| Basic Information | |
|---|---|
| Family ID | F073778 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSGSESSSAKRARIPQRGPQAPRFIVIEGPLRVGKTTLARILAE |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.50 % |
| % of genes near scaffold ends (potentially truncated) | 97.50 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.50% β-sheet: 0.00% Coil/Unstructured: 87.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF13360 | PQQ_2 | 3.33 |
| PF07676 | PD40 | 2.50 |
| PF01541 | GIY-YIG | 1.67 |
| PF13505 | OMP_b-brl | 0.83 |
| PF01712 | dNK | 0.83 |
| PF00266 | Aminotran_5 | 0.83 |
| PF00326 | Peptidase_S9 | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.50 % |
| Unclassified | root | N/A | 47.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001137|JGI12637J13337_1024510 | Not Available | 542 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101154091 | Not Available | 663 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101516307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 566 | Open in IMG/M |
| 3300002914|JGI25617J43924_10040787 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300004091|Ga0062387_100815997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 697 | Open in IMG/M |
| 3300004635|Ga0062388_100772520 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005175|Ga0066673_10231957 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005340|Ga0070689_101510753 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005435|Ga0070714_101635510 | Not Available | 629 | Open in IMG/M |
| 3300005446|Ga0066686_10295430 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005541|Ga0070733_10793059 | Not Available | 636 | Open in IMG/M |
| 3300005542|Ga0070732_10960461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 522 | Open in IMG/M |
| 3300005552|Ga0066701_10965141 | Not Available | 504 | Open in IMG/M |
| 3300005559|Ga0066700_10286356 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300005561|Ga0066699_10434724 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300005602|Ga0070762_10694030 | Not Available | 682 | Open in IMG/M |
| 3300005921|Ga0070766_10877783 | Not Available | 614 | Open in IMG/M |
| 3300006059|Ga0075017_101601382 | Not Available | 514 | Open in IMG/M |
| 3300006176|Ga0070765_101893403 | Not Available | 559 | Open in IMG/M |
| 3300006800|Ga0066660_10188127 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300007255|Ga0099791_10275643 | Not Available | 800 | Open in IMG/M |
| 3300007255|Ga0099791_10696492 | Not Available | 500 | Open in IMG/M |
| 3300007788|Ga0099795_10451804 | Not Available | 592 | Open in IMG/M |
| 3300009088|Ga0099830_11784014 | Not Available | 514 | Open in IMG/M |
| 3300009089|Ga0099828_11641102 | Not Available | 566 | Open in IMG/M |
| 3300009090|Ga0099827_10477244 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300009137|Ga0066709_100373255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1969 | Open in IMG/M |
| 3300009143|Ga0099792_10731382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_54_36 | 643 | Open in IMG/M |
| 3300009143|Ga0099792_10960914 | Not Available | 569 | Open in IMG/M |
