Metagenome / Metatranscriptome Family F073900

Basic Information
Family ID	F073900
Family Type	Metagenome / Metatranscriptome
Number of Sequences	120
Average Sequence Length	38 residues
Representative Sequence	MQVDAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH
Number of Associated Samples	103
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	19.17 %
% of genes near scaffold ends (potentially truncated)	65.00 %
% of genes from short scaffolds (< 2000 bps)	85.83 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Most Common Taxonomy
Group	Bacteria (69.167 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.167 % of family members)
Environment Ontology (ENVO)	Unclassified (25.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (40.833 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF00589	Phage_integrase	5.00
PF12728	HTH_17	4.17
PF11154	DUF2934	2.50
PF13185	GAF_2	2.50
PF11848	DUF3368	2.50
PF13561	adh_short_C2	1.67
PF13602	ADH_zinc_N_2	1.67
PF07080	DUF1348	1.67
PF02518	HATPase_c	0.83
PF01850	PIN	0.83
PF02786	CPSase_L_D2	0.83
PF01610	DDE_Tnp_ISL3	0.83
PF13607	Succ_CoA_lig	0.83
PF10137	TIR-like	0.83
PF01381	HTH_3	0.83
PF10091	Glycoamylase	0.83
PF13243	SQHop_cyclase_C	0.83
PF13083	KH_4	0.83
PF07883	Cupin_2	0.83
PF13596	PAS_10	0.83
PF10604	Polyketide_cyc2	0.83
PF13492	GAF_3	0.83
PF03450	CO_deh_flav_C	0.83
PF03466	LysR_substrate	0.83
PF00198	2-oxoacid_dh	0.83
PF12833	HTH_18	0.83
PF00432	Prenyltrans	0.83
PF13489	Methyltransf_23	0.83
PF14685	Tricorn_PDZ	0.83
PF02502	LacAB_rpiB	0.83
PF00106	adh_short	0.83
PF13470	PIN_3	0.83
PF12831	FAD_oxidored	0.83
PF03479	PCC	0.83
PF01436	NHL	0.83
PF01668	SmpB	0.83
PF05016	ParE_toxin	0.83
PF00012	HSP70	0.83
PF08281	Sigma70_r4_2	0.83
PF13482	RNase_H_2	0.83
PF07228	SpoIIE	0.83
PF01641	SelR	0.83
PF13768	VWA_3	0.83
PF04454	Linocin_M18	0.83
PF00588	SpoU_methylase	0.83
PF02371	Transposase_20	0.83
PF00230	MIP	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG3558	Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily	Function unknown [S]	1.67
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	0.83
COG0229	Peptide methionine sulfoxide reductase MsrB	Posttranslational modification, protein turnover, chaperones [O]	0.83
COG0443	Molecular chaperone DnaK (HSP70)	Posttranslational modification, protein turnover, chaperones [O]	0.83
COG0508	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component	Energy production and conversion [C]	0.83
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	0.83
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	0.83
COG0580	Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)	Carbohydrate transport and metabolism [G]	0.83
COG0691	tmRNA-binding protein	Posttranslational modification, protein turnover, chaperones [O]	0.83
COG0698	Ribose 5-phosphate isomerase RpiB	Carbohydrate transport and metabolism [G]	0.83
COG1661	Predicted DNA-binding protein with PD1-like DNA-binding motif, PPC/DUF296 domain	General function prediction only [R]	0.83
COG3464	Transposase	Mobilome: prophages, transposons [X]	0.83
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	69.17 %
Unclassified	root	N/A	30.83 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	69.17 %
Unclassified	root	N/A	30.83 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	69.17 %
Unclassified	root	N/A	30.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.83 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	25.00 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.50 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	2.50 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.83 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	11.67 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	7.50 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.67 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.83 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.83 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.83 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.83 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.83 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	4.17 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	1.67 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1.67 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.83 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.83 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.83 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.83 %
Legionellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.83 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.83 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4.17 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	1.67 %
Desulfovibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales	0.83 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.83 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.83 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.83 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.83 %
Coxiellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae	0.83 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.83 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.83 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	1.67 %
Desulfohalobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfohalobiaceae	0.83 %
Bryobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter	0.83 %
Acidicapsa	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa	0.83 %
Rickettsiella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Rickettsiella	0.83 %
Nitrococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Nitrococcus	0.83 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.83 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.83 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.83 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.83 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	1.67 %
unclassified Rickettsiella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Rickettsiella → unclassified Rickettsiella	0.83 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	0.83 %
Acidicapsa acidisoli	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli	0.83 %
Nitrococcus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Nitrococcus → Nitrococcus mobilis	0.83 %
Desulfohalobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfohalobiaceae → Desulfohalobium	0.83 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.83 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.83 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.83 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.83 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	1.67 %
Rickettsiella endosymbiont of Dermanyssus gallinae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Rickettsiella → unclassified Rickettsiella → Rickettsiella endosymbiont of Dermanyssus gallinae	0.83 %
Desulfohalobium retbaense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfohalobiaceae → Desulfohalobium → Desulfohalobium retbaense	0.83 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	0.83 %
Acidicapsa acidisoli	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli	0.83 %
Nitrococcus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Nitrococcus → Nitrococcus mobilis	0.83 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.83 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.83 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000567\|JGI12270J11330_10219785	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	632	Open in IMG/M
3300001546\|JGI12659J15293_10122978	Not Available	564	Open in IMG/M
3300001593\|JGI12635J15846_10106071	All Organisms → cellular organisms → Bacteria	2007	Open in IMG/M
3300001593\|JGI12635J15846_10179480	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1422	Open in IMG/M
3300005167\|Ga0066672_10047287	All Organisms → cellular organisms → Bacteria	2450	Open in IMG/M
3300005534\|Ga0070735_10685036	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300005537\|Ga0070730_10017133	All Organisms → cellular organisms → Bacteria	5723	Open in IMG/M
3300005540\|Ga0066697_10526266	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300005541\|Ga0070733_10457678	Not Available	852	Open in IMG/M
3300005541\|Ga0070733_10497005	All Organisms → cellular organisms → Bacteria	816	Open in IMG/M
3300005542\|Ga0070732_10346249	All Organisms → cellular organisms → Bacteria	894	Open in IMG/M
3300005542\|Ga0070732_10720468	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300005591\|Ga0070761_10151506	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli	1358	Open in IMG/M
3300005764\|Ga0066903_107003513	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	585	Open in IMG/M
3300006059\|Ga0075017_100027885	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3707	Open in IMG/M
