Basic Information | |
---|---|
Family ID | F073848 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 42 residues |
Representative Sequence | MFRTPFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 46.67 % |
% of genes near scaffold ends (potentially truncated) | 38.33 % |
% of genes from short scaffolds (< 2000 bps) | 85.83 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (55.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (26.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 75.61% β-sheet: 0.00% Coil/Unstructured: 24.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF01244 | Peptidase_M19 | 29.17 |
PF04909 | Amidohydro_2 | 16.67 |
PF03401 | TctC | 4.17 |
PF01925 | TauE | 4.17 |
PF02627 | CMD | 3.33 |
PF00903 | Glyoxalase | 1.67 |
PF00067 | p450 | 1.67 |
PF02586 | SRAP | 1.67 |
PF13202 | EF-hand_5 | 1.67 |
PF01068 | DNA_ligase_A_M | 1.67 |
PF00873 | ACR_tran | 0.83 |
PF00392 | GntR | 0.83 |
PF04977 | DivIC | 0.83 |
PF00583 | Acetyltransf_1 | 0.83 |
PF00400 | WD40 | 0.83 |
PF13628 | DUF4142 | 0.83 |
PF01738 | DLH | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 29.17 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 4.17 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 4.17 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 3.33 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 3.33 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.67 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.67 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.67 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.67 |
COG2919 | Cell division protein FtsB | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
COG4839 | Cell division protein FtsL | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.00 % |
Unclassified | root | N/A | 45.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459003|FZN2CUW02HYPW5 | Not Available | 502 | Open in IMG/M |
2170459010|GIO7OMY02HLXFC | Not Available | 509 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2149220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 711 | Open in IMG/M |
3300001661|JGI12053J15887_10002413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9166 | Open in IMG/M |
3300001661|JGI12053J15887_10056405 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
3300001661|JGI12053J15887_10328299 | Not Available | 743 | Open in IMG/M |
3300001661|JGI12053J15887_10460462 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300002568|C688J35102_118203818 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300004156|Ga0062589_101183660 | Not Available | 730 | Open in IMG/M |
3300005162|Ga0066814_10032490 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300005164|Ga0066815_10053552 | Not Available | 672 | Open in IMG/M |
3300005185|Ga0066811_1017579 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300005354|Ga0070675_100069574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2916 | Open in IMG/M |
3300005354|Ga0070675_100184790 | Not Available | 1803 | Open in IMG/M |
3300005434|Ga0070709_10725948 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300005455|Ga0070663_100307091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1272 | Open in IMG/M |
3300005459|Ga0068867_100177013 | Not Available | 1693 | Open in IMG/M |
3300005543|Ga0070672_100396261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1183 | Open in IMG/M |
3300005578|Ga0068854_100830013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 808 | Open in IMG/M |
3300006038|Ga0075365_10045219 | All Organisms → cellular organisms → Bacteria | 2887 | Open in IMG/M |
3300006038|Ga0075365_11155876 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006042|Ga0075368_10379391 | Not Available | 618 | Open in IMG/M |
3300006048|Ga0075363_100274812 | Not Available | 974 | Open in IMG/M |
3300006048|Ga0075363_100706672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | 609 | Open in IMG/M |
3300006175|Ga0070712_100616134 | Not Available | 920 | Open in IMG/M |
3300006178|Ga0075367_10062722 | Not Available | 2221 | Open in IMG/M |
3300006353|Ga0075370_10402874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 821 | Open in IMG/M |
