NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073809

Metagenome / Metatranscriptome Family F073809

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073809
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 36 residues
Representative Sequence MLAGAIAAVLLVFALFLSMLSSSPKDDAEWHPDTEA
Number of Associated Samples 87
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 88.24 %
% of genes near scaffold ends (potentially truncated) 10.00 %
% of genes from short scaffolds (< 2000 bps) 65.83 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.833 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(10.833 % of family members)
Environment Ontology (ENVO) Unclassified
(21.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 35.94%    β-sheet: 0.00%    Coil/Unstructured: 64.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF02163Peptidase_M50 16.67
PF11700ATG22 5.83
PF13620CarboxypepD_reg 5.00
PF04264YceI 5.00
PF07969Amidohydro_3 4.17
PF01734Patatin 3.33
PF00216Bac_DNA_binding 3.33
PF12697Abhydrolase_6 2.50
PF01628HrcA 1.67
PF03720UDPG_MGDP_dh_C 1.67
PF03721UDPG_MGDP_dh_N 1.67
PF00076RRM_1 1.67
PF13594Obsolete Pfam Family 1.67
PF01042Ribonuc_L-PSP 1.67
PF01431Peptidase_M13 1.67
PF13483Lactamase_B_3 1.67
PF00106adh_short 1.67
PF13468Glyoxalase_3 0.83
PF01011PQQ 0.83
PF01638HxlR 0.83
PF00037Fer4 0.83
PF02355SecD_SecF 0.83
PF13450NAD_binding_8 0.83
PF01613Flavin_Reduct 0.83
PF12838Fer4_7 0.83
PF07726AAA_3 0.83
PF07637PSD5 0.83
PF01988VIT1 0.83
PF13231PMT_2 0.83
PF02641DUF190 0.83
PF05685Uma2 0.83
PF03331LpxC 0.83
PF00378ECH_1 0.83
PF07724AAA_2 0.83
PF08502LeuA_dimer 0.83
PF00535Glycos_transf_2 0.83
PF12796Ank_2 0.83
PF11721Malectin 0.83
PF04542Sigma70_r2 0.83
PF02602HEM4 0.83
PF07859Abhydrolase_3 0.83
PF07626PSD3 0.83
PF05139Erythro_esteras 0.83
PF05016ParE_toxin 0.83
PF13432TPR_16 0.83
PF00072Response_reg 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 5.00
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 3.33
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 3.33
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 3.33
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 3.33
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.67
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 1.67
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.67
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 1.67
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 1.67
COG1420Transcriptional regulator of heat shock responseTranscription [K] 1.67
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 1.67
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.67
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.83
COG0119Isopropylmalate/homocitrate/citramalate synthasesAmino acid transport and metabolism [E] 0.83
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.83
COG2312Erythromycin esterase homologSecondary metabolites biosynthesis, transport and catabolism [Q] 0.83
COG1993PII-like signaling proteinSignal transduction mechanisms [T] 0.83
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.83
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.83
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.83
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.83
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.83
COG1587Uroporphyrinogen-III synthaseCoenzyme transport and metabolism [H] 0.83
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.83
COG0774UDP-3-O-acyl-N-acetylglucosamine deacetylaseCell wall/membrane/envelope biogenesis [M] 0.83
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.83