3300006059\|Ga0075017_100723326	Not Available	766	Open in IMG/M
3300006173\|Ga0070716_101329134	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300006173\|Ga0070716_101824539	Not Available	504	Open in IMG/M
3300006175\|Ga0070712_100622259	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	915	Open in IMG/M
3300006791\|Ga0066653_10530011	Not Available	596	Open in IMG/M
3300006796\|Ga0066665_10460618	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1048	Open in IMG/M
3300006893\|Ga0073928_10097882	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2469	Open in IMG/M
3300009012\|Ga0066710_100640778	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1615	Open in IMG/M
3300009029\|Ga0066793_10475043	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300009038\|Ga0099829_10382375	Not Available	1162	Open in IMG/M
3300009038\|Ga0099829_11109707	Not Available	656	Open in IMG/M
3300009089\|Ga0099828_10210430	All Organisms → cellular organisms → Bacteria → Acidobacteria	1737	Open in IMG/M
3300009089\|Ga0099828_10793314	All Organisms → cellular organisms → Bacteria → Proteobacteria	848	Open in IMG/M
3300009148\|Ga0105243_11408578	Not Available	718	Open in IMG/M
3300009162\|Ga0075423_13074802	Not Available	511	Open in IMG/M
3300009547\|Ga0116136_1043393	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1297	Open in IMG/M
3300009624\|Ga0116105_1188662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Nitrococcus → Nitrococcus mobilis	564	Open in IMG/M
3300009631\|Ga0116115_1067741	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	932	Open in IMG/M
3300009632\|Ga0116102_1064596	All Organisms → cellular organisms → Bacteria → Acidobacteria	1113	Open in IMG/M
3300009633\|Ga0116129_1002586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	9117	Open in IMG/M
3300009633\|Ga0116129_1219635	Not Available	539	Open in IMG/M
3300009636\|Ga0116112_1124318	Not Available	722	Open in IMG/M
3300009764\|Ga0116134_1057750	All Organisms → cellular organisms → Bacteria → Acidobacteria	1468	Open in IMG/M
3300010048\|Ga0126373_10970691	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300010360\|Ga0126372_11861225	All Organisms → cellular organisms → Bacteria → Acidobacteria	646	Open in IMG/M
3300010361\|Ga0126378_10236740	All Organisms → cellular organisms → Bacteria	1915	Open in IMG/M
3300010376\|Ga0126381_100243104	All Organisms → cellular organisms → Bacteria	2434	Open in IMG/M
3300010379\|Ga0136449_100441633	All Organisms → cellular organisms → Bacteria → Acidobacteria	2287	Open in IMG/M
3300010379\|Ga0136449_103229398	Not Available	629	Open in IMG/M
3300011120\|Ga0150983_13717967	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	687	Open in IMG/M
3300011269\|Ga0137392_10539148	Not Available	969	Open in IMG/M
3300011270\|Ga0137391_10908678	Not Available	720	Open in IMG/M
3300011271\|Ga0137393_10449918	All Organisms → cellular organisms → Bacteria	1104	Open in IMG/M
3300012096\|Ga0137389_11167816	Not Available	659	Open in IMG/M
3300012189\|Ga0137388_10998099	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	772	Open in IMG/M
3300012205\|Ga0137362_10337946	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1304	Open in IMG/M
3300012206\|Ga0137380_11736704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Rickettsiella → unclassified Rickettsiella → Rickettsiella endosymbiont of Dermanyssus gallinae	508	Open in IMG/M
3300012207\|Ga0137381_11192885	Not Available	654	Open in IMG/M
3300012924\|Ga0137413_10035126	All Organisms → cellular organisms → Bacteria	2791	Open in IMG/M
3300014156\|Ga0181518_10096997	All Organisms → cellular organisms → Bacteria	1652	Open in IMG/M
3300014158\|Ga0181521_10143134	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1386	Open in IMG/M
3300014159\|Ga0181530_10151093	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1324	Open in IMG/M
3300014159\|Ga0181530_10324862	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	800	Open in IMG/M
3300014501\|Ga0182024_11483923	Not Available	775	Open in IMG/M
3300014839\|Ga0182027_11019025	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	846	Open in IMG/M
3300014968\|Ga0157379_11801379	All Organisms → cellular organisms → Bacteria	601	Open in IMG/M
3300015193\|Ga0167668_1024750	All Organisms → cellular organisms → Bacteria	1336	Open in IMG/M