3300006358|Ga0068871_100914828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 814 | Open in IMG/M |
3300006573|Ga0074055_11743699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1954 | Open in IMG/M |
3300006854|Ga0075425_101342343 | Not Available | 810 | Open in IMG/M |
3300009143|Ga0099792_11234423 | Not Available | 508 | Open in IMG/M |
3300009148|Ga0105243_10868817 | Not Available | 895 | Open in IMG/M |
3300009156|Ga0111538_12180443 | Not Available | 696 | Open in IMG/M |
3300009840|Ga0126313_10250656 | Not Available | 1373 | Open in IMG/M |
3300010147|Ga0126319_1466505 | Not Available | 771 | Open in IMG/M |
3300010371|Ga0134125_11728767 | Not Available | 680 | Open in IMG/M |
3300010375|Ga0105239_12409277 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300012212|Ga0150985_111139814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4543 | Open in IMG/M |
3300012469|Ga0150984_117022143 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300012469|Ga0150984_117224416 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300012469|Ga0150984_117359190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBSH29 | 2159 | Open in IMG/M |
3300012469|Ga0150984_122905207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 930 | Open in IMG/M |
3300012924|Ga0137413_11107860 | Not Available | 627 | Open in IMG/M |
3300012924|Ga0137413_11159503 | Not Available | 614 | Open in IMG/M |
3300012941|Ga0162652_100003593 | Not Available | 1574 | Open in IMG/M |
3300012985|Ga0164308_11177785 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300013297|Ga0157378_11690657 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300014968|Ga0157379_12134640 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300014969|Ga0157376_11656670 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300015242|Ga0137412_10706144 | Not Available | 750 | Open in IMG/M |
3300015242|Ga0137412_10789887 | Not Available | 698 | Open in IMG/M |
3300015372|Ga0132256_102648641 | Not Available | 601 | Open in IMG/M |
3300017792|Ga0163161_11179703 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300017997|Ga0184610_1175658 | Not Available | 710 | Open in IMG/M |
3300018028|Ga0184608_10006673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3781 | Open in IMG/M |
3300018066|Ga0184617_1003154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2710 | Open in IMG/M |
3300018071|Ga0184618_10198923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 837 | Open in IMG/M |
3300018073|Ga0184624_10108279 | Not Available | 1194 | Open in IMG/M |
3300018081|Ga0184625_10245579 | Not Available | 938 | Open in IMG/M |
3300018083|Ga0184628_10286783 | Not Available | 865 | Open in IMG/M |
3300018476|Ga0190274_11216965 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300018476|Ga0190274_11420084 | Not Available | 784 | Open in IMG/M |
3300019269|Ga0184644_1120861 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300019269|Ga0184644_1721105 | Not Available | 609 | Open in IMG/M |
3300019889|Ga0193743_1213713 | Not Available | 599 | Open in IMG/M |
3300020016|Ga0193696_1060382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 995 | Open in IMG/M |
3300021078|Ga0210381_10012221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2113 | Open in IMG/M |
3300021082|Ga0210380_10200182 | Not Available | 902 | Open in IMG/M |
3300021344|Ga0193719_10342268 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300022915|Ga0247790_10199747 | Not Available | 531 | Open in IMG/M |
3300025899|Ga0207642_10012043 | Not Available | 3109 | Open in IMG/M |
3300025899|Ga0207642_10198155 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300025900|Ga0207710_10006666 | All Organisms → cellular organisms → Bacteria | 4922 | Open in IMG/M |
3300025918|Ga0207662_10031156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3098 | Open in IMG/M |
3300025925|Ga0207650_10684921 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300025925|Ga0207650_11573462 | Not Available | 558 | Open in IMG/M |
3300025932|Ga0207690_10347951 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300025937|Ga0207669_10234829 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
