSERTQLTLAVGLFVACMANVALVWAFL* |
| Ga0070709_100255203 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLTMGTGLHTFCERTQLTLAIGLFVACAANVALVLAFL* |
| Ga0070741_1000031470 | 3300005529 | Surface Soil | MGTWLHTFCERAQLTLAVGLLAACAANVALVWAFL* |
| Ga0070738_100012344 | 3300005531 | Surface Soil | MGTRLHTFCERVQLTLAVGLLVACAANVALVWVFL* |
| Ga0070739_104201352 | 3300005532 | Surface Soil | MVPAMGTILHTFCGRVQLTLAVGLLAACAANVALVWAFL* |
| Ga0070734_100158816 | 3300005533 | Surface Soil | MGTMLHTFCERVQLNLAIGLLMACAANVALVWAFL* |
| Ga0070735_101763562 | 3300005534 | Surface Soil | MVWAMGTTLQTASERMQLGLTIALLGACAANVALVWAFL* |
| Ga0066706_100733565 | 3300005598 | Soil | MGSTLHTFCERIQLTLAIGLLVACTANVALVWAFL* |
| Ga0066903_1007139322 | 3300005764 | Tropical Forest Soil | METTPYTFCERVQLTLAVGLFAACAANVALVFAFL* |
| Ga0066788_100612613 | 3300005944 | Soil | MFPAMGSTLHTFSERVQLTLAVALLAACAANVALVWTFL* |
| Ga0066790_100470451 | 3300005995 | Soil | MGSTLHTFSERVQLTLAVALLAACAANVALVWTFL* |
| Ga0075028_1000178674 | 3300006050 | Watersheds | MGTTPHTASDRVQLSLTVALLAACAANVALVFAWL* |
| Ga0070716_1010574821 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MFPGMGTGLRTLSERTLLTLAVGLFIACVANVALVWAFL* |
| Ga0079221_101428073 | 3300006804 | Agricultural Soil | MGTTLHTFGERVQLTLAVGLLAACAANLALVWAFF* |
| Ga0075433_115251221 | 3300006852 | Populus Rhizosphere | MGTMLHTARERVELTLAIALLIACAANVALVCAFL* |
| Ga0099794_105697292 | 3300007265 | Vadose Zone Soil | MFPAMGTTLHTFSERGIQLTLAIGLLVACAANVALVWAFP* |
| Ga0099829_109757391 | 3300009038 | Vadose Zone Soil | MFPAMGTTLHTFSERVQLTLAIGLLVACAANVALVWAFL* |
| Ga0099827_100337495 | 3300009090 | Vadose Zone Soil | MFPAMGTTLHTFSERGVQLTLAIGLLVACAANVALVWAFL* |
| Ga0066709_1004646504 | 3300009137 | Grasslands Soil | MFPAMGSTLHTFCERIQLTLAIGLLVACAANVALVWDFL* |
| Ga0126374_100343203 | 3300009792 | Tropical Forest Soil | MFPGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI* |
| Ga0126374_107199612 | 3300009792 | Tropical Forest Soil | MLPAMETTLHTFCERVQLNLAIGLLIACAANVALVWSFL* |
| Ga0123355_111643322 | 3300009826 | Termite Gut | MDTTPHTFCDRVQLSLAVGLFAACAANVVLVLVFL* |
| Ga0126380_112799011 | 3300010043 | Tropical Forest Soil | MGTGLRTFSERTQLSLAIGLFVACAANIALVLTFL* |
| Ga0126380_115347882 | 3300010043 | Tropical Forest Soil | MDTTPHTFCDRVQLTLAVGLFAACAANVVLVLVFL* |
| Ga0126373_107642333 | 3300010048 | Tropical Forest Soil | MFLLMEAMSRTFCERVQLTLAAGLFAACAANVALVWAFLF* |
| Ga0123356_102671823 | 3300010049 | Termite Gut | MDTTPHTFCNRVQLSLAVGLFAACAANVVLVLVFL* |
| Ga0123356_133911112 | 3300010049 | Termite Gut | PMDTTPHTFCDRVQLTLAVGLFAACAANVVLVLVFL* |
| Ga0123356_134777711 | 3300010049 | Termite Gut | MVLPMDTTRPTFCDRVQLTLAVGLFAACAANVVLVFVFL* |
| Ga0099796_105285272 | 3300010159 | Vadose Zone Soil | MFPAMGTTLHTFSERGIQLTLAIGLLVACAANVALVWAFL* |