3300015195\|Ga0167658_1000050	All Organisms → cellular organisms → Bacteria → Acidobacteria	84566	Open in IMG/M
3300015264\|Ga0137403_10797628	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	800	Open in IMG/M
3300017931\|Ga0187877_1233752	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	713	Open in IMG/M
3300017946\|Ga0187879_10016859	All Organisms → cellular organisms → Bacteria	4551	Open in IMG/M
3300017948\|Ga0187847_10016762	All Organisms → cellular organisms → Bacteria → Proteobacteria	4621	Open in IMG/M
3300017948\|Ga0187847_10308137	All Organisms → cellular organisms → Bacteria	865	Open in IMG/M
3300018012\|Ga0187810_10134325	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	987	Open in IMG/M
3300018042\|Ga0187871_10147778	All Organisms → cellular organisms → Bacteria	1329	Open in IMG/M
3300018058\|Ga0187766_11377461	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	517	Open in IMG/M
3300018062\|Ga0187784_10225442	All Organisms → cellular organisms → Bacteria	1527	Open in IMG/M
3300018086\|Ga0187769_10841661	Not Available	694	Open in IMG/M
3300019888\|Ga0193751_1115206	Not Available	1011	Open in IMG/M
3300020580\|Ga0210403_10871021	Not Available	712	Open in IMG/M
3300020583\|Ga0210401_10806625	Not Available	798	Open in IMG/M
3300020583\|Ga0210401_10901791	Not Available	743	Open in IMG/M
3300022532\|Ga0242655_10269699	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300022557\|Ga0212123_10136489	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1919	Open in IMG/M
3300022557\|Ga0212123_10572620	Not Available	718	Open in IMG/M
3300025905\|Ga0207685_10123367	All Organisms → cellular organisms → Bacteria	1140	Open in IMG/M
3300026142\|Ga0207698_11643723	Not Available	658	Open in IMG/M
3300026557\|Ga0179587_10140685	All Organisms → cellular organisms → Bacteria → Proteobacteria	1497	Open in IMG/M
3300027535\|Ga0209734_1095267	All Organisms → cellular organisms → Bacteria → Proteobacteria	571	Open in IMG/M
3300027559\|Ga0209222_1038322	All Organisms → cellular organisms → Bacteria	923	Open in IMG/M
3300027645\|Ga0209117_1061833	All Organisms → cellular organisms → Bacteria	1084	Open in IMG/M
3300027678\|Ga0209011_1020321	All Organisms → cellular organisms → Bacteria	2156	Open in IMG/M
3300027698\|Ga0209446_1010220	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2301	Open in IMG/M
3300027812\|Ga0209656_10180162	All Organisms → cellular organisms → Bacteria	1037	Open in IMG/M
3300027812\|Ga0209656_10337316	Not Available	688	Open in IMG/M
3300027824\|Ga0209040_10369776	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	675	Open in IMG/M
3300027875\|Ga0209283_10407947	All Organisms → cellular organisms → Bacteria	885	Open in IMG/M
3300027903\|Ga0209488_10295718	All Organisms → cellular organisms → Bacteria	1209	Open in IMG/M
3300029944\|Ga0311352_10970270	All Organisms → cellular organisms → Bacteria	655	Open in IMG/M
3300029990\|Ga0311336_10401171	All Organisms → cellular organisms → Bacteria	1150	Open in IMG/M
3300030618\|Ga0311354_11719747	Not Available	547	Open in IMG/M
3300031028\|Ga0302180_10525016	Not Available	578	Open in IMG/M
3300031234\|Ga0302325_12322206	Not Available	647	Open in IMG/M
3300031236\|Ga0302324_100390463	All Organisms → cellular organisms → Bacteria	2081	Open in IMG/M
3300031236\|Ga0302324_102528144	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300031241\|Ga0265325_10396183	Not Available	605	Open in IMG/M
3300031242\|Ga0265329_10179427	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300031708\|Ga0310686_107651609	All Organisms → cellular organisms → Bacteria	950	Open in IMG/M
3300031708\|Ga0310686_109719202	All Organisms → cellular organisms → Bacteria	1680	Open in IMG/M
3300031718\|Ga0307474_11669199	Not Available	500	Open in IMG/M
3300031726\|Ga0302321_100231521	All Organisms → cellular organisms → Bacteria	1947	Open in IMG/M
3300031910\|Ga0306923_12015818	Not Available	585	Open in IMG/M
3300031962\|Ga0307479_11300064	All Organisms → cellular organisms → Bacteria → Acidobacteria	688	Open in IMG/M
3300032160\|Ga0311301_11739957	Not Available	747	Open in IMG/M
3300032180\|Ga0307471_100571129	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1287	Open in IMG/M
3300032805\|Ga0335078_10536495	Not Available	1493	Open in IMG/M
3300032828\|Ga0335080_11911632	Not Available	577	Open in IMG/M
3300032829\|Ga0335070_10327489	All Organisms → cellular organisms → Bacteria → Proteobacteria	1479	Open in IMG/M