| 3300010046|Ga0126384_10153451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1776 | Open in IMG/M |
| 3300010046|Ga0126384_11376773 | Not Available | 657 | Open in IMG/M |
| 3300010046|Ga0126384_12118702 | Not Available | 540 | Open in IMG/M |
| 3300010047|Ga0126382_12457254 | Not Available | 507 | Open in IMG/M |
| 3300010336|Ga0134071_10137413 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300010359|Ga0126376_10515855 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300010360|Ga0126372_10606109 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300010361|Ga0126378_11169129 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300010366|Ga0126379_13758444 | Not Available | 509 | Open in IMG/M |
| 3300010398|Ga0126383_13156913 | Not Available | 538 | Open in IMG/M |
| 3300011269|Ga0137392_10295156 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300011269|Ga0137392_10517835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 991 | Open in IMG/M |
| 3300011270|Ga0137391_10274552 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300012211|Ga0137377_11414511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_54_36 | 623 | Open in IMG/M |
| 3300012349|Ga0137387_10606351 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012363|Ga0137390_10185574 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300012685|Ga0137397_10407107 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300012685|Ga0137397_10942780 | Not Available | 638 | Open in IMG/M |
| 3300012922|Ga0137394_10982125 | Not Available | 702 | Open in IMG/M |
| 3300012923|Ga0137359_10715064 | Not Available | 872 | Open in IMG/M |
| 3300012924|Ga0137413_10112856 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300012927|Ga0137416_10990899 | Not Available | 750 | Open in IMG/M |
| 3300012929|Ga0137404_10357124 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300012929|Ga0137404_12012508 | Not Available | 539 | Open in IMG/M |
| 3300012986|Ga0164304_11693521 | Not Available | 528 | Open in IMG/M |
| 3300017972|Ga0187781_10018198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4924 | Open in IMG/M |
| 3300017993|Ga0187823_10279147 | Not Available | 574 | Open in IMG/M |
| 3300018006|Ga0187804_10195684 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300018064|Ga0187773_11200048 | Not Available | 510 | Open in IMG/M |
| 3300018085|Ga0187772_11210361 | Not Available | 557 | Open in IMG/M |
| 3300020199|Ga0179592_10017909 | All Organisms → cellular organisms → Bacteria | 3123 | Open in IMG/M |
| 3300020199|Ga0179592_10053373 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300020579|Ga0210407_10548237 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300020580|Ga0210403_10031251 | All Organisms → cellular organisms → Bacteria | 4256 | Open in IMG/M |
| 3300020580|Ga0210403_10241993 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300020581|Ga0210399_10461299 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300020582|Ga0210395_11118500 | Not Available | 581 | Open in IMG/M |
| 3300020583|Ga0210401_11167663 | Not Available | 628 | Open in IMG/M |
| 3300021046|Ga0215015_10942953 | Not Available | 660 | Open in IMG/M |
| 3300021086|Ga0179596_10528742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_54_36 | 598 | Open in IMG/M |