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.83
COG0342Preprotein translocase subunit SecDIntracellular trafficking, secretion, and vesicular transport [U] 0.83
COG0341Preprotein translocase subunit SecFIntracellular trafficking, secretion, and vesicular transport [U] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.83 %
UnclassifiedrootN/A14.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10296796All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1013Open in IMG/M
3300004152|Ga0062386_101639214Not Available536Open in IMG/M
3300005529|Ga0070741_10037153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6451Open in IMG/M
3300005529|Ga0070741_10377718All Organisms → cellular organisms → Bacteria → Acidobacteria1308Open in IMG/M
3300005531|Ga0070738_10001924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia36062Open in IMG/M
3300005533|Ga0070734_10186696Not Available1197Open in IMG/M
3300005538|Ga0070731_10264757All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1141Open in IMG/M
3300005538|Ga0070731_10468447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae838Open in IMG/M
3300005541|Ga0070733_10274303All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300005541|Ga0070733_10329532All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300005542|Ga0070732_10165088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1320Open in IMG/M
3300005591|Ga0070761_10555608All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005712|Ga0070764_10186370All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300006028|Ga0070717_10030405All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4339Open in IMG/M
3300006028|Ga0070717_10060736All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3131Open in IMG/M
3300006176|Ga0070765_100498023All Organisms → cellular organisms → Bacteria → Acidobacteria1145Open in IMG/M
3300006800|Ga0066660_11470883All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300006893|Ga0073928_10215261Not Available1493Open in IMG/M
3300007258|Ga0099793_10365339All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300009029|Ga0066793_10221158All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300009700|Ga0116217_10660105Not Available649Open in IMG/M
3300009839|Ga0116223_10471135Not Available733Open in IMG/M
3300010379|Ga0136449_100189279All Organisms → cellular organisms → Bacteria3940Open in IMG/M
3300010379|Ga0136449_100368459All Organisms → cellular organisms → Bacteria2569Open in IMG/M
3300010379|Ga0136449_101338760All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300010379|Ga0136449_101386921All Organisms → cellular organisms → Bacteria → Acidobacteria1086Open in IMG/M
3300011271|Ga0137393_10693741All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300012202|Ga0137363_10116462All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2055Open in IMG/M
3300012930|Ga0137407_10915556All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4829Open in IMG/M
3300014167|Ga0181528_10729451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium554Open in IMG/M
3300014168|Ga0181534_10643397All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300014169|Ga0181531_10229824Not Available1130Open in IMG/M
3300014201|Ga0181537_10702922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium687Open in IMG/M
3300014501|Ga0182024_10004534All Organisms → cellular organisms → Bacteria → Acidobacteria31871Open in IMG/M
3300014501|Ga0182024_10005337All Organisms → cellular organisms → Bacteria28896Open in IMG/M
3300014501|Ga0182024_10209262All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2656Open in IMG/M