3300032892\|Ga0335081_10667973	All Organisms → cellular organisms → Bacteria	1267	Open in IMG/M
3300032892\|Ga0335081_11124763	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300033158\|Ga0335077_11544397	Not Available	634	Open in IMG/M
3300033289\|Ga0310914_11672247	Not Available	540	Open in IMG/M
3300033412\|Ga0310810_10000287	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	52595	Open in IMG/M
3300033417\|Ga0214471_11123165	Not Available	601	Open in IMG/M
3300034125\|Ga0370484_0007101	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfohalobiaceae → Desulfohalobium → Desulfohalobium retbaense	2300	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	95.00%
Host-Associated	Host-Associated	5.00%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	72.50%
Aquatic	Environmental → Aquatic	22.50%
Plants	Host-Associated → Plants	5.00%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	65.83%
Freshwater	Environmental → Aquatic → Freshwater	18.33%
Peat	Environmental → Terrestrial → Peat	6.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.17%
Thermal Springs	Environmental → Aquatic → Thermal Springs	2.50%
Sediment	Environmental → Aquatic → Sediment	1.67%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	43.33%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	18.33%
Loam	Environmental → Terrestrial → Soil → Loam	11.67%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	10.83%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	6.67%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	2.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.67%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.67%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	30.83%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	10.83%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.33%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	8.33%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.50%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	6.67%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	6.67%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.17%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.33%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	2.50%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.67%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.83%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	14.17%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	6.67%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	6.67%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	5.00%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	5.00%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	5.00%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.17%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	3.33%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	3.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.33%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.33%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	3.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.33%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.33%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	2.50%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.50%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.50%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.67%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.67%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.67%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.83%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.83%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.83%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.83%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.83%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.83%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.83%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000567	Peat soil microbial communities from Weissenstadt, Germany - SII-2010	Environmental	Open in IMG/M
3300001546	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1	Environmental	Open in IMG/M
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009029	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009547	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40	Environmental	Open in IMG/M
3300009624	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10	Environmental	Open in IMG/M