| 3300021171|Ga0210405_10149427 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
| 3300021401|Ga0210393_11607168 | Not Available | 515 | Open in IMG/M |
| 3300021405|Ga0210387_11864856 | Not Available | 505 | Open in IMG/M |
| 3300021420|Ga0210394_10161314 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300021420|Ga0210394_11628787 | Not Available | 542 | Open in IMG/M |
| 3300021420|Ga0210394_11709386 | Not Available | 527 | Open in IMG/M |
| 3300021559|Ga0210409_11439402 | Not Available | 565 | Open in IMG/M |
| 3300021560|Ga0126371_11489762 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300022726|Ga0242654_10101468 | Not Available | 905 | Open in IMG/M |
| 3300024288|Ga0179589_10610836 | Not Available | 511 | Open in IMG/M |
| 3300026296|Ga0209235_1238673 | Not Available | 571 | Open in IMG/M |
| 3300026317|Ga0209154_1013836 | All Organisms → cellular organisms → Bacteria | 3878 | Open in IMG/M |
| 3300026489|Ga0257160_1005919 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300026542|Ga0209805_1017356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3807 | Open in IMG/M |
| 3300026872|Ga0207785_1026021 | Not Available | 511 | Open in IMG/M |
| 3300027562|Ga0209735_1094298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_54_36 | 651 | Open in IMG/M |
| 3300027645|Ga0209117_1005998 | All Organisms → cellular organisms → Bacteria | 4164 | Open in IMG/M |
| 3300027698|Ga0209446_1210253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300027853|Ga0209274_10343867 | Not Available | 768 | Open in IMG/M |
| 3300027857|Ga0209166_10392030 | Not Available | 722 | Open in IMG/M |
| 3300027862|Ga0209701_10032423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3389 | Open in IMG/M |
| 3300027862|Ga0209701_10253358 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300027867|Ga0209167_10125338 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300027882|Ga0209590_11003378 | Not Available | 521 | Open in IMG/M |
| 3300027986|Ga0209168_10104948 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300028138|Ga0247684_1013706 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300028536|Ga0137415_10135678 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300028746|Ga0302233_10422427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 505 | Open in IMG/M |
| 3300028871|Ga0302230_10277344 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300029636|Ga0222749_10189741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1022 | Open in IMG/M |
| 3300030053|Ga0302177_10476758 | Not Available | 647 | Open in IMG/M |
| 3300031231|Ga0170824_122783034 | Not Available | 525 | Open in IMG/M |
| 3300031474|Ga0170818_103222488 | Not Available | 633 | Open in IMG/M |
| 3300031718|Ga0307474_10984579 | Not Available | 667 | Open in IMG/M |
| 3300031720|Ga0307469_10020885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3556 | Open in IMG/M |
| 3300031730|Ga0307516_10763061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300031754|Ga0307475_10116489 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
| 3300031754|Ga0307475_10498916 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300031820|Ga0307473_10906211 | Not Available | 637 | Open in IMG/M |
