Metagenome / Metatranscriptome Family F073744

Overview

Basic Information

• Family ID: F073744
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 120
• Average Sequence Length: 39 residues
• Representative Sequence: PPEVAASLIHSADERIPVSDLELGVGWLRHAAHAVLG
• Number of Associated Samples: 109
• Number of Associated Scaffolds: 120

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 91.67 %
• % of genes from short scaffolds (< 2000 bps): 92.50 %
• Associated GOLD sequencing projects: 109
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (61.667 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.000 % of family members)
• Environment Ontology (ENVO): Unclassified (25.833 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (59.167 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 44.62%
  β-sheet: 0.00%
  Coil/Unstructured: 55.38%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF00425	Chorismate_bind	30.00
PF07136	DUF1385	14.17
PF02749	QRPTase_N	2.50
PF01063	Aminotran_4	2.50
PF07687	M20_dimer	2.50
PF01546	Peptidase_M20	1.67
PF01434	Peptidase_M41	0.83
PF00004	AAA	0.83
PF00857	Isochorismatase	0.83
PF05548	Peptidase_M11	0.83
PF02518	HATPase_c	0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG3872	Uncharacterized conserved protein YqhQ, DUF1385 family	Function unknown [S]	14.17
COG0115	Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase	Amino acid transport and metabolism [E]	5.00
COG0157	Nicotinate-nucleotide pyrophosphorylase	Coenzyme transport and metabolism [H]	2.50
COG1488	Nicotinic acid phosphoribosyltransferase	Coenzyme transport and metabolism [H]	2.50
COG0465	ATP-dependent Zn proteases	Posttranslational modification, protein turnover, chaperones [O]	0.83
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.83
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.83

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
All Organisms	root	All Organisms	38.33 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
cellular organisms	root	All Organisms → cellular organisms	38.33 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	38.33 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	29.17 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	29.17 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	7.50 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	6.67 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	5.83 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1.67 %
Thermoleophilales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales	0.83 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.83 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.83 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.83 %
Thermoleophilaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae	0.83 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.83 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.83 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.83 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.83 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.83 %
Micromonospora	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora	0.83 %
Thermoleophilum	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum	0.83 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.83 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.83 %
unclassified Solirubrobacter	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter	0.83 %
unclassified Micromonospora	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora	0.83 %
Thermoleophilum album	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	0.83 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.83 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.67 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.83 %
Micromonospora sp. CNZ285	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. CNZ285	0.83 %
Solirubrobacter sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.	0.83 %
Thermoleophilum album	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	0.83 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.83 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2170459007|GJ61VE201B4RKI	Not Available	501
3300000364|INPhiseqgaiiFebDRAFT_101945967	Not Available	565
3300000858|JGI10213J12805_11021656	All Organisms → cellular organisms → Bacteria	561
3300000887|AL16A1W_10353396	All Organisms → cellular organisms → Bacteria	956
3300000953|JGI11615J12901_13307137	Not Available	501
3300004114|Ga0062593_101899331	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	658
3300004479|Ga0062595_100188319	All Organisms → cellular organisms → Bacteria	1259
3300005176|Ga0066679_11040067	Not Available	508
3300005178|Ga0066688_10822542	Not Available	579
3300005179|Ga0066684_10397113	Not Available	926
3300005531|Ga0070738_10372891	Not Available	571
3300005535|Ga0070684_101513264	Not Available	632
3300005535|Ga0070684_101826516	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	573
3300005542|Ga0070732_10134296	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1470
3300005546|Ga0070696_101279969	Not Available	622
3300005552|Ga0066701_10872071	Not Available	534
3300005554|Ga0066661_10480856	Not Available	754
3300005554|Ga0066661_10942919	All Organisms → cellular organisms → Bacteria	505
3300005556|Ga0066707_10435990	Not Available	851
3300005556|Ga0066707_10486443	Not Available	801
3300005568|Ga0066703_10044365	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2465
3300005764|Ga0066903_108082506	All Organisms → cellular organisms → Bacteria	539
3300005834|Ga0068851_10223132	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.	1060
3300005896|Ga0075282_1028821	Not Available	742
3300006028|Ga0070717_12078821	Not Available	511
3300006032|Ga0066696_10664051	Not Available	672
3300006195|Ga0075366_10108792	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1667
3300006578|Ga0074059_12132459	All Organisms → cellular organisms → Bacteria	1043
3300006755|Ga0079222_12195036	Not Available	549
3300006791|Ga0066653_10641006	All Organisms → cellular organisms → Bacteria	543
3300006800|Ga0066660_11024810	Not Available	661
3300006806|Ga0079220_10284564	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1011
3300006853|Ga0075420_100733499	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	852
3300006904|Ga0075424_100057570	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	4060
3300006954|Ga0079219_12185094	Not Available	532
3300009093|Ga0105240_11399148	Not Available	735
3300009789|Ga0126307_11511203	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	545
3300009840|Ga0126313_10652693	Not Available	850
3300010036|Ga0126305_10027501	All Organisms → cellular organisms → Bacteria	3067
3300010152|Ga0126318_10546641	Not Available	752
3300010323|Ga0134086_10235838	Not Available	693
3300010333|Ga0134080_10609989	Not Available	532
3300010336|Ga0134071_10753319	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	518
3300010358|Ga0126370_10747932	Not Available	865
3300010360|Ga0126372_12489227	Not Available	569
3300010362|Ga0126377_11194425	Not Available	831
3300010362|Ga0126377_11792697	Not Available	689
3300010371|Ga0134125_11301539	Not Available	793
3300010376|Ga0126381_101224406	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1085
3300010376|Ga0126381_104358429	Not Available	548
3300010396|Ga0134126_12123493	Not Available	613
3300010880|Ga0126350_12051990	Not Available	637
3300011000|Ga0138513_100000907	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2437
3300011971|Ga0120175_1029841	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	646
3300012096|Ga0137389_10326992	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1301
3300012198|Ga0137364_10698912	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	765
3300012200|Ga0137382_11114484	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	563
3300012204|Ga0137374_10501606	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	942
3300012212|Ga0150985_119412711	Not Available	841
3300012358|Ga0137368_10508885	Not Available	775
3300012684|Ga0136614_10271947	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1263
3300012897|Ga0157285_10088222	Not Available	832
3300012923|Ga0137359_11354671	Not Available	600
3300012951|Ga0164300_10395581	Not Available	757
3300012961|Ga0164302_10598668	Not Available	799
3300012972|Ga0134077_10424039	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	578
3300012984|Ga0164309_11935222	Not Available	505
3300012987|Ga0164307_10415018	Not Available	996
3300012987|Ga0164307_10540730	Not Available	888
3300012988|Ga0164306_10791076	Not Available	763
3300013100|Ga0157373_10299034	Not Available	1142
3300013104|Ga0157370_12058501	Not Available	512
3300013297|Ga0157378_11659116	Not Available	686
3300013307|Ga0157372_10887096	Not Available	1035
3300013772|Ga0120158_10066634	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2356
3300013772|Ga0120158_10167097	Not Available	1193
3300014745|Ga0157377_11522631	Not Available	533
3300014823|Ga0120170_1098822	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	592
3300014969|Ga0157376_12990430	Not Available	512
3300015052|Ga0137411_1381272	All Organisms → cellular organisms → Bacteria	4323
3300015372|Ga0132256_102273474	Not Available	646
3300015373|Ga0132257_100377901	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	1718
3300017959|Ga0187779_10979761	Not Available	586
3300017974|Ga0187777_10360890	Not Available	1000
3300017974|Ga0187777_10981709	Not Available	610
3300017974|Ga0187777_11026547	Not Available	597
3300018089|Ga0187774_11236886	Not Available	537
3300018433|Ga0066667_11549173	Not Available	588
3300018468|Ga0066662_12975751	Not Available	503
3300018481|Ga0190271_13417740	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	532
3300019884|Ga0193741_1007772	All Organisms → cellular organisms → Bacteria	2838
3300020012|Ga0193732_1078062	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	540
3300020062|Ga0193724_1024968	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1273
3300020082|Ga0206353_11047909	Not Available	713
3300020082|Ga0206353_11458223	Not Available	574
3300021560|Ga0126371_11348306	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	846
3300025552|Ga0210142_1072595	Not Available	672
3300025904|Ga0207647_10612648	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	600
3300025909|Ga0207705_10451773	Not Available	996
3300025917|Ga0207660_10225940	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. CNZ285	1471
3300025929|Ga0207664_11934669	Not Available	512
3300025939|Ga0207665_10314931	Not Available	1173
3300025949|Ga0207667_10716877	Not Available	1002
3300025949|Ga0207667_12121573	Not Available	520
3300025987|Ga0208906_1021577	Not Available	557
3300026035|Ga0207703_11914923	Not Available	569
3300026041|Ga0207639_10523594	Not Available	1086
3300026308|Ga0209265_1084361	Not Available	893
3300028563|Ga0265319_1038018	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1637
3300028710|Ga0307322_10000828	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	6266
3300028719|Ga0307301_10115412	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	856
3300028722|Ga0307319_10248295	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	586
3300028771|Ga0307320_10134803	Not Available	950
3300028799|Ga0307284_10042019	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1577
3300028881|Ga0307277_10504219	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	543
3300028885|Ga0307304_10012398	All Organisms → cellular organisms → Bacteria	2733
3300032002|Ga0307416_101243310	Not Available	850
3300032064|Ga0318510_10423086	Not Available	569
3300033004|Ga0335084_11494728	Not Available	668
3300034115|Ga0364945_0240733	Not Available	557