3300009631	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100	Environmental	Open in IMG/M
3300009632	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40	Environmental	Open in IMG/M
3300009633	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10	Environmental	Open in IMG/M
3300009636	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150	Environmental	Open in IMG/M
3300009764	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300014156	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG	Environmental	Open in IMG/M
3300014158	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG	Environmental	Open in IMG/M
3300014159	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014839	Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015193	Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)	Environmental	Open in IMG/M
3300015195	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)	Environmental	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300017931	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100	Environmental	Open in IMG/M
3300017946	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10	Environmental	Open in IMG/M
3300017948	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10	Environmental	Open in IMG/M
3300018012	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5	Environmental	Open in IMG/M
3300018042	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300022532	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027535	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)	Environmental	Open in IMG/M
3300027559	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)	Environmental	Open in IMG/M
3300027645	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)	Environmental	Open in IMG/M
3300027678	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)	Environmental	Open in IMG/M
3300027698	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027812	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027824	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300029944	II_Palsa_E1 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030618	II_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300031028	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2	Environmental	Open in IMG/M
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental	Open in IMG/M
3300031236	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1	Environmental	Open in IMG/M
3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Host-Associated	Open in IMG/M
3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Host-Associated	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300033158	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033417	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155	Environmental	Open in IMG/M
3300034125	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F073900

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12270J11330_102197851	3300000567	Peatlands Soil	ETRMQVDAFLKEHEIHDYTATDFEQDREALRQLRMRETQP*
JGI12659J15293_101229781	3300001546	Forest Soil	FETRMQVDAFLKEHEVYDLTVADFEQDRETLRQLRAREAQL*
JGI12635J15846_101060712	3300001593	Forest Soil	MQVDAFSKEHEVYDFTAADFEQDRETLRQLRAREAQR*
JGI12635J15846_101794801	3300001593	Forest Soil	VDAFLKEHEVYDFTAADFEQDRETLRQVRAREAQL*
Ga0066672_100472875	3300005167	Soil	TRMQVDAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH*
Ga0070735_106850361	3300005534	Surface Soil	MQVDVFLKEHEVYDFTEADFEQDRETLRQLRGEDA*
Ga0070730_100171335	3300005537	Surface Soil	MQVDALLKEHEIFDYSAADFKQDLETLRELRMREVRP*
Ga0066697_105262662	3300005540	Soil	MQVDAFLKEHEIFDYSAADFEQDRETLWELRAREAQH*
Ga0070733_104576781	3300005541	Surface Soil	MSMQVDAFLKEHEILDFSAADFEQDRETLRELRMREARP*
Ga0070733_104970053	3300005541	Surface Soil	MAGHVLTARMQLDAFLKEHEVYDFTAADFEQDRDTPCQLRKRDAQH*
Ga0070732_103462492	3300005542	Surface Soil	MQVEAFLKEHEIYDYSVADFEQDRETLRNLRTSEA*
Ga0070732_107204682	3300005542	Surface Soil	MQVDVFLKEHEVYDFTMADFEQDRETLRGLRTREAQH*
Ga0070761_101515062	3300005591	Soil	LVFETQMQVDAFLKEHEIFDYSADDFEQDRETLRELRMRELRP*
Ga0066903_1070035131	3300005764	Tropical Forest Soil	MQVDAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH*
Ga0075017_1000278851	3300006059	Watersheds	QVDEFLKEHEVYDFTAADFEQDRQTLREFRIGQSRR*
Ga0075017_1007233262	3300006059	Watersheds	RMQVDAFLKEHEVFDFTAADFEQDRETLRQLRVREARL*