| 3300031823|Ga0307478_11413945 | Not Available | 577 | Open in IMG/M |
| 3300031910|Ga0306923_11745879 | Not Available | 641 | Open in IMG/M |
| 3300031946|Ga0310910_10940655 | Not Available | 677 | Open in IMG/M |
| 3300031962|Ga0307479_10193887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2000 | Open in IMG/M |
| 3300031962|Ga0307479_11208271 | Not Available | 719 | Open in IMG/M |
| 3300032076|Ga0306924_10911387 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300032205|Ga0307472_102530259 | Not Available | 522 | Open in IMG/M |
| 3300032782|Ga0335082_11133972 | Not Available | 648 | Open in IMG/M |
| 3300032805|Ga0335078_10708445 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300032893|Ga0335069_10987255 | Not Available | 935 | Open in IMG/M |
| 3300032954|Ga0335083_11111826 | Not Available | 617 | Open in IMG/M |
| 3300033805|Ga0314864_0043953 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.33% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026872 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12637J13337_10245101 | 3300001137 | Forest Soil | MAANESSSAKRARIPQRAPQLPRFIVVEGPLRVGKSTL |
| JGIcombinedJ26739_1011540911 | 3300002245 | Forest Soil | MSANESTSAKRAPIPERGPQTPRFIVIEGPLRVGKT |
| JGIcombinedJ26739_1015163071 | 3300002245 | Forest Soil | MSPNESSSAKRAPVPTRGPQAPRSIVIEGPLRVGKSTLAKILA |
| JGI25617J43924_100407873 | 3300002914 | Grasslands Soil | MPGNDSSAAKRARTPQRTPQPPRFIVIEGPLRVGKTTLARIL |
| Ga0062387_1008159971 | 3300004091 | Bog Forest Soil | MAAHESSSAKRARDPQRAAQAPRFIVIEGPLRVGKTTLAKILAEKL |
| Ga0062388_1007725202 | 3300004635 | Bog Forest Soil | MAGSTSSSAKRAKVPQRGAQSPRFIAIEGPLRVGKSTLARILAERL |
| Ga0066673_102319571 | 3300005175 | Soil | MPAHESSSAKRAPKTQRGPHAPKHIVIEGPLRVGKSTLARILAE |
| Ga0070689_1015107532 | 3300005340 | Switchgrass Rhizosphere | MTAHESSSAKRALKPQRGPHAPKFIVIEGPLRVGKSTLARIL |
| Ga0070714_1016355102 | 3300005435 | Agricultural Soil | MAPSESSSTKRALKPQSGSQPPRFIVIEGPLRVGKTTLARILA |
| Ga0066686_102954301 | 3300005446 | Soil | MAANDSSAAKRARTPQRGPQTPRFIVIEGPLRVGKTTLAKILAEREAGLQ* |
| Ga0070733_107930591 | 3300005541 | Surface Soil | MSPNESSSAKRAPVPTRGPQAPRFIVIEGPLRVGKSTL |
| Ga0070732_109604611 | 3300005542 | Surface Soil | MAAYESSSAKRAPIPQRGPQAPRFIVIEGPLRVGKTTLAKILAERLHA |
| Ga0066701_109651412 | 3300005552 | Soil | MPGDNSSAAKRARVPQRSLEPPRFMVIEGPLRVGKTTLARI |
| Ga0066700_102863561 | 3300005559 | Soil | MTAHESSSAKRAPKTQRGPHAPKHIVIEGPLRVGKSTLARI |
| Ga0066699_104347241 | 3300005561 | Soil | MPGNDSSAAKRALVPQRSPQPPRFIAIEGPLRVGKSTL |
| Ga0070762_106940301 | 3300005602 | Soil | MAANESTAAKRAPKPERGPQSPRFIAIEGPLRVGKTTL |
| Ga0070766_108777832 | 3300005921 | Soil | MAANESTAAKRAPQPERGPQSPRFIVIEGPLRVGKTTLAKIL |
| Ga0075017_1016013821 | 3300006059 | Watersheds | MSPNESSSAKRAPVPTRGPQAPRFIVIEGPLRVGKST |
| Ga0070765_1018934032 | 3300006176 | Soil | MPGSGSDSSSAKRAKQPQPGPKPPQFIVIEGPLRVGKTT |
| Ga0066660_101881274 | 3300006800 | Soil | MPGNDSSAAKRALVPQRSPQPPRFIAIEGPLRVGKSTLARILA |
| Ga0099791_102756431 | 3300007255 | Vadose Zone Soil | MSPNESSSAKRAPVPTRGPQAPRFIVIEGPLRVGKSTLAK |
| Ga0099791_106964921 | 3300007255 | Vadose Zone Soil | MAANDSSAAKRARTPQRGPQTPRFIVIEGPLRVGKTTLAKILAER |