3300014501|Ga0182024_10541300All Organisms → cellular organisms → Bacteria → Acidobacteria1471Open in IMG/M
3300014657|Ga0181522_10098977All Organisms → cellular organisms → Bacteria → Acidobacteria1682Open in IMG/M
3300015195|Ga0167658_1000779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales15421Open in IMG/M
3300017821|Ga0187812_1099416All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300017822|Ga0187802_10394906All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300017928|Ga0187806_1083081All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300017928|Ga0187806_1265945All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300017933|Ga0187801_10485611All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300017934|Ga0187803_10310709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium630Open in IMG/M
3300017948|Ga0187847_10222110All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1029Open in IMG/M
3300017955|Ga0187817_10211911Not Available1235Open in IMG/M
3300017961|Ga0187778_10025481All Organisms → cellular organisms → Bacteria3613Open in IMG/M
3300017961|Ga0187778_10538652All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300017970|Ga0187783_10067128All Organisms → cellular organisms → Bacteria2642Open in IMG/M
3300017970|Ga0187783_10646568All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300017975|Ga0187782_10063834All Organisms → cellular organisms → Bacteria2684Open in IMG/M
3300017975|Ga0187782_11283887All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium574Open in IMG/M
3300017988|Ga0181520_10161779All Organisms → cellular organisms → Bacteria → Acidobacteria1806Open in IMG/M
3300018007|Ga0187805_10260887All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300018008|Ga0187888_1000265All Organisms → cellular organisms → Bacteria56080Open in IMG/M
3300018017|Ga0187872_10333845All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300018044|Ga0187890_10430585Not Available740Open in IMG/M
3300018062|Ga0187784_11044761All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300018086|Ga0187769_10048349All Organisms → cellular organisms → Bacteria2947Open in IMG/M
3300018088|Ga0187771_10251478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1474Open in IMG/M
3300019284|Ga0187797_1311103Not Available570Open in IMG/M
3300019284|Ga0187797_1506372All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium702Open in IMG/M
3300020582|Ga0210395_10335994All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1136Open in IMG/M
3300021181|Ga0210388_10236546All Organisms → cellular organisms → Bacteria → Acidobacteria1602Open in IMG/M
3300021402|Ga0210385_10050058All Organisms → cellular organisms → Bacteria2784Open in IMG/M
3300021402|Ga0210385_10671732All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium792Open in IMG/M
3300021420|Ga0210394_10074571All Organisms → cellular organisms → Bacteria → Acidobacteria2936Open in IMG/M
3300021432|Ga0210384_10226235All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300021433|Ga0210391_11165547Not Available597Open in IMG/M
3300021474|Ga0210390_10057627All Organisms → cellular organisms → Bacteria3200Open in IMG/M
3300021477|Ga0210398_10226009All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300021477|Ga0210398_10237875All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300021560|Ga0126371_10081535All Organisms → cellular organisms → Bacteria → Acidobacteria3175Open in IMG/M
3300022518|Ga0224548_1024247All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300022555|Ga0212088_10006883All Organisms → cellular organisms → Bacteria19872Open in IMG/M