Ga0070716_1013291342	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MQVDAFLKEHEIFDYSAADFEQDRETLRELRMREARP*
Ga0070716_1018245391	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MQVDAFLKEHEIFDYSAADFEKDRETLRGIRMREGRP*
Ga0070712_1006222592	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	DTGMQVDAFLKEHEICDYSIGDFEQDRATLREIRMQEPRL*
Ga0066653_105300113	3300006791	Soil	MQVDAFLEEHEIFDYSAADFEQDRETLWELRAREAQH*
Ga0066665_104606181	3300006796	Soil	DAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH*
Ga0073928_100978822	3300006893	Iron-Sulfur Acid Spring	MQVDAFLKEHEFYDFTAADFEQDRETLRQLRARNSVKT*
Ga0066710_1006407784	3300009012	Grasslands Soil	MQVDAFLKEHEIFDYSAADFEQDRETLWELRAREAQH
Ga0066793_104750431	3300009029	Prmafrost Soil	MQVDAFLKEHEIYDYSVADFEQDRETLRELRMREARP*
Ga0099829_103823752	3300009038	Vadose Zone Soil	FETRMQVDAFLREHEVYDFTAADFEQDEETLRQLRAREAQV*
Ga0099829_111097071	3300009038	Vadose Zone Soil	MQVDAFLKEHDVYDFTAADFEQDRETLRQLRVREAQR*
Ga0099828_102104301	3300009089	Vadose Zone Soil	MQVDAFLKEHEIFDYSAADFEQDRETLRELRMREGSA*
Ga0099828_107933141	3300009089	Vadose Zone Soil	MQVDALLKEHEIFDYSAADFEQDRETLREHRMRKALP*
Ga0105243_114085782	3300009148	Miscanthus Rhizosphere	MQVDTFLKEHEVYDFTAADFEQDRETLRQLRMRVPQL*
Ga0075423_130748021	3300009162	Populus Rhizosphere	RMQVDAFLKEHEVFDFTATDFERDRETLRQLRAR*
Ga0116136_10433932	3300009547	Peatland	MQADAFLKEHEVYDFAAADFEQDCETLRQVRMREA*
Ga0116105_11886621	3300009624	Peatland	QLDAFLKEHEVYDFSAADFEQDRETLCHLRKRDAQH*
Ga0116115_10677411	3300009631	Peatland	MQTDAFLKEHEVYDFTVADFKQDCETLRQVRMREA*
Ga0116102_10645962	3300009632	Peatland	MQVGAFLKEHEIFDYSAADFEQDRETLQEIRMREARP*
Ga0116129_10025861	3300009633	Peatland	MQVDAFLKEHEVYDLTVADFEQDRETLRQLRAGEAQL*
Ga0116129_12196351	3300009633	Peatland	LQVEAFLKEHEVYEFTAADFKQDRETLRQLRVREAQN*
Ga0116112_11243181	3300009636	Peatland	QVDAFLKEHEVYDLTVADFEQDRETLRQLRAREAQL*
Ga0116134_10577501	3300009764	Peatland	MQVDAFLKEHEVYDFTAADFEQDRETLRKLRARKAKR*
Ga0126373_109706911	3300010048	Tropical Forest Soil	RMQVDAFLKEHEVYDFTAADFEHDRETLRELRTREAQH*
Ga0126372_118612252	3300010360	Tropical Forest Soil	VDAFLKEHEVYDFTAADFEHDRETLRELRTREAQH*
Ga0126378_102367401	3300010361	Tropical Forest Soil	ETRMQVDAFLKEHEIYDFTAADFEQDRETLRQLRSE*
Ga0126381_1002431041	3300010376	Tropical Forest Soil	MQVDAFLKEHEVYDFTVADFEQDRETLRQLRAGEAQH*
Ga0136449_1004416332	3300010379	Peatlands Soil	MEVDAFLKEHEVFDYSAADFELDRETLRDLRMREARP*
Ga0136449_1032293981	3300010379	Peatlands Soil	RLLVFETRMQVDAFLKEHEVYDFTVEDFKQDCETLRQISGKGTQH*
Ga0150983_137179671	3300011120	Forest Soil	VDAFLKEHEIFDYSTADFEQDCETLRELRMREARP*
Ga0137392_105391482	3300011269	Vadose Zone Soil	MEVDAFLKEHEIFEYSAADFEQDRETLREHRMRKALP*
Ga0137391_109086782	3300011270	Vadose Zone Soil	STPFLKEHEIFDYSAADFEQDRETLREHRMRKALP*
Ga0137393_104499181	3300011271	Vadose Zone Soil	DAFLKEHEIFDYSAADFEQDRETLRELRMREVRP*
Ga0137389_111678162	3300012096	Vadose Zone Soil	DDFLKEHDIFDYSASEFEQDRETLRELRMREVRP*
Ga0137388_109980991	3300012189	Vadose Zone Soil	MQVDAFLKEHEVFDYSAADFEQDRETLRELRMREARP*
Ga0137362_103379464	3300012205	Vadose Zone Soil	ETRMQVVAFLKEHEVYDFTASDFEQDRETLRQLRVREARL*
Ga0137380_117367042	3300012206	Vadose Zone Soil	PAPAFETRMQVDAFSKEHEVYDFTAADFEQDRETLRQLRAREAQR*
Ga0137381_111928852	3300012207	Vadose Zone Soil	GFETRMQVDAFLKEHEVYDFTAADFEQDRETLRQVRVREARL*
Ga0137413_100351261	3300012924	Vadose Zone Soil	MQVDALLKEHEIFDYSAADFELDRETLRELRMREARP*
Ga0181518_100969973	3300014156	Bog	FETRMQVDDFLKEHEVYDFIVEDFKQDCETLRQLRTREA*
Ga0181521_101431341	3300014158	Bog	MQLDAFLKEHEVYDFTAADFEQDRETLCQLRKRDAQH*
Ga0181530_101510931	3300014159	Bog	RMQVDAFLKEHEVYDFTAADFEQDRETLRQLRVREVRL*
Ga0181530_103248622	3300014159	Bog	MQVDAFLREHEIFDYSAADFERDRETLRQFRVREAQH*
Ga0182024_114839231	3300014501	Permafrost	DAFLKEHEIFDYSAADFEQDRETLRELRMRELRP*
Ga0182027_110190253	3300014839	Fen	MQVDAFLKEHEIYDYTAADFEQDRETLRQLRMGQARP*
Ga0157379_118013793	3300014968	Switchgrass Rhizosphere	LAFETRMQVDAFLKEHEVYDFTAADFEQDRETLRQLRVKDGQR*
Ga0167668_10247503	3300015193	Glacier Forefield Soil	MQVDAFLKEHEIYDYSVADFEQDRKTLRKIRMRETQR*
Ga0167658_100005040	3300015195	Glacier Forefield Soil	MQVDGFLKDHEIYDSSVEDFEQDRETLRRLRMKDAQP*
Ga0137403_107976281	3300015264	Vadose Zone Soil	MQVDAFLKEHEIYDYSVADFEQDRETLRKLRMRETQR*
Ga0187877_12337523	3300017931	Peatland	ANAGGRAFLKEHEVYDLTVADFEQDRETLRQLRAREAQL
Ga0187879_100168594	3300017946	Peatland	MQTDAFLKEHEVYDFTVADFKQDCETLRQVRMREA
Ga0187847_100167621	3300017948	Peatland	DFLKEHEVYDFTVEDFKQDCETLRQVRARELSPGA
Ga0187847_103081371	3300017948	Peatland	VDGFLKEHEVYDFTVADFGQDCETLRQVRTREAQS