| Ga0099795_104518042 | 3300007788 | Vadose Zone Soil | MSPNESSSAKPAPVPTRGPQAPRFIVIEGPLRVGKSTLAKILAERLH |
| Ga0099830_117840141 | 3300009088 | Vadose Zone Soil | MPAKESSAAKHARVPQRAPQPPRFIAIEGPLRVGKTTLARVLAER |
| Ga0099828_116411021 | 3300009089 | Vadose Zone Soil | MPNESSSAKRALSPQRGPQAPRFIVIEGPLRVGKSTLAKILAERL |
| Ga0099827_104772441 | 3300009090 | Vadose Zone Soil | MSPNESSSAKRALSPQRGPQAPRFIVIEGPLRVGKSTLAKI |
| Ga0066709_1003732551 | 3300009137 | Grasslands Soil | MPGNDSSAAKRALVPQRSPQPPRFIAIEGPLRVGKTTL |
| Ga0099792_107313821 | 3300009143 | Vadose Zone Soil | MSPNESSSAKRAPIPTRGPQAPRFIVIEGPLRVGKSTLA* |
| Ga0099792_109609141 | 3300009143 | Vadose Zone Soil | MTAHESSSAKRAPKTQRGPHAPKHIVIEGPLRVGKSTL |
| Ga0126384_101534511 | 3300010046 | Tropical Forest Soil | MAHDSSAKRAPIPRRGPQAPRFIAIEGPLRVGKSTLARI |
| Ga0126384_113767731 | 3300010046 | Tropical Forest Soil | MAHDSSAKRALIPKRGPQAPRFIAIEGALRVGKSTLARILAER |
| Ga0126384_121187021 | 3300010046 | Tropical Forest Soil | MPGSGNDASAAKRARVPQRGPQAPRFIVVEGPLRVGKSALARILAERLHA |
| Ga0126382_124572541 | 3300010047 | Tropical Forest Soil | MPGSGNDASAAKRARIPQHGPQAPRFIVVEGPLRVGKNTLAHILTE |
| Ga0134071_101374131 | 3300010336 | Grasslands Soil | MTAHESSSAKRAPKTQRGPHAPRHIVIEGPLRVGKSTLARILAERLH |
| Ga0126376_105158551 | 3300010359 | Tropical Forest Soil | MAHDSSAKRAPIPRRGPQAPRFIAIEGPLRVGKSTLARILA |
| Ga0126372_106061092 | 3300010360 | Tropical Forest Soil | MPGSGNDASAAKRARVPQRGPQAPRFIVVEGPLRVGK |
| Ga0126378_111691291 | 3300010361 | Tropical Forest Soil | MSESSSAQRAPIPQRGPQAPRFIVIEGPLRVGKTTLAKVLAERLHA |
| Ga0126379_137584442 | 3300010366 | Tropical Forest Soil | MSGNDSSAAKRALVPARSPEPPRFIAIEGPLRVGKSTLAR |
| Ga0126383_131569131 | 3300010398 | Tropical Forest Soil | MATHESSSAKRALKTQRGPHAPKHIVIEGPLRVGKSTLARILAERLHA |
| Ga0137392_102951561 | 3300011269 | Vadose Zone Soil | MPNESSSAKRALSPQRGPQAPRFIVIEGPLRVGKSTLA |
| Ga0137392_105178352 | 3300011269 | Vadose Zone Soil | MPGNDSSAAKRARVPQRSPQLPRFIVIEGPLRVGKT |
| Ga0137391_102745522 | 3300011270 | Vadose Zone Soil | MSPNESSAKRAPVPTRGPQAPRFIVIEGPLRVGKST |
| Ga0137377_114145112 | 3300012211 | Vadose Zone Soil | MPGNDSSAAKRARTPLRTPQPPRFIVIEGPLRVGKTTLA |
| Ga0137387_106063511 | 3300012349 | Vadose Zone Soil | MPGNDSAATQRARVPQRSPQLPRFIVIEGPLRVGKTTLA |
| Ga0137390_101855743 | 3300012363 | Vadose Zone Soil | MSPNESSSAKRALSPQRGPQAPRFIVIEGPLRVGKSTLAKILAERL |
| Ga0137397_104071071 | 3300012685 | Vadose Zone Soil | MAANDSSAAKRARTPQRGPQTPRFIVIEGPLRVGKTTLAKILAERL |
| Ga0137397_109427802 | 3300012685 | Vadose Zone Soil | MAANEPSAAKRARTPQRGLQTPRFIIIEGPLRVGKTTLAKILAERLHA |
| Ga0137394_109821251 | 3300012922 | Vadose Zone Soil | MAANDSSAAKRARTPQRGPQTPRFIVIEGPLRVGKTTLAK |
| Ga0137359_107150642 | 3300012923 | Vadose Zone Soil | MSPNESTSAKRAPVPTRGPQAPRFIVIEGQLRVGNSTLAKILAESLHDRHAH |
| Ga0137413_101128561 | 3300012924 | Vadose Zone Soil | MAGMESSSAKRARIPQRGPQAPRFIVIEGPLRVGKTTLARILAERLH |
| Ga0137416_109908992 | 3300012927 | Vadose Zone Soil | MAANDSSAAKRARTPQRGPQTPRFIVIEGPLRVGKTTLAKILA |
| Ga0137404_103571242 | 3300012929 | Vadose Zone Soil | MAANDSSAAKRARTPQRGPQTPRFIVIEGPLRVGKTTLAKILAE |
| Ga0137404_120125081 | 3300012929 | Vadose Zone Soil | MSPNESTSAKRAPVPTRGPQAPRFIVIEGPLRVGKSTLAKILAERL |
| Ga0164304_116935211 | 3300012986 | Soil | MAPNESTAAKRAPVPERGPQSPRFIVIEGPLRVGKTTL |
| Ga0187781_100181987 | 3300017972 | Tropical Peatland | MPGSNSSSAKRARQPQPGSKPPQFIVIEGPLRVGKTTLARILAERLH |
| Ga0187823_102791471 | 3300017993 | Freshwater Sediment | MPGSDSSAKRARQPQPGSKPPQFIVIEGPLRVGKTTLARILAER |
| Ga0187804_101956841 | 3300018006 | Freshwater Sediment | MAASDSSSAKRARKPQPGSQPPRFIVIEGPLRVGKTTLARLLAERL |
| Ga0187773_112000481 | 3300018064 | Tropical Peatland | MAAHESSAAKRARITPQRAPQPPRFIVIEGPLRVGKSTLARILA |
| Ga0187772_112103612 | 3300018085 | Tropical Peatland | MPGSESSSAKRARQPQPGPQPPQFIVIEGPLRVGKT |
| Ga0179592_100179091 | 3300020199 | Vadose Zone Soil | MPGDNSSAAKRARIPQRSLEPPRFIVIEGPLRVGKT |
| Ga0179592_100533733 | 3300020199 | Vadose Zone Soil | MPGNDSSAAKRARTPQRTPQPPRFIVIEGPLRVGK |
| Ga0210407_105482372 | 3300020579 | Soil | MAANESTAAKRAPQPERGPQSPRFIVIEGPLRVGKTTLA |
| Ga0210403_100312511 | 3300020580 | Soil | MSPNESSSAKRAPVPTRGPQAPRFIVIEGPLRVGKSTLA |
| Ga0210403_102419931 | 3300020580 | Soil | MAGSESSSAKRARIPQRGPQAPRFIVIEGPLRVGKTTLARILAERLHA |
| Ga0210399_104612991 | 3300020581 | Soil | MAANESTAAKRAPQPERGPQSPRFIVIEGPLRVGKTTLAKTLA |
| Ga0210395_111185001 | 3300020582 | Soil | MPGSDSSSAKRARQPQPGSKPPQFIVIEGPLRVGKTTLARILA |
| Ga0210401_111676632 | 3300020583 | Soil | MSANESTSAKRAPIPERGPQAPRFIVIEGPLRVGKTTLAKVLAERLH |
| Ga0215015_109429531 | 3300021046 | Soil | MAGSESSSAKRARIPQRGPQAPRFIVIEGPLRVGKTTL |
| Ga0179596_105287421 | 3300021086 | Vadose Zone Soil | MPGNDSSAAKRARLPHRGPQPPRFIVIEGPLRVGKTTLARILAER |
| Ga0210405_101494273 | 3300021171 | Soil | MSPNESSSAKRAPVPTRGPQAPRFIVIEGPLRVGKS |
| Ga0210393_116071681 | 3300021401 | Soil | MANESSSAKRAPIPTRGPQAPRFIVIEGPLRVGKTTLAKVLAARLHA |
| Ga0210387_118648561 | 3300021405 | Soil | MAPSESSSTKRALKPQSGSQPPRFIVIEGPLRVGK |
| Ga0210394_101613143 | 3300021420 | Soil | MSANESSSAKRAPIPERGPQAPRFIVIEGPLRVGKTTLAK |
| Ga0210394_116287871 | 3300021420 | Soil | MAANESTAAKRAPQPERGPQSPRFIVIEGPLRVGKTTL |
| Ga0210394_117093861 | 3300021420 | Soil | MAGMESSSAKRARIPMKGPQAPRFIVIEGPLRVGKT |
| Ga0210409_114394021 | 3300021559 | Soil | MSPNESSSAKRAPAPQRGPQAPRFIVIEGPLRVGKTTLAK |
| Ga0126371_114897622 | 3300021560 | Tropical Forest Soil | MESSSAKRARLEKGPQAPRFIAIEGPLRVGKTTLARILAERLH |
| Ga0242654_101014682 | 3300022726 | Soil | MPGNDSSAAKRARTPQRSPQPPRFIVIEGPLRVGKTTLARILAER |
| Ga0179589_106108361 | 3300024288 | Vadose Zone Soil | MSGSESSSAKRARIPQRGPQATRIIVIEGPLRVGKTT |
| Ga0209235_12386731 | 3300026296 | Grasslands Soil | MAANDSSAAKRARTPQRGPQTPRFIVIEGPLRVGKTTLAKILAERLH |
| Ga0209154_10138364 | 3300026317 | Soil | MPGNDSSAAKRARIPQRGPQAPRFIVIEGPLRVGKTTL |
| Ga0257160_10059191 | 3300026489 | Soil | MTAHESSSAKRATKPQRGPHAPKHIVIEGPLRVGKSTL |
| Ga0209805_10173563 | 3300026542 | Soil | MPGNDSSAAKRALVPQRSPQPPRFIAIEGPLRVGKSTLAR |
| Ga0207785_10260211 | 3300026872 | Tropical Forest Soil | MPESSSAKRARQPQPASQPPRFIVIEGPLRVGKTTLARVL |
| Ga0209735_10942981 | 3300027562 | Forest Soil | MPGNDSSAAKRARLPQRGPQLPRFIVIEGPLRVGKTTLARVLAERLHA |
| Ga0209117_10059981 | 3300027645 | Forest Soil | MPGNDSSAAKRARVPQRSPQLPRFIVIEGPLRVGKTTLARILAER |
| Ga0209446_12102531 | 3300027698 | Bog Forest Soil | MAANESTAAKRAPQPERGPQSPRFIVIEGPLRVGKT |
| Ga0209274_103438672 | 3300027853 | Soil | MAANDSTAAKRAPKPERGPQSPRFIVIEGPLRVGK |
| Ga0209166_103920301 | 3300027857 | Surface Soil | MSGSESSSAKRARIPQRGPQAPRFIVIEGPLRVGKTTLARILAE |
| Ga0209701_100324231 | 3300027862 | Vadose Zone Soil | MPGNDSSAAKRARTPQRTPQPPRFIVIEGPLRVGKTTL |
| Ga0209701_102533581 | 3300027862 | Vadose Zone Soil | MAANNSSAAKRARTPQRGPQTPRSIVIEGPLRVGKTTLAKILAE |
| Ga0209167_101253381 | 3300027867 | Surface Soil | MANESSSAKRALKTQRGPHAPKFIVIEGPLRVGKSTLERVLAER |
| Ga0209590_110033781 | 3300027882 | Vadose Zone Soil | MAANESSAARRARVPQSGPQPPHFIVIEGPLRVGKTTLAKI |
| Ga0209168_101049483 | 3300027986 | Surface Soil | MANESSSAKRAPIPQRGPQAPRFIVIEGPLRVGKTTL |
| Ga0247684_10137062 | 3300028138 | Soil | MAANESTAAKRAPSPERGLQSPRFIVIEGPLRVGKTTLAKILAE |
| Ga0137415_101356783 | 3300028536 | Vadose Zone Soil | MSPNESSSAKRAPIPTRGPQAPRFIVIEGPLRVGKSTLA |
| Ga0302233_104224272 | 3300028746 | Palsa | MAAHEWSSAKRAREPQRAAEAPRFIVIEGPLRVGKTTLAKILAEKLH |
| Ga0302230_102773441 | 3300028871 | Palsa | MAAHEWSSAKRAREPQRAAEAPRFIVIEGPLRVGKTTLAKILAEK |
| Ga0222749_101897411 | 3300029636 | Soil | MPGNDSSAAKRARTPQRTPQPPRFIVIEGPLRVGKTTLARILAERLH |
| Ga0302177_104767582 | 3300030053 | Palsa | MAANDSTSAKRAREPQRAANAPRFIVIEGPLRVGKTTLARI |
| Ga0170824_1227830342 | 3300031231 | Forest Soil | MTADESSSAKRAPKTQRGPHAPKHIVIEGPLRVGKSTLARILAE |
| Ga0170818_1032224881 | 3300031474 | Forest Soil | MTADESSSAKRAPKTQRGPHAPKHIVIEGPLRVGKSTLARI |
| Ga0307474_109845792 | 3300031718 | Hardwood Forest Soil | MAANESTAAKRAPAPERGPQTPRFIVIEGPLRVGKTTLAKILAERLHA |
| Ga0307469_100208851 | 3300031720 | Hardwood Forest Soil | MAANDSSAAKRARTPQRGPQTPRFIVIEGPLRVGKTTLARILA |
| Ga0307516_107630611 | 3300031730 | Ectomycorrhiza | MTANESSSAKRATKTQRGPHAPRHIVIEGPLRVGKSTLARILAER |
| Ga0307475_101164893 | 3300031754 | Hardwood Forest Soil | MPGNDSSAAKRARTPQRTPQPPRFIVIEGPLRVGKTTLARILA |
| Ga0307475_104989162 | 3300031754 | Hardwood Forest Soil | MSASESTAAKRAPSPQRIPQPPRFIVIEGPLRVGKTTLAKVLTERLHA |
| Ga0307473_109062112 | 3300031820 | Hardwood Forest Soil | MPASDSSAKRARKPQPGPQPPRFIVIEGPLRVGKTTLARILAKCLNCE |
| Ga0307478_114139451 | 3300031823 | Hardwood Forest Soil | MSPNESSSAKRAPVPTRGPQAPRFIVIEGPLRVGKSTLAKI |
| Ga0306923_117458792 | 3300031910 | Soil | MSGSDSSSAKRAKQPQPAPKPPQFIVIEGPLRVGK |
| Ga0310910_109406552 | 3300031946 | Soil | MAGSDSSSAKRARIPMKGPQAPRFIVIEGPLRVGKTTLARI |
| Ga0307479_101938873 | 3300031962 | Hardwood Forest Soil | MAAISAGDRMQRMSPNESSSAKRAPVPTRGPQAPRFIVIEGPLRVGKSTLAKILAERLHA |
| Ga0307479_112082712 | 3300031962 | Hardwood Forest Soil | MSPNESSSAKRAPLPTRGPQAPRFIVIEGPLRVGKSTLAKVLA |
| Ga0306924_109113871 | 3300032076 | Soil | MTAHESSSAKRAPKTLRGPHAPKHIVIEGPLRVGKS |
| Ga0307472_1025302592 | 3300032205 | Hardwood Forest Soil | MTAHESSSAKRAPKTQRGPHAPRHIVIEGPLRVGKSTLARILAER |
| Ga0335082_111339721 | 3300032782 | Soil | MTESSSAKRVRVQKGPQAPRFIVIEGPLRVGKTTLAR |
| Ga0335078_107084451 | 3300032805 | Soil | MTESSSAKRVRVQKGPQAPRFIVIEGPLRVGKTTLARILAE |
| Ga0335069_109872551 | 3300032893 | Soil | MTESSSAKRVRVQKGPQAPRFIVIEGPLRVGKTTLARILAERLH |
| Ga0335083_111118262 | 3300032954 | Soil | MAHLSSAKRAPVAKRGPQAPRFIAVEGPLRVGKSTLARILA |
| Ga0314864_0043953_878_1003 | 3300033805 | Peatland | MPESSSARRARQPQPGSQPPRFIVIEGPLRVGKTTLARVLAE |
| ⦗Top⦘ |