3300022721|Ga0242666_1134219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium596Open in IMG/M
3300022881|Ga0224545_1003359All Organisms → cellular organisms → Bacteria → Acidobacteria2781Open in IMG/M
3300026320|Ga0209131_1366142Not Available537Open in IMG/M
3300026551|Ga0209648_10000036All Organisms → cellular organisms → Bacteria → Acidobacteria76007Open in IMG/M
3300027855|Ga0209693_10023723All Organisms → cellular organisms → Bacteria2967Open in IMG/M
3300027869|Ga0209579_10381399All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli763Open in IMG/M
3300027889|Ga0209380_10643161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium612Open in IMG/M
3300027908|Ga0209006_10027701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5137Open in IMG/M
3300027908|Ga0209006_10675249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium847Open in IMG/M
3300028792|Ga0307504_10103807All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300028906|Ga0308309_10140672All Organisms → cellular organisms → Bacteria1930Open in IMG/M
3300029701|Ga0222748_1068188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium642Open in IMG/M
3300029943|Ga0311340_10037210All Organisms → cellular organisms → Bacteria5899Open in IMG/M
3300030007|Ga0311338_10121274All Organisms → cellular organisms → Bacteria → Acidobacteria3188Open in IMG/M
3300030007|Ga0311338_10822526All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae923Open in IMG/M
3300031234|Ga0302325_10129537All Organisms → cellular organisms → Bacteria4599Open in IMG/M
3300031234|Ga0302325_10735324All Organisms → cellular organisms → Bacteria1411Open in IMG/M
3300031234|Ga0302325_11254055Not Available980Open in IMG/M
3300031236|Ga0302324_100008845All Organisms → cellular organisms → Bacteria → Acidobacteria21173Open in IMG/M
3300031236|Ga0302324_100026360All Organisms → cellular organisms → Bacteria → Acidobacteria11111Open in IMG/M
3300031236|Ga0302324_100308407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2422Open in IMG/M
3300031236|Ga0302324_100834733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1277Open in IMG/M
3300031708|Ga0310686_110671070All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300031720|Ga0307469_11028420Not Available771Open in IMG/M
3300031823|Ga0307478_10525632All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300032160|Ga0311301_10000988All Organisms → cellular organisms → Bacteria108958Open in IMG/M
3300032160|Ga0311301_10245377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2965Open in IMG/M
3300032160|Ga0311301_12058347Not Available663Open in IMG/M
3300032515|Ga0348332_13529823All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300032782|Ga0335082_10026115All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6232Open in IMG/M
3300032805|Ga0335078_10037025All Organisms → cellular organisms → Bacteria7244Open in IMG/M
3300032805|Ga0335078_10158002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3198Open in IMG/M
3300032805|Ga0335078_10304119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2143Open in IMG/M
3300032805|Ga0335078_10936758All Organisms → cellular organisms → Bacteria → Acidobacteria1035Open in IMG/M
3300032805|Ga0335078_12095266Not Available601Open in IMG/M
3300032805|Ga0335078_12388260All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300032828|Ga0335080_10379716All Organisms → cellular organisms → Bacteria → Acidobacteria1520Open in IMG/M
3300032829|Ga0335070_10190825All Organisms → cellular organisms → Bacteria2047Open in IMG/M