| Ga0126378_134042911 | 3300010361 | Tropical Forest Soil | MFPAMGTSLHTFCERVQFHLAIGLFVACAANVALVWSFL* |
| Ga0126377_107605542 | 3300010362 | Tropical Forest Soil | MGTTLHTASERVELTLAIGLLIACAANVALVCAFL* |
| Ga0126381_1016654592 | 3300010376 | Tropical Forest Soil | METTSRTFCERVQLTLAAGLFAACAANVALVWAFLF* |
| Ga0126381_1028951752 | 3300010376 | Tropical Forest Soil | MFLPMETMSRTFSECVQLTLAAGLFAACAANVALVWAFLF* |
| Ga0126381_1032061963 | 3300010376 | Tropical Forest Soil | METTPYIFCERVQLTLAVGLFAACAANVALVFAFL* |
| Ga0126381_1037302391 | 3300010376 | Tropical Forest Soil | METMLHTFCERVQLPLAVGLFAACAANVALVWAFL* |
| Ga0126381_1049304351 | 3300010376 | Tropical Forest Soil | MLPAMGTTLQTFCERVQLNLAIGLLMACTANVALVWAF |
| Ga0137392_104328852 | 3300011269 | Vadose Zone Soil | MGTTLHTFSERVQLTLAIALLVACAANVALVWAFL* |
| Ga0153954_10064952 | 3300011418 | Attine Ant Fungus Gardens | METMNEIASERMHLRLTVGLLLACVANVALVCAFL* |
| Ga0137389_102512132 | 3300012096 | Vadose Zone Soil | MFPAMGTTLHAFSERVQLTLAIGLLVACAANVALVWAFL* |
| Ga0137383_1000581010 | 3300012199 | Vadose Zone Soil | MFPAMGSTLHTFCERIQLTLAIGLLVACTANVALVWAFL* |
| Ga0137363_102593753 | 3300012202 | Vadose Zone Soil | MFPAMGTTLHTFSERGVRLTLAIGLLVACAANVALVWAFL* |
| Ga0137399_101929871 | 3300012203 | Vadose Zone Soil | MGTTLHTFSERGVQLTLAIGLLVACAANVALVWAFL* |
| Ga0137384_105976702 | 3300012357 | Vadose Zone Soil | MFPAMGSTLHTFSGRVQVTLAVALLVACAANVALVWAFL* |
| Ga0137385_107384801 | 3300012359 | Vadose Zone Soil | MGTTLHTFSERIQLTLAIALLVACAANVALVWAFL* |
| Ga0137397_102052563 | 3300012685 | Vadose Zone Soil | MFPSMGSTLHTFSERVQLTLAIALLVACAANVALVWAFL* |
| Ga0137404_104231561 | 3300012929 | Vadose Zone Soil | MFSAMGTSLHTFSGRVQLTLAIGLLVACAANVALV |
| Ga0137407_101829984 | 3300012930 | Vadose Zone Soil | MFPSMGSTLHTFSERVRLTLAIALLVACAANVALVWAFL* |
| Ga0137407_110674031 | 3300012930 | Vadose Zone Soil | MFSAMGTSLHTFSGRVQLTLAIGLLVACAANVALVCAFL* |
| Ga0137407_115105282 | 3300012930 | Vadose Zone Soil | MGTTLHTFSERVQLTLAIALLVACAANVTLVWAFL* |
| Ga0137410_100210697 | 3300012944 | Vadose Zone Soil | MFPAMGTTLHTFSEHGVQLTLAIGLLVACAANVALVWAFL* |
| Ga0126369_106088952 | 3300012971 | Tropical Forest Soil | MGTSLHTFCQRVQLNLAIGLLMACAANVALVWSFL* |
| Ga0182035_105379691 | 3300016341 | Soil | RMFPGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI |
| Ga0182035_107424191 | 3300016341 | Soil | MGTSLHTFCQRLQLNLAIGLLMACAANVALVWSFL |
| Ga0187785_101612362 | 3300017947 | Tropical Peatland | MGTSLHTFCERVQFHLAIGLFVACAANVALVWSFLS |
| Ga0187780_114636202 | 3300017973 | Tropical Peatland | RRMVPPMGSMLHTFCERVQLTLAVGLLAACAANVALVWAFL |
| Ga0187784_104065442 | 3300018062 | Tropical Peatland | MGTSLHSFCERVQLNLAIGLLMACAANVALVWAFL |
| Ga0187772_100146305 | 3300018085 | Tropical Peatland | MGTGLHTFSERVQLNLAIGLLMACAANVALVWAFL |
| Ga0137408_11831423 | 3300019789 | Vadose Zone Soil | MFPSMGSTLHTFSERVQLTLAIALLVACAANVALVWAFL |
| Ga0179594_100008402 | 3300020170 | Vadose Zone Soil | MGTTLHTFSERGVQLTLAIGLLVACAANVALVWAFL |
| Ga0179594_101139251 | 3300020170 | Vadose Zone Soil | MFPAMGSTLHTFCERIQLTLAIGLLVACAANVALVWAFL |
| Ga0179592_100331534 | 3300020199 | Vadose Zone Soil | MGSTLHTFSERVQLTLAIALLVACAANVALVWAFL |
| Ga0210407_100031485 | 3300020579 | Soil | MGTGLRTLSERTLLTLAVGLFIACVANVALVWAFL |
| Ga0210403_106055912 | 3300020580 | Soil | MFPGMGTGLRTLSERTLLTLAVGLFIACVANVALVWAFL |
| Ga0179596_100494204 | 3300021086 | Vadose Zone Soil | MGTTLYTFSERVQLTLAIGLLVACAANVALVWAFL |
| Ga0179596_102312371 | 3300021086 | Vadose Zone Soil | MGTTLHTFSERVQLTLAIALLVACAANVALVWAFL |
| Ga0179596_103584392 | 3300021086 | Vadose Zone Soil | MFPAMGSTLHTFSGRVQMTLAVALLVACAANVALVWAFL |
| Ga0210406_113372641 | 3300021168 | Soil | MGTSLHTFCERVQFHLAIGLFVACAANVALVWSFL |
| Ga0213872_103671141 | 3300021361 | Rhizosphere | LMVPSMESLFHTFCERAQLTLAVGLLAACAANIALVWAFL |
| Ga0213878_102421962 | 3300021444 | Bulk Soil | MLASMGTLLHTFCERAQLTLAVGLLAACAANVALVWAFL |
| Ga0210392_102499521 | 3300021475 | Soil | LTMGTGLHTFCERTQLTLAIGLFVACAANVALVLAFL |
| Ga0126371_1000291711 | 3300021560 | Tropical Forest Soil | MGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI |
| Ga0126371_101835974 | 3300021560 | Tropical Forest Soil | MEATPYTFCERVQLTLAVGLFAACAANVALVFAFL |
| Ga0207684_101080605 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MFPAMGTSLHTFSRRVQLTLAIGLLVACAANVALVWAFL |
| Ga0209849_10289652 | 3300026215 | Soil | MFPAMGSTLHTFSERVQLTLAVALLAACAANVALVWTFL |
| Ga0209161_101903953 | 3300026548 | Soil | MFPAMGSTLHTFCERIQLTLAIGLLVACTANVALVWAFL |
| Ga0209622_10680162 | 3300027502 | Forest Soil | MGTMLHTFCERVQLTLAVGLLAACAANVALVWVFL |
| Ga0209523_10313572 | 3300027548 | Forest Soil | MGNLLHTFCERAQLTLAVGLFAACAANVALVWAFL |
| Ga0209178_14208222 | 3300027725 | Agricultural Soil | MGTTLHTFGERVQLTLAVGLLAACAANLALVWAFF |
| Ga0209656_104964031 | 3300027812 | Bog Forest Soil | METMPHTFCERVQLTLALGLLAACAANVALVWVFL |
| Ga0209060_100166033 | 3300027826 | Surface Soil | MGTMLHTFCERVQLNLAIGLLMACAANVALVWAFL |
| Ga0209060_100284384 | 3300027826 | Surface Soil | MGTRLHTFCERVQLTLAVGLLVACAANVALVWVFL |
| Ga0209060_101365813 | 3300027826 | Surface Soil | MGTMLHTFCERVQVNLAIGLLMACAANVALVWAFL |
| Ga0209579_101951412 | 3300027869 | Surface Soil | MFLRMGTLLHTFCERAQLTLAVGLLAGCAANVALVWAFL |
| Ga0209068_100933403 | 3300027894 | Watersheds | MGTTPHTASDRVQLSLTVALLAACAANVALVFAWL |
| Ga0209062_10076777 | 3300027965 | Surface Soil | MGTWLHTFCERAQLTLAVGLLAACAANVALVWAFL |
| Ga0265340_100532184 | 3300031247 | Rhizosphere | MVAGMGTMLHTFCERVQLTLAIGLLMACAANVVLVCAFL |
| Ga0318516_103786402 | 3300031543 | Soil | APPMGTMLHTSCEGMHLKLALGLLIACAANVALVCAFL |
| Ga0318534_103128972 | 3300031544 | Soil | MGTSLHTFCQRVQLNLAIGLLMACAANVALVWSFL |
| Ga0307476_100043412 | 3300031715 | Hardwood Forest Soil | MGTMLHTFCERAQLTLAVGLLAACAANVALVWVFL |
| Ga0306917_106236052 | 3300031719 | Soil | MFPGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI |
| Ga0307477_103945292 | 3300031753 | Hardwood Forest Soil | MGNLLHTFCERAQLTLAAGLLAACAANVALVWAFL |
| Ga0318554_103783683 | 3300031765 | Soil | PVMERMLHTFCERVQLPLAVALFAACAANVVLVWAFL |
| Ga0318547_104874562 | 3300031781 | Soil | MERILHTFCERVQLPLAVALFAACAANVALVWAFL |
| Ga0306919_100849373 | 3300031879 | Soil | MGTMLHTSCEGMHLKLALGLLIACAANVALVCAFL |
| Ga0306925_102412833 | 3300031890 | Soil | MERMLHTFCERVQLPLAVALFAACAANVALVWAFL |
| Ga0306923_121364272 | 3300031910 | Soil | MGTTLHTFCGRVQLTLAAGLLAACLANAALVWAHL |
| Ga0306923_124394112 | 3300031910 | Soil | CRMGTSLHTFCQRVQLNLAIGLLMACAANVALVWSFL |
| Ga0306921_100944686 | 3300031912 | Soil | MGTMLHTSCEGMQLKLALGLLMACAANVALVCAFL |
| Ga0306921_103156353 | 3300031912 | Soil | MFPDMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI |
| Ga0310913_100287972 | 3300031945 | Soil | MGTMLHTSCEGMHLKLALGLLIACAANVVLVCAFL |
| Ga0310910_105189602 | 3300031946 | Soil | MFPGMGTGLRTFSERTLLTLAIGLFIACVANVALVWAFI |
| Ga0306926_104799563 | 3300031954 | Soil | PGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI |
| Ga0306926_118144192 | 3300031954 | Soil | MFPAMGTSLHTFCERVQFHLAIGLFVACAANVALVWSFL |
| Ga0307479_110052552 | 3300031962 | Hardwood Forest Soil | MLPAMETTLHTFCERVQLNLAIGLLIACAANVALVWSFL |
| Ga0318531_101940482 | 3300031981 | Soil | MERMLHTFCERVQLPLAVALFAACAANVVLVWAFL |
| Ga0318562_108752672 | 3300032008 | Soil | METLFHTFCERAQLTLAVGLLAACAANVALVWAFL |
| Ga0318559_101066431 | 3300032039 | Soil | MERILHTFCERVQLPLAVALFAACAANVVLVWAFL |
| Ga0318545_103928122 | 3300032042 | Soil | MERTLHTFCERVQLPLAVALFAACAANVALVWAFL |
| Ga0307470_101634244 | 3300032174 | Hardwood Forest Soil | MVLAMGTGLHTFCERTQLTLAIGLFVACAANVALVLAFL |
| Ga0335085_100105565 | 3300032770 | Soil | MVLPMGTLRHSSCELVQLTLAIGLLAACAANIALVWAFL |
| Ga0335070_105629112 | 3300032829 | Soil | MGTLLQTFCKRAQLTLAIGLLAGCAANVVLVWAFL |
| Ga0335070_118714041 | 3300032829 | Soil | MGSMLHTFCERVQLTLAVGLLAACAANVVLVWAFL |
| Ga0335081_103103793 | 3300032892 | Soil | MGTTLHTFCGRVQLNLAIGLLMACTANVALVWAFL |
| Ga0335071_109542602 | 3300032897 | Soil | MGTLLHTFCERVQLTLVVGLAAACAANVALVWVFL |
| Ga0335071_115763682 | 3300032897 | Soil | MGTLHHTFCEHVQLTLAVGLLAACAANVALVCLFL |
| Ga0335083_110422272 | 3300032954 | Soil | MVLPMGTGLQTFSGRTQLTLAIGLFAACAANVALVLVFL |
| Ga0371488_0066112_803_922 | 3300033983 | Peat Soil | MFPAMGTMLHTSSERVQLTLTVGLLVACAANVALVLAFL |
| ⦗Top⦘ |