3300026075|Ga0207708_10015260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5760 | Open in IMG/M |
3300027388|Ga0208995_1026546 | Not Available | 1009 | Open in IMG/M |
3300027480|Ga0208993_1016940 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
3300027480|Ga0208993_1018725 | Not Available | 1212 | Open in IMG/M |
3300027616|Ga0209106_1016417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1587 | Open in IMG/M |
3300027681|Ga0208991_1079672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 986 | Open in IMG/M |
3300027681|Ga0208991_1185587 | Not Available | 607 | Open in IMG/M |
3300027738|Ga0208989_10176752 | Not Available | 712 | Open in IMG/M |
3300028379|Ga0268266_11417132 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300028381|Ga0268264_10046768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3595 | Open in IMG/M |
3300028708|Ga0307295_10089078 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300028710|Ga0307322_10111068 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300028714|Ga0307309_10023671 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300028718|Ga0307307_10144268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 741 | Open in IMG/M |
3300028754|Ga0307297_10086662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1014 | Open in IMG/M |
3300028754|Ga0307297_10114933 | Not Available | 896 | Open in IMG/M |
3300028755|Ga0307316_10026202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1885 | Open in IMG/M |
3300028771|Ga0307320_10173961 | Not Available | 838 | Open in IMG/M |
3300028771|Ga0307320_10253067 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300028784|Ga0307282_10662847 | Not Available | 506 | Open in IMG/M |
3300028787|Ga0307323_10097758 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300028787|Ga0307323_10099565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1042 | Open in IMG/M |
3300028790|Ga0307283_10052422 | Not Available | 976 | Open in IMG/M |
3300028791|Ga0307290_10184622 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300028793|Ga0307299_10026025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2113 | Open in IMG/M |
3300028796|Ga0307287_10322335 | Not Available | 583 | Open in IMG/M |
3300028802|Ga0307503_10431360 | Not Available | 695 | Open in IMG/M |
3300028810|Ga0307294_10229781 | Not Available | 651 | Open in IMG/M |
3300028814|Ga0307302_10667111 | Not Available | 517 | Open in IMG/M |
3300028819|Ga0307296_10726879 | Not Available | 542 | Open in IMG/M |
3300028828|Ga0307312_10431198 | Not Available | 867 | Open in IMG/M |
3300028828|Ga0307312_10997405 | Not Available | 554 | Open in IMG/M |
3300028889|Ga0247827_10052968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1865 | Open in IMG/M |
3300031092|Ga0308204_10043571 | Not Available | 1060 | Open in IMG/M |
3300031093|Ga0308197_10487264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | 502 | Open in IMG/M |
3300031099|Ga0308181_1120657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium hereditatis | 587 | Open in IMG/M |
3300031421|Ga0308194_10251681 | Not Available | 593 | Open in IMG/M |
3300031720|Ga0307469_10848041 | Not Available | 842 | Open in IMG/M |
3300031847|Ga0310907_10143868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1087 | Open in IMG/M |
3300032180|Ga0307471_102693731 | Not Available | 631 | Open in IMG/M |
3300033550|Ga0247829_10117524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 2028 | Open in IMG/M |
3300033550|Ga0247829_10274999 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 26.67% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.17% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.83% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 5.83% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.17% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.33% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.50% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.67% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.83% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.83% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005185 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPB | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E4A_11004110 | 2170459003 | Grass Soil | MSRPPHVSGTSFRHVASDVLHDLITAILVAVAALTASGLLDRIWDAL |
F62_03842000 | 2170459010 | Grass Soil | MDMFPGASRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL |
ICChiseqgaiiDRAFT_21492201 | 3300000033 | Soil | MEMFPGPFRHLASEVLSDLVTAVLVALAAVIASRLLDRIWDAL* |
JGI12053J15887_100024131 | 3300001661 | Forest Soil | MFLGPFRHLASDVMSDLVIAVLVALAAVIASGLVDRIWDTL* |
JGI12053J15887_100564055 | 3300001661 | Forest Soil | MEMFPGPFRHLASDVVNDLVTAFLVALAAVIASSLLDRIWDAL* |
JGI12053J15887_103282992 | 3300001661 | Forest Soil | MEMFPGPFRHLASDVVNDLVTAFLVALAAVIASGLLDRIWDAL* |
JGI12053J15887_104604623 | 3300001661 | Forest Soil | PSRHFASDVMSDLVIAVLVALAAVIASGLLDRIWDVL* |
C688J35102_1182038182 | 3300002568 | Soil | MVRPPMFRTPFRHVASDVLHDLLTAFLVAMAALTASGLLDRIWDAL* |
Ga0062589_1011836601 | 3300004156 | Soil | MFRTPFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL* |
Ga0066814_100324902 | 3300005162 | Soil | MLRIPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0066815_100535521 | 3300005164 | Soil | MFRTPFCHVASDVLHDLITAFLVAVAALTASGLLDRIWDA |
Ga0066811_10175791 | 3300005185 | Soil | MFRIPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0070675_1000695743 | 3300005354 | Miscanthus Rhizosphere | GMVRPPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0070675_1001847902 | 3300005354 | Miscanthus Rhizosphere | MVRPPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0070709_107259482 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0070663_1003070912 | 3300005455 | Corn Rhizosphere | MSRPPMFPTPFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL* |
Ga0068867_1001770131 | 3300005459 | Miscanthus Rhizosphere | MSRPPMFRTRFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0070672_1003962612 | 3300005543 | Miscanthus Rhizosphere | MSRPPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0068854_1008300131 | 3300005578 | Corn Rhizosphere | HVADSMLHDLITAILVAIAAVIASGLLDRIWDAL* |
Ga0075365_100452194 | 3300006038 | Populus Endosphere | MSLRPMFRTPFRHVASDVLHDLITAVLVAVAAVIASGLLDRIWDAL* |
Ga0075365_111558763 | 3300006038 | Populus Endosphere | TPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0075368_103793912 | 3300006042 | Populus Endosphere | MARPPMFRTPFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL* |
Ga0075363_1002748122 | 3300006048 | Populus Endosphere | MFLGPFRHLASDVMSDLVIAILVALAAVIASGLLDRIWDVL* |
Ga0075363_1007066722 | 3300006048 | Populus Endosphere | MVRPPIFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0070712_1006161341 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIW |
Ga0075367_100627222 | 3300006178 | Populus Endosphere | MFRTPFRHVASDVLHDLITAFLVAVAAIIASGLLNRIWDAL* |
Ga0075370_104028742 | 3300006353 | Populus Endosphere | MARPPMFRTPFRHVASDVLHDLITAFLVAVAAIIASGLLNRIWDAL* |
Ga0068871_1009148281 | 3300006358 | Miscanthus Rhizosphere | PPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0074055_117436992 | 3300006573 | Soil | MSRPPMFRTPFRHVASDVLHDLITAFLVAVAVLTASGLLDRIWDAL* |
Ga0075425_1013423432 | 3300006854 | Populus Rhizosphere | MVRPPMFRTPFRHVASDVLHDLITAFLVAVAAIIASGLLNRIWDAL* |
Ga0099792_112344231 | 3300009143 | Vadose Zone Soil | MDMFPGSSRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL* |
Ga0105243_108688172 | 3300009148 | Miscanthus Rhizosphere | MFRTPFRHVASDVLHDLITAFLVAVAALTVSGLLDRIWDAL* |
Ga0111538_121804432 | 3300009156 | Populus Rhizosphere | MFRTPCRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0126313_102506562 | 3300009840 | Serpentine Soil | MFRTPFRHVASDVLHDLLTAFLVAMAALTASGLLDRIWDAL* |
Ga0126319_14665051 | 3300010147 | Soil | MDMFPGPSRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL* |
Ga0134125_117287672 | 3300010371 | Terrestrial Soil | MFPTPFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL* |
Ga0105239_124092772 | 3300010375 | Corn Rhizosphere | FRTPFRHVASDVLHDLITAFLVAVAAIIASGLLNRIWDAL* |
Ga0150985_1111398148 | 3300012212 | Avena Fatua Rhizosphere | MTNRHVASDVLHDLITSILVAITAVIASGLLDRVWEAL* |
Ga0150984_1170221432 | 3300012469 | Avena Fatua Rhizosphere | MFRTPFRHVASDVLHDLLTAFLVAVGALTASGLLDRIWDAL* |
Ga0150984_1172244162 | 3300012469 | Avena Fatua Rhizosphere | PFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL* |
Ga0150984_1173591904 | 3300012469 | Avena Fatua Rhizosphere | WRHTASDVLHDLITSILVAITAVIASGLLDRVWDAL* |
Ga0150984_1229052072 | 3300012469 | Avena Fatua Rhizosphere | MSALRHTASDVLHDLIIAFLVAIAAVTTSGLLDRVWEAL* |
Ga0137413_111078602 | 3300012924 | Vadose Zone Soil | SRHFASDVMSDLVIAVLVALAAVIASGLLDRIWDVL* |
Ga0137413_111595031 | 3300012924 | Vadose Zone Soil | MDMFPGASRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL* |
Ga0162652_1000035931 | 3300012941 | Soil | MFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDA |
Ga0164308_111777851 | 3300012985 | Soil | PFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL* |
Ga0157378_116906571 | 3300013297 | Miscanthus Rhizosphere | PMFRTPFRHVASDVLHDLITAFLVSVVAVISYGLINRIWDAL* |
Ga0157379_121346402 | 3300014968 | Switchgrass Rhizosphere | FRHVASDVLHDLITAFLVAVAAIIASGLLNRIWDAL* |
Ga0157376_116566701 | 3300014969 | Miscanthus Rhizosphere | MVRPPMFRTPFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL* |
Ga0137412_107061441 | 3300015242 | Vadose Zone Soil | MELFPGPFRHLASEVLSDLVTAVLVALAAVIASRLLDRIWDAL* |
Ga0137412_107898872 | 3300015242 | Vadose Zone Soil | MDRFTGPSRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL* |
Ga0132256_1026486411 | 3300015372 | Arabidopsis Rhizosphere | MFRTPFRHVASDVLHDLITAFLVAVAALTASRLLDRIWDAL* |
Ga0163161_111797031 | 3300017792 | Switchgrass Rhizosphere | PFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL |
Ga0184610_11756582 | 3300017997 | Groundwater Sediment | MDMFPGPSRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL |
Ga0184608_100066734 | 3300018028 | Groundwater Sediment | MEMFPGPFRHLASEVLSDLVTAVLVALAAVIASRLLDRIWDAL |
Ga0184617_10031543 | 3300018066 | Groundwater Sediment | MDMFPSRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL |
Ga0184618_101989231 | 3300018071 | Groundwater Sediment | MDMFPGPSRHFASDVMNDLVIAVLVALAAVIASGLLDRLWDAL |
Ga0184624_101082792 | 3300018073 | Groundwater Sediment | MVRPPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAR |
Ga0184625_102455792 | 3300018081 | Groundwater Sediment | MTRPPMFRTPFRHVASDVLHDLITAVLVAVAALTASGLLDRIWDAL |
Ga0184628_102867832 | 3300018083 | Groundwater Sediment | MFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDR |
Ga0190274_112169652 | 3300018476 | Soil | MFRTTFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0190274_114200841 | 3300018476 | Soil | MFRTPCRHVASDVLHDLITAFLVAVAALTASGLLDRIW |
Ga0184644_11208611 | 3300019269 | Groundwater Sediment | WFMEMFPGPFRHLASEVLSDLVTAVLVALAAVIASRLLDRIWDAL |
Ga0184644_17211051 | 3300019269 | Groundwater Sediment | MSLRPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0193743_12137131 | 3300019889 | Soil | MSRPPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0193696_10603822 | 3300020016 | Soil | FMDMFPSRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL |
Ga0210381_100122211 | 3300021078 | Groundwater Sediment | MEMFPGPFRHLASEVLSDLVTAVLVALAAVIATRLLDRIWDAL |
Ga0210380_102001821 | 3300021082 | Groundwater Sediment | MSLRPMFRTPFRHVASDVLHDLITAFLVAVAALTAPGLLDRIWDAL |
Ga0193719_103422681 | 3300021344 | Soil | RPRFMDMFPGPSRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL |
Ga0247790_101997471 | 3300022915 | Soil | MSRPPMFPTPFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL |
Ga0207642_100120432 | 3300025899 | Miscanthus Rhizosphere | MFRIPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0207642_101981551 | 3300025899 | Miscanthus Rhizosphere | TPFRHVARDVLHDLITAFLVAVAALIASGLLDRIWDAL |
Ga0207710_100066667 | 3300025900 | Switchgrass Rhizosphere | MFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWD |
Ga0207662_100311563 | 3300025918 | Switchgrass Rhizosphere | SGMSRPPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0207650_106849212 | 3300025925 | Switchgrass Rhizosphere | PMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0207650_115734622 | 3300025925 | Switchgrass Rhizosphere | MVRPPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0207690_103479511 | 3300025932 | Corn Rhizosphere | MFRTPFRHVASDVLHDLITAFLVAVAAIIASGLLNRIWDAL |
Ga0207669_102348292 | 3300025937 | Miscanthus Rhizosphere | FRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0207708_100152601 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRPPMFRTPFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL |
Ga0208995_10265462 | 3300027388 | Forest Soil | MEMFPGPFRHLASDVVNDLVTAFLVALAAVIASGLLDRIWDAL |
Ga0208993_10169402 | 3300027480 | Forest Soil | MDMFPGPSRQFASDVMSDLVIAVLVALAAVIASGLLDRIWDVL |
Ga0208993_10187253 | 3300027480 | Forest Soil | MLMFLGPFRHLASDVMSDLVIAVLVALAAVIASGLVDRIWDTL |
Ga0209106_10164172 | 3300027616 | Forest Soil | MEMFPGPFRHLASDVVNDLVTAFLVALAAVIASSLLDRIWDAL |
Ga0208991_10796721 | 3300027681 | Forest Soil | MFLGPFRHLASDVMSDLVIAVLVALAAVIASGLVDRIWDTL |
Ga0208991_11855871 | 3300027681 | Forest Soil | MHMFLVPFRHLAGDVVSDLVTAVLVALAAVIASGLLDRIWDAL |
Ga0208989_101767522 | 3300027738 | Forest Soil | MHMFLGPFRHLAGDVVSDLVTAVLVALAAVIASGLLDRIWDAL |
Ga0268266_114171321 | 3300028379 | Switchgrass Rhizosphere | PIRHVASDVLHDLITAFLVAVAAIIASGLLNRIWDAL |
Ga0268264_100467682 | 3300028381 | Switchgrass Rhizosphere | MFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0307295_100890782 | 3300028708 | Soil | MFRTPFRHVASDVLHDLITAFLVAVGALTASGLLDRIWDAL |
Ga0307322_101110682 | 3300028710 | Soil | FRHLASEVLSDLVTAVLVALAAVIASRLLDRIWDAL |
Ga0307309_100236712 | 3300028714 | Soil | MFRTPFRHVASDVLHDLLTAFLVAMAALTASGLLDRIWDAL |
Ga0307307_101442681 | 3300028718 | Soil | MEMFPGPFRHLASEVLSDLVTAVLVALAAVIATRLLDR |
Ga0307297_100866621 | 3300028754 | Soil | RFMDMFPSRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL |
Ga0307297_101149332 | 3300028754 | Soil | MFRTPCRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0307316_100262022 | 3300028755 | Soil | MDMFPGASRHFASDVMNDLVIAVLVALAAVIASGLLDRVWDAL |
Ga0307320_101739611 | 3300028771 | Soil | FRHLASDVMSDLVIAVLVALAAVIASGLLDRILDVL |
Ga0307320_102530671 | 3300028771 | Soil | MFRTPFRHVASDVLHDLITAFLVAVAALTAPGLLDRIWDAL |
Ga0307282_106628471 | 3300028784 | Soil | HIFPGPFRHLTGDVVSDLVIAVLVALAAVIASGLLDRIWDAL |
Ga0307323_100977582 | 3300028787 | Soil | EGWFMEMFPGPFRHLASEVLSDLVTAVLVALAAVIASRLLDRIWDAL |
Ga0307323_100995651 | 3300028787 | Soil | MEMFPGPFRHLASEVLSDLVTAVLVALAAVIASRLLD |
Ga0307283_100524222 | 3300028790 | Soil | MFRTPFRHVASDVLHDLITAFLVAVAALTASGLLD |
Ga0307290_101846223 | 3300028791 | Soil | WFVDLFMFLGPFRHLASDVMSDLVIAVLVALAAVIASGLLDRIWDVL |
Ga0307299_100260252 | 3300028793 | Soil | MDMFPGPSRHFASDVMDDLVIAVLVALAAVIASGLLDRIWDAL |
Ga0307287_103223351 | 3300028796 | Soil | MEMFPGPFRHLASEVLSDLVTAVLVALAAVIASRL |
Ga0307503_104313601 | 3300028802 | Soil | MTRPPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0307294_102297812 | 3300028810 | Soil | MDMFPGPSRHFASNVMNDLVIAVLVALAAVIASGLLDRIWDAL |
Ga0307302_106671112 | 3300028814 | Soil | MEMFPRPFRHLASEVLSDLVTAVLVALAAVIASRLLDRIWDAL |
Ga0307296_107268792 | 3300028819 | Soil | SSRHLARDVLNDLVTAVLVSLSAVIASELLERISDGLWGRS |
Ga0307312_104311981 | 3300028828 | Soil | MFRTPFRHVASDVLHDLITAFLVAVGALTASGLLDRIWD |
Ga0307312_109974051 | 3300028828 | Soil | RPWFMDMFPGPSRHFASDVMNDLVIAVLVALAAVIASGLLDRIWDAL |
Ga0247827_100529681 | 3300028889 | Soil | SRPPMFRTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0308204_100435711 | 3300031092 | Soil | MEMFPRPFRHLASDVVNDLVTAFLVALAAIIASGLLNRIWWDAL |
Ga0308197_104872642 | 3300031093 | Soil | MSLRPMFRTPFRHVASDVLHDLITAFLVAVATLTASGLLDRIWDAL |
Ga0308181_11206572 | 3300031099 | Soil | MDMFPGPSRHFASDVMSDLVIAVLVVLAAVIASGLLDRIWDVL |
Ga0308194_102516811 | 3300031421 | Soil | MDMFPGPSRHFASDVMNDLAIAVLVALAAVIASGLLDRIWDAL |
Ga0307469_108480412 | 3300031720 | Hardwood Forest Soil | MFRTPFRHVASDVLHDLITAFLVAVAALTASSLLDRIWDAL |
Ga0310907_101438682 | 3300031847 | Soil | MFRTPFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAL |
Ga0307471_1026937311 | 3300032180 | Hardwood Forest Soil | MFRTSCRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0247829_101175241 | 3300033550 | Soil | RTPFRHVASDVLHDLITAFLVAVAALTASGLLDRIWDAL |
Ga0247829_102749991 | 3300033550 | Soil | MFRTPFRHVASDVLHDLITAFLVAVAALIASGLLDRIWDAV |
⦗Top⦘ |