3300032892|Ga0335081_10230572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2524Open in IMG/M
3300032892|Ga0335081_11375232All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300032895|Ga0335074_10004476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia19224Open in IMG/M
3300033134|Ga0335073_11863614Not Available558Open in IMG/M
3300033405|Ga0326727_10549893All Organisms → cellular organisms → Bacteria982Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil10.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.17%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil8.33%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.50%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland7.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.67%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.33%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost3.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.67%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.67%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.67%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.83%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.83%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.83%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.83%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.83%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.83%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022518Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24EnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1029679623300001593Forest SoilMLAVAIAGVLIVFALFLSMLSSSPKDDAEWNPDTEA*
Ga0062386_10163921423300004152Bog Forest SoilVGLSMLAAAIAGVLIVFALFLSMLSSSPKDDAEWKIDTEA*
Ga0070741_1003715323300005529Surface SoilMWAAAITAVLIVFALFLSMLSSAPKDDPEWNPDTEP*
Ga0070741_1037771823300005529Surface SoilMLIGAILAVLLIFGLFLSMLSSSPKSDAEWHPDTEA*
Ga0070738_10001924273300005531Surface SoilMLVGAIISGLLILGLFLSMLSSSPKPEQEKHFDTQL*
Ga0070734_1018669613300005533Surface SoilMLAGAIVVVLLILGMFLSMLSSSPKADSKWHPDTDA*
Ga0070731_1026475723300005538Surface SoilMLAVAIGAVLIVFALFLSMLSSSPKDDAEWKIDTEV*
Ga0070731_1046844723300005538Surface SoilMWAAAIAALFLVFALFLSMLSSAPKDDPEWNPDTDV*
Ga0070733_1027430313300005541Surface SoilMLAGAIAAILIVFALFLSMLSSSPKDDAEWNIDTET*
Ga0070733_1032953223300005541Surface SoilMLVGAIVSGLLIFGLFLSMLGSSPKAESEKHFDSQV*
Ga0070732_1016508823300005542Surface SoilMVASAIIGGLLVFGLFLSMLSSAPKGDAERHSDTEA*
Ga0070761_1055560823300005591SoilMLAVAIAGVFIVFALFLSMLSSSPKDDVEWNPDTEA*
Ga0070764_1018637023300005712SoilMLAGAIAAILLVFALFLSMLSSSPKDDAEWNPDTEA*
Ga0070717_1003040543300006028Corn, Switchgrass And Miscanthus RhizosphereMVASAIIGGLLVFGLFLSMLSSAPKGDGKWHSDTDA*
Ga0070717_1006073623300006028Corn, Switchgrass And Miscanthus RhizosphereMLAAAIAGALIVFALFLSMLSSSPKDDAEWNIDTEA*
Ga0070765_10049802323300006176SoilMLAGAIAAVLLVFALFLSMLSSSPKDDAEFNIDTEA*
Ga0066660_1147088323300006800SoilMLVGAIVSGLLIFGLFLSMLSSSPKSDSEKHLDTSGVKD*
Ga0073928_1021526123300006893Iron-Sulfur Acid SpringMLFVTIIAVLFIFGLFLSMLSSSPKPDAEWHIDTEA*
Ga0099793_1036533923300007258Vadose Zone SoilMMAGAIIAILLIFGLFLSMLSSSPKGEVEWHPDTDV*
Ga0066793_1022115823300009029Prmafrost SoilMLIAAAIAILIILGLFLSMLSSSPKTEREFHPDTEV*
Ga0116217_1066010523300009700Peatlands SoilMLAGAIAAVLLVFALFLSMLSSSPKDDAEWHPDTEA*
Ga0116223_1047113523300009839Peatlands SoilMLMGAILAVLLIFGLFLSMLSSSPKGDSEWHPDTEA*
Ga0136449_10018927933300010379Peatlands SoilMLAGAIIGVLLIFGLFLSMLSSSPPSDAELHSDTDL*
Ga0136449_10036845913300010379Peatlands SoilMLMGAIIAVFLIFGLFLSMLGSSPKKEGEWNIDTEA*
Ga0136449_10133876013300010379Peatlands SoilMLVGAIVSGLFIFGLFLSMLSSSPKPDAEEKLDTQV*
Ga0136449_10138692123300010379Peatlands SoilMLAGAIVAVLLIFGLFLSMLSSSPKDDAEWKPDTEA*
Ga0137393_1069374123300011271Vadose Zone SoilMLTGAIIAVLLIFGLFLSMLSSSPKSDAEWHIDTEV*
Ga0137363_1011646223300012202Vadose Zone SoilMMAGAIIAILLIFGLFLSMLSSSPKREVEWHPDTDV*
Ga0137407_1091555613300012930Vadose Zone SoilMLAGAIVALLLIFGLFLSMLSSSPKADPECQTDTEA*
Ga0181528_1072945123300014167BogMLATTIAAILLVFALFLSMLSSSPKDDAEWNADTEA*
Ga0181534_1064339723300014168BogMLFAAIIGVLLIFGLFLSMLSSSPKSDAEWHPDTEV*
Ga0181531_1022982433300014169BogMLAGAIIAVLLIFGLFLSMLSSSPKADPEYHPDTEA*
Ga0181537_1070292223300014201BogMLAGAIAAGLLVFALFLSMLSSAPKDDAEWHSDTDV*
Ga0182024_10004534243300014501PermafrostMLAGAIVAVLLIFGLFLSMLSSSPRGDSEYHPDTEA*
Ga0182024_1000533733300014501PermafrostMLAAAIAGVLLVFALFLSMLSSSPKDDTEWNPDTEA*
Ga0182024_1020926243300014501PermafrostMLAGAIAAILIVFALFLSMLSSSPKDDAEWKIDTET*
Ga0182024_1054130033300014501PermafrostMFAGAIAAVLLVFALFLSMLSSSPKDDAEWNADTEA*
Ga0181522_1009897723300014657BogMLAAAIAGVLIVFALFLSMLSSSPKDEVEWNPDTEA*
Ga0167658_1000779133300015195Glacier Forefield SoilMVAGAIIAILFIFGLFLSMLSSSPKQEAEWHPDTEV*
Ga0187812_109941623300017821Freshwater SedimentMLAGAIAAILLVFALFLSMLSSSPKDDAEWNPDTEA
Ga0187802_1039490623300017822Freshwater SedimentMLAGAIVAVLLIFGLFLSMLSSSPKRDAKWHPDTEA
Ga0187806_108308123300017928Freshwater SedimentMLAGAIVAVLLIFGLFLSMLSSSPKRDSKWHPDTEA
Ga0187806_126594523300017928Freshwater SedimentMLVGAIVGGFLIFGLFLSMLSSSPKSKSEEHLDTQV
Ga0187801_1048561123300017933Freshwater SedimentLAAAIAGVLIVFALFLSMLSSSPKDDAEWKPDTEA
Ga0187803_1031070923300017934Freshwater SedimentMLAGAIVAGLLIFGLFLSMLSSSPKSDAKWHPDTEA
Ga0187847_1022211023300017948PeatlandMLLTAIIAVLLIFGLFLSMLSSSPKSDSEWHPDTDV
Ga0187817_1021191113300017955Freshwater SedimentMLAGAIVAVLLIFGLFLSMLSSSPNRDAKWHPDTE
Ga0187778_1002548123300017961Tropical PeatlandMLVGAIVSGLLIFGLFLSMLSSSPKGESDNHLDSQV
Ga0187778_1053865223300017961Tropical PeatlandMLFGAIVAVLLVFGLFLSMLSSSPKRDSEYHPDTEA
Ga0187783_1006712853300017970Tropical PeatlandMLTAAIAGFLIVFALFLSMLSSSPKDDAEWNPDTDV
Ga0187783_1064656813300017970Tropical PeatlandMLAAAVAVLLIVFALFLSMLSSAPKDDQEWKPDTEA
Ga0187782_1006383443300017975Tropical PeatlandMLAAAITGVLIVFALFLSMLSSSPKDDAEWNIDTES
Ga0187782_1128388713300017975Tropical PeatlandEGGLLQMLVGAILGGLLIFGLFLSMLSSSPKSEPEKHFDTQV
Ga0181520_1016177933300017988BogMLAAAIAGVLIVFALFLSMLSSSPKDEVEWNPDTEA
Ga0187805_1026088723300018007Freshwater SedimentMLAAAIAGVLIVFALFLSMLSSSPKDDGEWNVDTEA
Ga0187888_1000265223300018008PeatlandMLAGAIAAVLIVFALFLSMLSSSPKDDAEWKPDTEA
Ga0187872_1033384523300018017PeatlandMLVGAIVSGLLIFGLFLSMLSSSPKSKSEEHFDTQV
Ga0187890_1043058513300018044PeatlandMLTAAIAGILIVFALFLSMLSSAPKDDVEWNPDTEA
Ga0187784_1104476113300018062Tropical PeatlandMLIGAIVAVLLIFGLFLSMLSSSPKSDSEWHPDTDA
Ga0187769_1004834943300018086Tropical PeatlandMLAGAIIVVLLILGMFLSMLSSSPKSDSEWHPDTDA
Ga0187771_1025147833300018088Tropical PeatlandMLVGAIVAVLLIFGLFLSMLSSSPKGDSKWHPDTDA
Ga0187797_131110323300019284PeatlandLAMLISAIVAVLLIFGLFLSMLSSSPKSDSEWHPDTDA
Ga0187797_150637223300019284PeatlandVMLAGAIIVVLLILGMFLSMLSSSPKSDSEWHPDTDA
Ga0210395_1033599423300020582SoilMLMGAIVAVLLIFGLFLSMLSSSPRADAEYNPDTEA
Ga0210388_1023654623300021181SoilMLAGAILAVLIVFALFLSMLSSSPKDDAEWNIDTEA
Ga0210385_1005005823300021402SoilMLAGAIAAILLVFALFLSMLSSSPKDDAEWNPDTDV
Ga0210385_1067173223300021402SoilMLAGAIAAILIVFALFLSMLSSSPKDDAEWNIDTET
Ga0210394_1007457143300021420SoilMLAGAIAAVLLVFALFLSMLSSSPKDDAEFNIDTEA
Ga0210384_1022623523300021432SoilMLASAIIGVLLIFGLFLSMLSSSPKGDAEWPSDTEV
Ga0210391_1116554723300021433SoilMFAGAIAAVLLVFALFLSMLSSSPKDDAEWNADTEA
Ga0210390_1005762733300021474SoilMLAGAIAAILLVFALFLSMLSSSPKDDPEWNPDTDV
Ga0210398_1022600933300021477SoilMLAVAIAGVFIVFALFLSMLSSSPKDDVEWNPDTEA
Ga0210398_1023787523300021477SoilWESRMLMGAIVAVLLIFGLFLSMLSSSPRADAEYNPDTEA
Ga0126371_1008153523300021560Tropical Forest SoilMILGAILSGLLIFGLFLSMLSSSPKSDPKKHFDTQV
Ga0224548_102424723300022518SoilSVMLAGTIVAVLLIFGLFLSMLSSSPRGDSEYHPDTEV
Ga0212088_10006883103300022555Freshwater Lake HypolimnionMIVTAIAGLLLILGLFLSMLTSSPKGDGASHTDTL
Ga0242666_113421923300022721SoilFAVAIAGVLIVFALFLSMLSSSPKDDAEWNIDTEA
Ga0224545_100335933300022881SoilMLAGAIVAVLLIFGLFLSMLSSSPRGDSEYHPDTEA
Ga0209131_136614223300026320Grasslands SoilMMAGAIIAILLIFGLFLSMLSSSPKREVEWHPDTDV
Ga0209648_10000036643300026551Grasslands SoilMIAGAIIAVLLIFGLFLSMLSSSPKSDSEWHHDTKG
Ga0209693_1002372323300027855SoilMLAGAIVAVLLIFGLFLSMLSSSPRADSECHPDTDV
Ga0209579_1038139923300027869Surface SoilMWAAAIAALFLVFALFLSMLSSAPKDDPEWNPDTDV
Ga0209380_1064316113300027889SoilMFAVAIAGVLIVFALFLSMLSSSPKDDVEWNPDTEA
Ga0209006_1002770183300027908Forest SoilMFAVAIAGVLIVFALFLSMLSSSPKDDAEWNIDTEA
Ga0209006_1067524923300027908Forest SoilMLAGAILAVLIVFALFLSMLSSSPKDDAEWNTDTEA
Ga0307504_1010380713300028792SoilMLAGAVIAVLLIFGLFLSMLSSSPKGDSEWHPDSDV
Ga0308309_1014067213300028906SoilGLTMLAGAIAAVLLVFALFLSMLSSSPKDDAEFNIDTEA
Ga0222748_106818823300029701SoilSMLAGAIAAILIVFALFLSMLSSSPKDDAEWNIDTET
Ga0311340_1003721083300029943PalsaMFAFITAILIVFALFLSMLSSSPKDDADWNIDTEA
Ga0311338_1012127443300030007PalsaMLAGAIVAVLLIFGLFLSMLSSSPRAESECNPDTDA
Ga0311338_1082252623300030007PalsaMLAGAIAAGLLVFALFLSMLSSSPKDDAELNVDTEA
Ga0302325_1012953743300031234PalsaMLAGAIAAFLIVFALFLSMLSSSPKDDVEWNPDTEA
Ga0302325_1073532423300031234PalsaMLAGAIAAILLVFALFLSMLSSSPKDDVEWNPDTDA
Ga0302325_1093813823300031234PalsaMLISAAVAFLFIIGLFLSMLSSSPKRDTEWNPDTEA
Ga0302325_1125405513300031234PalsaMLAGAIVAVLLIFGLFLSMLSSSPRADSEYHPDTEA
Ga0302324_10000884593300031236PalsaMLVGTIAAVLIVFALFLSMLSSAPKDDSEWKPDTDA
Ga0302324_10002636033300031236PalsaMLAGAIAAVLLVFALFLSMLSSSPKDDAEWNPDTES
Ga0302324_10030840723300031236PalsaMLAGAIAAVLLVFALFLSMLSSSPKDDAELNPDTEA
Ga0302324_10083473333300031236PalsaLASAIAAILIVFALFLSMLSSSPKDDAEWNIDTEA
Ga0310686_11067107013300031708SoilMLMGAIVAVLLIFGLFLSMLSSSPRADAEYHPDTEA
Ga0307469_1102842023300031720Hardwood Forest SoilMLVFAILALLLILGLFLSMLSSSPKGDSEWHSDTKA
Ga0307478_1052563223300031823Hardwood Forest SoilMLVGAIVSGLFIFGLFLSMLSESPKAEQEKHFDTQA
Ga0311301_10000988273300032160Peatlands SoilMLAGAIAAVLLVFALFLSMLSSSPKDDAEWHPDTEA
Ga0311301_1024537723300032160Peatlands SoilMLMGAILAVLLIFGLFLSMLSSSPKGDSEWHPDTEA
Ga0311301_1205834723300032160Peatlands SoilMLMGAIIAVFLIFGLFLSMLGSSPKKEGEWNIDTEA
Ga0348332_1352982323300032515Plant LitterAMLAGAIAAVLLVFALFLSMLSSSPKDDAEWNTDTEA
Ga0335082_1002611543300032782SoilMLAGAIIAVLFIFGLFLSMLSSSPKADGEWHPDTDV
Ga0335078_1003702563300032805SoilMLAGAIIVVLLILGMFLSMLSSSPKSDSEWHPDTEA
Ga0335078_1015800223300032805SoilMLVGAIVSGLLIFGLFLSMLSSSPKAEPEKHFDTQV
Ga0335078_1030411923300032805SoilMWAAAITAVLIVFALFLSMLSSSPKDDPEWNPDTEM
Ga0335078_1093675823300032805SoilMLFGAIVAVLLIFGLFLSMLSSSPKDDAEWKPDTEA
Ga0335078_1209526613300032805SoilMLVGAIVAVLLIFGLFLSMLGSSPKKDSEWNQDTEA
Ga0335078_1238826013300032805SoilMLLGAIVSGLLIFGLFLSMLSSSPKSKSEEHFDSQV
Ga0335080_1037971623300032828SoilMLLCAILAVLLIFGLFLSMLSSSPKGDSEWHPDTEA
Ga0335070_1019082523300032829SoilMLFGAIISGLFILGLFLSMLSSSPKAEHEKHFDTQV
Ga0335081_1023057243300032892SoilMVVGAIVSGLLIFGLFLSMVSSSPKRDSEDNLDTQL
Ga0335081_1137523223300032892SoilMLIGAIVAVLLIFGLFLSMLSSSPKGDSEWHPDTEQ
Ga0335074_10004476183300032895SoilMLAAAIAGVLIVFALFLSMLSSAPKDDAEWNPDTEA
Ga0335073_1186361423300033134SoilMLAAAIAGVLIVFALFLSMLSSSPKDDAEWNSDTEA
Ga0326727_1054989323300033405Peat SoilMLISAAIALLFIVGLFLSMLSSSPKPDAEWNPDTEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.