Ga0187810_101343252	3300018012	Freshwater Sediment	ETQMQVDAFLKEHEICDYSADDFEQDRETLRELRMRELRP
Ga0187871_101477782	3300018042	Peatland	MQVEEFLAQHEVFGFTAADFERDRETLRQLRASEPLR
Ga0187766_113774611	3300018058	Tropical Peatland	QVDAFLKEHEVYDFTAADFEQDRETLRQLRLREAQQ
Ga0187784_102254424	3300018062	Tropical Peatland	GFETRMQVDAFLKQHEICDYTAVDFERDRETLRQIPKR
Ga0187769_108416611	3300018086	Tropical Peatland	MQVDAFLTEREVYDFTAADLEQDRETLGQLRPKQGQLRR
Ga0193751_11152063	3300019888	Soil	ETRMQVDTFLKEHEVFDFTAADFEQDRETLRQLRATEPQR
Ga0210403_108710212	3300020580	Soil	RMQVDAFLKEHEVYDLTVADFEQDRETLRQLRAREAQL
Ga0210401_108066252	3300020583	Soil	RMQVDAFLKEHEVYDFTAVDFEQDRETLCQLRKRDVQH
Ga0210401_109017911	3300020583	Soil	ADSFLKEHEAYDFTAADFERDRETLRQLRARELQH
Ga0242655_102696992	3300022532	Soil	VFGTRMQVDAFLKEHEIFDYSAADFEQDRETLRGIRMREARP
Ga0212123_101364894	3300022557	Iron-Sulfur Acid Spring	MQVDAFLKEHEFYDFTAADFEQDRETLRQLRARNSVKT
Ga0212123_105726202	3300022557	Iron-Sulfur Acid Spring	TRIQVDAFLKEHEIFDYSAADFEQDRETLRELRMREARP
Ga0207685_101233673	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	QVDAFLKEHEVYDFTADDFEQDRETLRQLRVKEAQL
Ga0207698_116437231	3300026142	Corn Rhizosphere	RMQVDAFLKEHEVFDFTMTDFEQDRETLRQLRAREAQR
Ga0179587_101406852	3300026557	Vadose Zone Soil	MQVDALLKEHEIFDYSAADFELDRETLRELRMREARP
Ga0209734_10952672	3300027535	Forest Soil	AFGTRMQVDAFSKEHEVYDFTAADFEQDRETLRQLRAREAQR
Ga0209222_10383221	3300027559	Forest Soil	LAFETRTQIDAFLKEHEIFDYSASDFEQDRETLRQLRVKEAQH
Ga0209117_10618331	3300027645	Forest Soil	FETRMQVDAFLKEHEVYDFTAADFEQDRETLRQLRVREARL
Ga0209011_10203212	3300027678	Forest Soil	MQVDAFSKEHEVYDFTAADFEQDRETLRQLRAREAQR
Ga0209446_10102204	3300027698	Bog Forest Soil	MQVDAFLKEHEIFDYSAADFEQDRETLWELRMSEAQP
Ga0209656_101801623	3300027812	Bog Forest Soil	RMQVDAFLKEHEVFDFTVEDFERDRETLRQLRLRVT
Ga0209656_103373162	3300027812	Bog Forest Soil	FETRMQVDAFLKEHEIFDYSAADFEQDRETLRELRMREAQP
Ga0209040_103697762	3300027824	Bog Forest Soil	RMQVDAFLKEHEIFDYSAADFEKDRETLRGIRMREARP
Ga0209283_104079471	3300027875	Vadose Zone Soil	AFETRMQVDAFLKEHEIFDYSAADFEQDRETLRELRMREGSA
Ga0209488_102957181	3300027903	Vadose Zone Soil	RMQVDALLKEHEIFDYSAADFEQDRETLRELRMREARP
Ga0311352_109702701	3300029944	Palsa	GFETRMQVDSFLKEHEVYDFTAANFERDRETLRQLRASEGQR
Ga0311336_104011711	3300029990	Fen	FETRMQVDAFLKEHEVYDFTAADFEQDRETLRQLRATEAQI
Ga0311354_117197471	3300030618	Palsa	ETHMQADAFLKEHEVYEFTMEDFKQDCETLRQVRAREA
Ga0302180_105250161	3300031028	Palsa	MQVDAFLKEHEVFDYSAADFEQDRETLRELRMREARS
Ga0302325_123222061	3300031234	Palsa	VDAFLKEHEVYDFSAADFEQDRETLCHLRKRDAQH
Ga0302324_1003904634	3300031236	Palsa	AFETRMHVDAFLKEHEIFDYSAADFERDRETLRELRMREARP
Ga0302324_1025281441	3300031236	Palsa	FETRMQVDAFLKEHEIFDYTAADFEQDRETLRQLRMREAQP
Ga0265325_103961831	3300031241	Rhizosphere	RLLLGFETRMQMEDFLSKHEVFEFTAADFEQDRETLRQFRANEER
Ga0265329_101794271	3300031242	Rhizosphere	LLGFETRMQMEDFLSKHEVFEFTAADFEQDRETLRQFRANEER
Ga0310686_1076516094	3300031708	Soil	MEVDAFLKEHQIFDYSAADFEQDRETLRGIRMTEARP
Ga0310686_1097192023	3300031708	Soil	MQLDAFLKQHEVFDYSAADFEQDRETLRELRMREARP
Ga0307474_116691993	3300031718	Hardwood Forest Soil	MQVDAFLKEHEIFDYSAADFEQDRETLRELRMREARP
Ga0302321_1002315211	3300031726	Fen	TRMQVDAFLKEHEVYDFTAADFEQDRETLRQLRATEAQI
Ga0306923_120158182	3300031910	Soil	MQMDAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH
Ga0307479_113000641	3300031962	Hardwood Forest Soil	MEVDAFLKEHEIFDYSAPDFEQDRETLRDLRMRELRP
Ga0311301_117399572	3300032160	Peatlands Soil	MEVDAFLKEHEVFDYSAADFELDRETLRDLRMREARP
Ga0307471_1005711292	3300032180	Hardwood Forest Soil	MQVDAFLKEQEIYDYSVEDFEQDRETLRELRMREARR
Ga0335078_105364954	3300032805	Soil	RMQVDAFLKEHEVYDFTAVDFEQDRETLRQLRAREAQH
Ga0335080_119116321	3300032828	Soil	ETRMQVDDFLKEHEVYDLTVADFKQDCKTLRQVRMRET
Ga0335070_103274893	3300032829	Soil	MQVEAFLKEHDVYDFTAAGFEPGRVRLRQLRAREAQS
Ga0335081_106679732	3300032892	Soil	MQLDAFLKEHEIYDYTAADFEQDRETLRQVRMREAQT
Ga0335081_111247631	3300032892	Soil	TRMQCDAFLKEHEIFDYSVADFEQDRETLRDLRSRDARP
Ga0335077_115443971	3300033158	Soil	QLDAFLKEHEIYDYTAADFEQDRETLRQVRMREAQT
Ga0310914_116722471	3300033289	Soil	LGFQTSMQMDAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH
Ga0310810_100002874	3300033412	Soil	MQVDAFLKEHEVYDFTAADFEQDCETLRQLPMKEAQH
Ga0214471_111231652	3300033417	Soil	MQVDAFLKEHEVYDFKAADFEQDRETLRQLRAREAQR
Ga0370484_0007101_54_167	3300034125	Untreated Peat Soil	MQVDAFLKEHEVYDFTAADFEQDRETLRQLRATEAQI

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign