| Basic Information | |
|---|---|
| Family ID | F073841 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 43 residues |
| Representative Sequence | NGGGVAFFAHVGGFVFGVIVALLLTNAGRVAPQDRSGALRAPA |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.67 % |
| % of genes near scaffold ends (potentially truncated) | 98.33 % |
| % of genes from short scaffolds (< 2000 bps) | 92.50 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF04972 | BON | 16.67 |
| PF01594 | AI-2E_transport | 8.33 |
| PF03706 | LPG_synthase_TM | 8.33 |
| PF00196 | GerE | 5.83 |
| PF10646 | Germane | 4.17 |
| PF01694 | Rhomboid | 2.50 |
| PF07730 | HisKA_3 | 2.50 |
| PF10009 | DUF2252 | 2.50 |
| PF13462 | Thioredoxin_4 | 1.67 |
| PF06803 | DUF1232 | 1.67 |
| PF07731 | Cu-oxidase_2 | 1.67 |
| PF03729 | DUF308 | 1.67 |
| PF06210 | DUF1003 | 1.67 |
| PF14241 | Obsolete Pfam Family | 0.83 |
| PF12713 | DUF3806 | 0.83 |
| PF00437 | T2SSE | 0.83 |
| PF06293 | Kdo | 0.83 |
| PF01061 | ABC2_membrane | 0.83 |
| PF13396 | PLDc_N | 0.83 |
| PF05173 | DapB_C | 0.83 |
| PF04261 | Dyp_perox | 0.83 |
| PF02163 | Peptidase_M50 | 0.83 |
| PF00174 | Oxidored_molyb | 0.83 |
| PF00903 | Glyoxalase | 0.83 |
| PF00456 | Transketolase_N | 0.83 |
| PF00582 | Usp | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 8.33 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 8.33 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 2.50 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 2.50 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 2.50 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 2.50 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 2.50 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 1.67 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 1.67 |
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 1.67 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 1.67 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.83 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.83 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.83 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.83 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.83 |
| COG0289 | 4-hydroxy-tetrahydrodipicolinate reductase | Amino acid transport and metabolism [E] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.50 % |
| Unclassified | root | N/A | 32.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0813425 | Not Available | 1374 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105375189 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1071 | Open in IMG/M |
| 3300000550|F24TB_10747978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300000789|JGI1027J11758_11851216 | Not Available | 518 | Open in IMG/M |
| 3300000956|JGI10216J12902_101794457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1042 | Open in IMG/M |
| 3300000956|JGI10216J12902_103664610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300000956|JGI10216J12902_112876203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 710 | Open in IMG/M |
| 3300000956|JGI10216J12902_116469392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1174 | Open in IMG/M |
| 3300000956|JGI10216J12902_116812855 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300001431|F14TB_100048806 | Not Available | 1044 | Open in IMG/M |
| 3300002074|JGI24748J21848_1059075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300004479|Ga0062595_101718619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300004643|Ga0062591_102948171 | Not Available | 505 | Open in IMG/M |
| 3300005161|Ga0066807_1003092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1330 | Open in IMG/M |
| 3300005164|Ga0066815_10090731 | Not Available | 562 | Open in IMG/M |
| 3300005332|Ga0066388_105832714 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005334|Ga0068869_100710086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300005338|Ga0068868_100662600 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300005338|Ga0068868_101608189 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005435|Ga0070714_101800934 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005447|Ga0066689_10550412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300005454|Ga0066687_10388623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300005471|Ga0070698_102155027 | Not Available | 511 | Open in IMG/M |
| 3300005529|Ga0070741_11188562 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005536|Ga0070697_100701728 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005536|Ga0070697_101928823 | Not Available | 529 | Open in IMG/M |
| 3300005563|Ga0068855_100191914 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300005564|Ga0070664_101591487 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005764|Ga0066903_100610663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1893 | Open in IMG/M |
| 3300005764|Ga0066903_105326263 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 680 | Open in IMG/M |
| 3300005764|Ga0066903_107707355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 554 | Open in IMG/M |
| 3300005844|Ga0068862_100743403 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300005983|Ga0081540_1104177 | Not Available | 1215 | Open in IMG/M |
| 3300006028|Ga0070717_10385235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1258 | Open in IMG/M |
| 3300006058|Ga0075432_10534496 | Not Available | 527 | Open in IMG/M |
| 3300006175|Ga0070712_101013849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300006175|Ga0070712_101630165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300006755|Ga0079222_10925563 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006796|Ga0066665_11324087 | Not Available | 554 | Open in IMG/M |
| 3300006844|Ga0075428_101754427 | Not Available | 647 | Open in IMG/M |
| 3300006852|Ga0075433_10158956 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300006871|Ga0075434_101783026 | Not Available | 622 | Open in IMG/M |
| 3300006881|Ga0068865_101061271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300006914|Ga0075436_101320225 | Not Available | 546 | Open in IMG/M |
| 3300009137|Ga0066709_100059285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4399 | Open in IMG/M |
| 3300009147|Ga0114129_13324576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300009176|Ga0105242_11563003 | Not Available | 692 | Open in IMG/M |
| 3300009553|Ga0105249_10012176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7574 | Open in IMG/M |
| 3300010326|Ga0134065_10056414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1223 | Open in IMG/M |
| 3300010366|Ga0126379_10695544 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300010371|Ga0134125_10345675 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300010373|Ga0134128_11210009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 833 | Open in IMG/M |
| 3300010399|Ga0134127_11066148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 871 | Open in IMG/M |
| 3300010403|Ga0134123_10427676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1223 | Open in IMG/M |
| 3300011269|Ga0137392_10529506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 979 | Open in IMG/M |
| 3300012200|Ga0137382_10589403 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012201|Ga0137365_10905350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300012209|Ga0137379_10589926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1018 | Open in IMG/M |
| 3300012211|Ga0137377_11816932 | Not Available | 529 | Open in IMG/M |
| 3300012349|Ga0137387_11076476 | Not Available | 574 | Open in IMG/M |
| 3300012354|Ga0137366_10560429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 822 | Open in IMG/M |
| 3300012356|Ga0137371_10304346 | Not Available | 1241 | Open in IMG/M |
| 3300012357|Ga0137384_11606579 | Not Available | 500 | Open in IMG/M |
| 3300012930|Ga0137407_10091004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2593 | Open in IMG/M |
| 3300012971|Ga0126369_13695654 | Not Available | 501 | Open in IMG/M |
| 3300012984|Ga0164309_10807546 | Not Available | 756 | Open in IMG/M |
| 3300012986|Ga0164304_11308286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300012986|Ga0164304_11508084 | Not Available | 556 | Open in IMG/M |
| 3300012987|Ga0164307_10763179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 765 | Open in IMG/M |
| 3300012988|Ga0164306_11355112 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012988|Ga0164306_11438678 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
| 3300012989|Ga0164305_10099842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1860 | Open in IMG/M |
| 3300012989|Ga0164305_11566631 | Not Available | 587 | Open in IMG/M |
| 3300012989|Ga0164305_12060654 | Not Available | 522 | Open in IMG/M |
| 3300013102|Ga0157371_10833742 | Not Available | 696 | Open in IMG/M |
| 3300013296|Ga0157374_11273674 | Not Available | 757 | Open in IMG/M |
| 3300013297|Ga0157378_11710462 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300014745|Ga0157377_11118295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300015200|Ga0173480_10658659 | Not Available | 651 | Open in IMG/M |
| 3300017959|Ga0187779_10180732 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1312 | Open in IMG/M |
| 3300017966|Ga0187776_10677280 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 727 | Open in IMG/M |
| 3300018027|Ga0184605_10468070 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300018058|Ga0187766_10583074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 762 | Open in IMG/M |
| 3300018071|Ga0184618_10004588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3778 | Open in IMG/M |
| 3300018075|Ga0184632_10242404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planotetraspora → Planotetraspora thailandica | 789 | Open in IMG/M |
| 3300019361|Ga0173482_10132143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 949 | Open in IMG/M |
| 3300019361|Ga0173482_10372516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300020018|Ga0193721_1129269 | Not Available | 628 | Open in IMG/M |
| 3300020022|Ga0193733_1079054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 923 | Open in IMG/M |
| 3300021377|Ga0213874_10427992 | Not Available | 519 | Open in IMG/M |
| 3300021968|Ga0193698_1020745 | Not Available | 858 | Open in IMG/M |
| 3300024186|Ga0247688_1006188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1677 | Open in IMG/M |
| 3300025906|Ga0207699_10471325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 903 | Open in IMG/M |
| 3300025923|Ga0207681_11630462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300025931|Ga0207644_10453376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1054 | Open in IMG/M |
| 3300025931|Ga0207644_11210145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300025932|Ga0207690_10099687 | Not Available | 2072 | Open in IMG/M |
| 3300025935|Ga0207709_11519339 | Not Available | 556 | Open in IMG/M |
| 3300025937|Ga0207669_10780391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 791 | Open in IMG/M |
| 3300026118|Ga0207675_100327082 | Not Available | 1498 | Open in IMG/M |
| 3300026894|Ga0207980_1015350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300027874|Ga0209465_10434133 | Not Available | 657 | Open in IMG/M |
| 3300028710|Ga0307322_10004130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3064 | Open in IMG/M |
| 3300028717|Ga0307298_10033518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1372 | Open in IMG/M |
| 3300028793|Ga0307299_10178360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
| 3300028796|Ga0307287_10059040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1420 | Open in IMG/M |
| 3300028811|Ga0307292_10522345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300028819|Ga0307296_10301259 | Not Available | 874 | Open in IMG/M |
| 3300028885|Ga0307304_10288531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300031231|Ga0170824_121220925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
| 3300031720|Ga0307469_11655129 | Not Available | 616 | Open in IMG/M |
| 3300031740|Ga0307468_100728044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 834 | Open in IMG/M |
| 3300031782|Ga0318552_10440407 | Not Available | 665 | Open in IMG/M |
| 3300032025|Ga0318507_10331956 | Not Available | 662 | Open in IMG/M |
| 3300032770|Ga0335085_12184446 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300032782|Ga0335082_11602388 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300032954|Ga0335083_10929224 | Not Available | 689 | Open in IMG/M |
| 3300033158|Ga0335077_10136959 | Not Available | 2826 | Open in IMG/M |
| 3300033475|Ga0310811_10783508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
| 3300034817|Ga0373948_0071554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 778 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.17% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026894 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_08134254 | 2228664021 | Soil | NGGGVAFFAHIGGFVFGVVVARVLSNLGQVAPQDGSAALRAPA |
| INPhiseqgaiiFebDRAFT_1053751892 | 3300000364 | Soil | AFFAHVGGFVFGALVAWVLVGAGRVSPQGVSPAFPSG* |
| F24TB_107479781 | 3300000550 | Soil | NGGGVAFFAHVGGFVFGVIVALLLTNAGRVAPQDRSGALRAPA* |
| JGI1027J11758_118512161 | 3300000789 | Soil | VAFFAHIGGFVFGVVVARVLSNLGQVAPQDGSAALRAPA* |
| JGI10216J12902_1017944574 | 3300000956 | Soil | AFFAHVGGFVFGVIVALLLTNAGRVTPQDRSGTLSAPA* |
| JGI10216J12902_1036646102 | 3300000956 | Soil | GGVAFFAHVGGFVFGVAVAVLLTSAGRVAPQSGTALRPA* |
| JGI10216J12902_1128762031 | 3300000956 | Soil | GGVAFFAHVGGFVFGVLVALVLTKSGRVAPQDRSAVLGAPRLAS* |
| JGI10216J12902_1164693921 | 3300000956 | Soil | VGGFVFGVLVALLLTNSGRVTPQDRSVALRAPAY* |
| JGI10216J12902_1168128555 | 3300000956 | Soil | NGGGVAFFAHVGGFVFGVLAALLLTNTGLVAPQDRSSPLRAPA* |
| F14TB_1000488063 | 3300001431 | Soil | AHVGGFVFGVIVALLLTNAGRVAPQDRSAALRAPA* |
| JGI24748J21848_10590752 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | KANGGGVAFFAHVGGFLFGVAVAFLLSNLGRVTAQDEGQALRVPA* |
| Ga0062595_1017186192 | 3300004479 | Soil | GGTAFFAHVGGFVFGALVTLVLTNVGRVVPQDDTALRAPA* |
| Ga0062591_1029481712 | 3300004643 | Soil | GSAANGGGVAFFAHVGGFLFGVIVTLLLTHAGRVAPQDRSRALGAPA* |
| Ga0066807_10030922 | 3300005161 | Soil | MLGASANGDGTAFFAHVGGFVFGALVALLLASAGRVAPQDGTALRAPA* |
| Ga0066815_100907311 | 3300005164 | Soil | GGVAFFAHVGGFLFGALVAWLVTGAGLVAPQDRSGALRAPA* |
| Ga0066388_1058327141 | 3300005332 | Tropical Forest Soil | NGGGVAFFAHVGGFLFGVLVALLLAGVGRVTSDTGGSAPAGAAA* |
| Ga0068869_1007100863 | 3300005334 | Miscanthus Rhizosphere | ANGGGVAFFAHVGGFVFGVLAARVLSTLGQVAPQDGSAALRAPA* |
| Ga0068868_1006626001 | 3300005338 | Miscanthus Rhizosphere | GVAFFAHVGGFVFGALVAWLLKTAGRVAPQGGSPPPLRAPA* |
| Ga0068868_1016081891 | 3300005338 | Miscanthus Rhizosphere | GGTAFFAHVGGFVFGALVALVLANAGRVAPQESTALRAPA* |
| Ga0070714_1018009341 | 3300005435 | Agricultural Soil | NGGGVAFFAHVGGFVFGAIVAWLLTGAGVVAPQDRSAALRTA* |
| Ga0066689_105504122 | 3300005447 | Soil | ANGGGVAFFAHVGGFIFGVSVALLLTSAGRVVPQGSSPLRAPA* |
| Ga0066687_103886231 | 3300005454 | Soil | FGATANGGGVAFFAHVGGFLFGAAVAQLLTSAGRVVPQGGIPARVPV* |
| Ga0070698_1021550271 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VAFFAHVGGFVFGALIAWLLAAAGRAGAEPEPAPLRAWG* |
| Ga0070741_111885622 | 3300005529 | Surface Soil | GLFSASANGGGVAFFAHVGGFLFGVLVTTALAARGRIAPQEAGLPALRAPAW* |
| Ga0070697_1007017282 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | FGASANGGGVAFFAHVGGFVFGVIVAVLLKSAGRVAPQDSAPLGAPA* |
| Ga0070697_1019288231 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LFGASANGGGVAFFAHVGGFVFGAIVALLLTSVGRVVPQDGSSALRAPA* |
| Ga0068855_1001919141 | 3300005563 | Corn Rhizosphere | ANGGGVAFFAHVGGFVFGAIVAWLLTGAGLVAPQDRSTAARAPAY* |
| Ga0070664_1015914871 | 3300005564 | Corn Rhizosphere | GGVAFFAHVGGFVFGAIVAWLLTGAGVVAPQDRSAALRTA* |
| Ga0066903_1006106633 | 3300005764 | Tropical Forest Soil | VAFFAHVGGFVFGVIVTLFLGRTGWIDAQDRSTPLPAPGLIAR* |
| Ga0066903_1053262631 | 3300005764 | Tropical Forest Soil | GGVAFFAHVGGFVFGVLVARLLLGSGRIVLGRDRPVGVPV* |
| Ga0066903_1077073553 | 3300005764 | Tropical Forest Soil | ANGGGVAFFAHVGGFVFGVVVTLALTHAGRIAPNTGAAASPAPT* |
| Ga0068862_1007434033 | 3300005844 | Switchgrass Rhizosphere | FFAHVGGFVFGAIVAWLLTGAGLVAPQDRSTAARAPAY* |
| Ga0081540_11041774 | 3300005983 | Tabebuia Heterophylla Rhizosphere | AHVGGFVFGALVTLLLTKSGRVAPQDRSIAWGGAPA* |
| Ga0070717_103852354 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GLLGASANGGGTAFFAHVGGFVFGALVSLALASAGRVVPQDGAVLRAPA* |
| Ga0075432_105344962 | 3300006058 | Populus Rhizosphere | FFAHVGGFVFGAIVARVLVGVGQVAPQEGGTALRAPA* |
| Ga0070712_1010138491 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FFAHVGGFIFGVLVTLLLRGLGRISPQDLSTGAVGAPAY* |
| Ga0070712_1016301651 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FFAHVGGFIFGAIVAWTLVGVGLVVRPDGNPPLRTPAGAL* |
| Ga0079222_109255632 | 3300006755 | Agricultural Soil | GGGVAFFAHVGGFVFGALVAWLLKTAGRVAPQGGSPPPLRAPA* |
| Ga0066665_113240871 | 3300006796 | Soil | HVGGFVFGAIVAWLLTGAGLVAPQDRSAALRAPA* |
| Ga0075428_1017544273 | 3300006844 | Populus Rhizosphere | ANGGGVAFFAHVGGFVFGAILTLVLARAGQVAAPNGRASPAHA* |
| Ga0075433_101589561 | 3300006852 | Populus Rhizosphere | VAFFAHIGGFVFGAIVAWALMAAGRAAPQGGSPPLRAPA* |
| Ga0075434_1017830262 | 3300006871 | Populus Rhizosphere | ANGGGVAFFAHVGGFVFGVIVTLLLTRTGQIEKQDRSTALPAPV* |
| Ga0068865_1010612711 | 3300006881 | Miscanthus Rhizosphere | VGGFVFGAIVAWLLTGAGLVAPQDRSTAARAPAY* |
| Ga0075436_1013202251 | 3300006914 | Populus Rhizosphere | GVAFFAHVGGFVFGAIVAWLLTGTGLVAPQDRSAAARAPAY* |
| Ga0066709_1000592857 | 3300009137 | Grasslands Soil | FAHVGGFVLGFVVARILAGVGRVAPDDNGFPLRAPA* |
| Ga0114129_133245761 | 3300009147 | Populus Rhizosphere | SANGGGTAFFAHVGGFLFGVVVALVLAGAGRVAPQDSTALRAPA* |
| Ga0105242_115630031 | 3300009176 | Miscanthus Rhizosphere | GGGVAFFAHVGGFVFGAIVAWLLTGVGVVAPQDRSAALRPA* |
| Ga0105249_100121769 | 3300009553 | Switchgrass Rhizosphere | SNGGGTAFFAHVGGFVFGVLVAWLLLQSGRIAGQERSVPLGGPA* |
| Ga0134065_100564144 | 3300010326 | Grasslands Soil | IEPNVGLFGASANGGGVAFFVHVDGFLIGLIIALVLTRVGRVAPQDGGQPARVPA* |
| Ga0126379_106955441 | 3300010366 | Tropical Forest Soil | NGGGVAFFAHVGGFVFGVIVTLLLTNAGRISPQDRSQILGAPA* |
| Ga0134125_103456751 | 3300010371 | Terrestrial Soil | IFSSSANGGGVAFFAHVGGFVFGALVAWLLKTAGRVAPQGGSPPPLRAPA* |
| Ga0134128_112100092 | 3300010373 | Terrestrial Soil | GVFSSSANGGGVAFFAHVGGFIFGAIVAWTLVGVGLVVRPDGDPPLRTPAGAL* |
| Ga0134127_110661481 | 3300010399 | Terrestrial Soil | ANGGGTAFFAHVGGFVFGAVVALLLANAGRVAPQESTALRAPA* |
| Ga0134123_104276761 | 3300010403 | Terrestrial Soil | NFGLFGSAANGGGVAFFAHVGGFVFGVIVALLLTNAGRVAPQDRSGPLRAPA* |
| Ga0137392_105295061 | 3300011269 | Vadose Zone Soil | QLVEANFGLFGSTANGGGVAFFAHVGGFLFGVSVALLLTSIGRVAPQDTSPLRAPA* |
| Ga0137382_105894031 | 3300012200 | Vadose Zone Soil | GLFSSNANGGGVAFFAHVGGFIFGAIVATLLSSSGRIASDANTDTGAGLMRAPA* |
| Ga0137365_109053502 | 3300012201 | Vadose Zone Soil | ANGGGTAFFAHVGGFVFGALVALLLANAGRVAPQDGAPLRVSA* |
| Ga0137379_105899261 | 3300012209 | Vadose Zone Soil | NFGIFGSAANGGGVAFFAHVGGFVFGAIVAWLLTGAGLVAPQDRSTAARASAY* |
| Ga0137377_118169322 | 3300012211 | Vadose Zone Soil | FGATANGGGVAFFAHVGGFLFGVVVAQLLASAGRVAPQGDGSALRVPA* |
| Ga0137387_110764761 | 3300012349 | Vadose Zone Soil | HVGGFVFGAIVAWLLTGAGLVAPQDRSAALPAPA* |
| Ga0137366_105604292 | 3300012354 | Vadose Zone Soil | FAHVGGFIFGAIVAAVLTGAGRVAPQEGSAFLRAPA* |
| Ga0137371_103043461 | 3300012356 | Vadose Zone Soil | FFAHVGGFVFGAIVAWLLTGAGLVTPQDRSGVLRAPA* |
| Ga0137384_116065792 | 3300012357 | Vadose Zone Soil | VAFFAHVGGFVFGALVAWLLTGVGLVAPQDRSAALRAPA* |
| Ga0137407_100910041 | 3300012930 | Vadose Zone Soil | ANFGIFGSAANGGGVAFFAHVGGFVFGAIVAWLLTGAGLVTPQDRSAVLRAPA* |
| Ga0126369_136956541 | 3300012971 | Tropical Forest Soil | ANGGGVAFFAHVGGFVFGVIVTLLLTNAGRISPQDRSQILGAPA* |
| Ga0164309_108075461 | 3300012984 | Soil | FFAHVGGFVFGVIVAWLLTNTGRVTPQDRSAALGAPA* |
| Ga0164304_113082861 | 3300012986 | Soil | NGGGVAFFAHVGGFIFGVAVAAFLSSLGRVAPQDGGQALLRAST* |
| Ga0164304_115080841 | 3300012986 | Soil | ATSNGGGTAFFAHVGGFVFGVLVAWLLLQSGRIAGQERSVPLGGPA* |
| Ga0164307_107631792 | 3300012987 | Soil | FFAHVGGFVFGVVVARLLVQAGRVAGEERGVPLGGPA* |
| Ga0164306_113551122 | 3300012988 | Soil | AANGGGVAFFAHVGGFAFGYLVTRFLTDSGRVVPADVSLPLRAPA* |
| Ga0164306_114386782 | 3300012988 | Soil | NFGLFGSSANGGGVAFFAHVGGFVFGDFVAKLLTDAGRVTPQQNREPLGAFT* |
| Ga0164305_100998421 | 3300012989 | Soil | NGGGVAFFAHVGGFVFGAIVAWLLTGAGLVAPQDRSTAARAPAY* |
| Ga0164305_115666313 | 3300012989 | Soil | GVAFFAHVGGFVFGVIVAWLLTNTGRVTPQDRSAALGAPA* |
| Ga0164305_120606541 | 3300012989 | Soil | NGGGVAFFAHVGGFVFGVIVALVLTRTGQIAAQDRSAALPAPG* |
| Ga0157371_108337421 | 3300013102 | Corn Rhizosphere | TSNGGGTAFFAHVGGFVFGVLVAWLLVQSGRIAGQERSVPLGGPA* |
| Ga0157374_112736743 | 3300013296 | Miscanthus Rhizosphere | GVAFFAHVGGFVFGAIVAWLLTGVGVVAPQDRSAALRPA* |
| Ga0157378_117104622 | 3300013297 | Miscanthus Rhizosphere | AHVGGFVFGVLVAWVLVNAGRVVTSDTTALRAPA* |
| Ga0157377_111182953 | 3300014745 | Miscanthus Rhizosphere | AHVGGFVFGAIVAWLLTGAGVVAPQDRSTAARAPAY* |
| Ga0173480_106586593 | 3300015200 | Soil | FAHVGGFVFGVLVAIVLTNAGRVQPQDYGGTVLRAPA* |
| Ga0187779_101807321 | 3300017959 | Tropical Peatland | AFFAHVGGFVFGVIVTLLLKNARQVALKDRSGMLRAPA |
| Ga0187776_106772802 | 3300017966 | Tropical Peatland | FFAHVGGFVFGVAATLALLNARRITPQGEDALGAPA |
| Ga0184605_104680703 | 3300018027 | Groundwater Sediment | FGSAANGGGVAFFAHVGGFVFGVIVALLLTNAGRVAPQDRSGALGAPA |
| Ga0187766_105830743 | 3300018058 | Tropical Peatland | FFAHVGGFVFGVIVTLLLKNAGQVALQDRSGVLRAPA |
| Ga0184618_100045884 | 3300018071 | Groundwater Sediment | GGGVAFFAHVGGFVFGVSVAVLLTSVGRVVPQDSGPLRAPA |
| Ga0184632_102424041 | 3300018075 | Groundwater Sediment | ANGGGVAFFAHVGGFVFGVLVAWLLTRAGRVAANERAPEFGAPA |
| Ga0173482_101321433 | 3300019361 | Soil | AFFAHVGGFVFGVVVARLLTGAGWVAPQDRSAALRAPA |
| Ga0173482_103725161 | 3300019361 | Soil | NGGGVAFFAHVGGFIFGVVAALFLSSIGRVAPQGGGQPVRVSA |
| Ga0193721_11292692 | 3300020018 | Soil | GGVAFFAHVGGFVFGVIVALLLRNAGRLVPQDSGGALRAPA |
| Ga0193733_10790541 | 3300020022 | Soil | FSSSANGGGVAFFAHVGGFVFGAIVTWLLMGTRRISAQDMAALRAPT |
| Ga0213874_104279921 | 3300021377 | Plant Roots | VAFFAHVGGFIFGVIVALGLTRAGRVAPDTGAAAAPA |
| Ga0193698_10207452 | 3300021968 | Soil | NGGGVAFFAHVGGFIFGAAVAWALTSVGRVAPQSVAAGAGLRAPV |
| Ga0247688_10061884 | 3300024186 | Soil | FAHVGGFVFGALVSLALASAGRVVPQDGAVLRAPA |
| Ga0207699_104713251 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GGGVAFFAHVGGFIFGAIVAWILVGAGRVIRPDGNPPLRAPAGAL |
| Ga0207681_116304623 | 3300025923 | Switchgrass Rhizosphere | FAHVGGFVFGAIVAWLLTGAGLVDPQDRSTAARAPAY |
| Ga0207644_104533762 | 3300025931 | Switchgrass Rhizosphere | VAFFAHVGGFVFGAFVAKLLTDAGRVTPQQNREPLGAFT |
| Ga0207644_112101452 | 3300025931 | Switchgrass Rhizosphere | GGGTAFFAHVGGFVFGALVSLALASAGRVVPQDGAVLRAPA |
| Ga0207690_100996874 | 3300025932 | Corn Rhizosphere | AFFAHVGGFVFGAIVAWLLTGAGVVAPQDRSAALRTA |
| Ga0207709_115193392 | 3300025935 | Miscanthus Rhizosphere | GTAFFAHVGGFVFGVLVAWLLLQSGRIAGQERSVPLGGPA |
| Ga0207669_107803912 | 3300025937 | Miscanthus Rhizosphere | GGVAFFAHVGGFVFGAIVAWILVGAGRVVRPDGNPPLRAPAGAL |
| Ga0207675_1003270821 | 3300026118 | Switchgrass Rhizosphere | NFGLFGSAANGGGVAFFAHVGGFLFGVIVALLLTKAGRVAPQDRSATLGAPA |
| Ga0207980_10153502 | 3300026894 | Soil | MLGASANGDGTAFFAHVGGFVFGALVALLLASAGRVAPQDGTALRAPA |
| Ga0209465_104341333 | 3300027874 | Tropical Forest Soil | NGGGVAFFAHVGGFVFGVIVALLLTSAGRIAPQDRSRTLGAPA |
| Ga0307322_100041301 | 3300028710 | Soil | AANGGGVAFFAHVGGFVFGAIVAWLLTGAGLVAPQDRSTAARAPAY |
| Ga0307298_100335181 | 3300028717 | Soil | ANGGGVAFFAHVGGFIFGAIVAWILVGAGRVIRPDGNPPLRAPAGAL |
| Ga0307299_101783602 | 3300028793 | Soil | NANGGGVAFFAHVGGFAFGAIVAWVLTDVGRIAPQGHTAGLRAPA |
| Ga0307287_100590404 | 3300028796 | Soil | NFGIFGSAANGGGVAFFAHVGGFVFGAIVAWLLTGAGLVAPQDRSTAARAPAY |
| Ga0307292_105223452 | 3300028811 | Soil | GASANGGGVAFFAHVGGFAFGAIVAWVLTDVGRIAPQGDTAGLRAPA |
| Ga0307296_103012592 | 3300028819 | Soil | ATANGGGVAFFAHVGGFLFGVVVAQLLANAGRVAPQGDGSALRVPA |
| Ga0307304_102885311 | 3300028885 | Soil | ANFGIFGSAANGGGVAFFAHVGGFVFGVIVALLLRNAGRLVPQDSGGALRAPA |
| Ga0170824_1212209251 | 3300031231 | Forest Soil | NGGGVAFFAHVGGFIFGVAVALLLTTAGRVGPQDRSGALGALA |
| Ga0307469_116551291 | 3300031720 | Hardwood Forest Soil | NAGLFSSTANGGGTAFFAHVGGFVFGVLIAWLLKQAGRVTPQEPAVPLGAPV |
| Ga0307468_1007280441 | 3300031740 | Hardwood Forest Soil | GTAFFAHVGGFVFGALAALLLASAGRVAPQDGTALRAPA |
| Ga0318552_104404071 | 3300031782 | Soil | YQLIEANFGLFGAAANGGGVAFFAHVGGFVFGVVVALALERGSSIGSQARGQPLHAPA |
| Ga0318507_103319561 | 3300032025 | Soil | LIEANFGLFGAAANGGGVAFFAHVGGFVFGVVVALALERGGSIGSQARGQPLHATA |
| Ga0335085_121844461 | 3300032770 | Soil | SSANGGGVAFFAHVGGFVFGVITTLALAGAGRISPTEDMGALRATA |
| Ga0335082_116023881 | 3300032782 | Soil | FGFFSSSANGGGGVAFFAHVGGFIFGVAVTMGLLNAGRVATRDDRALGATI |
| Ga0335083_109292243 | 3300032954 | Soil | GVAFFAHVGGFLFGLVVALALMNAGRVVPQDGSAAFGTT |
| Ga0335077_101369591 | 3300033158 | Soil | GGGVAFFAHVGGFLFGLLVALALLNAGRVVPQDGSAAFGAA |
| Ga0310811_107835081 | 3300033475 | Soil | ANGGGVAFFAHVGGFVFGAIVAWLLTGAGLVAPQDRSTAARVPAY |
| Ga0373948_0071554_2_118 | 3300034817 | Rhizosphere Soil | FFAHVGGFVFGALVAWLLKTAGRVAPQGGSPPPLRAPA |
| ⦗Top⦘ |