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	81.67%
Host-Associated	Host-Associated	18.33%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	79.17%
Plants	Host-Associated → Plants	18.33%
Aquatic	Environmental → Aquatic	2.50%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	77.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere	10.83%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.67%
Freshwater	Environmental → Aquatic → Freshwater	1.67%
Marine	Environmental → Aquatic → Marine	0.83%
Floodplain	Environmental → Terrestrial → Floodplain	0.83%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.83%
Roots	Host-Associated → Plants → Roots	0.83%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	64.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.33%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.67%
Loam	Environmental → Terrestrial → Soil → Loam	6.67%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.00%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.67%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.83%
Ice	Environmental → Aquatic → Freshwater → Ice	0.83%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.83%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.83%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.83%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.83%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	39.17%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	15.83%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.33%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.00%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.17%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	4.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.67%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.83%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.83%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.83%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.83%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.83%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.83%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	15.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	13.33%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.83%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	5.83%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	4.17%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.17%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.17%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.33%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.50%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.50%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.50%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.50%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.67%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.67%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.67%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.67%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.67%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.67%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.83%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.83%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.83%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.83%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.83%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.83%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.83%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.83%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.83%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.83%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.83%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.83%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2170459007	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm	Environmental
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000858	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental
3300000887	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina	Environmental
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated
3300005896	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204	Environmental
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental
3300006195	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Host-Associated
3300006578	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)	Environmental
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental
3300010152	Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)	Environmental
3300010323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG	Environmental
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010880	Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300011000	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015	Environmental
3300011971	Permafrost microbial communities from Nunavut, Canada - A7_80cm_12M	Environmental
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental
3300012684	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)	Environmental
3300012897	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300014823	Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M	Environmental
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015052	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)	Environmental
3300015372	Soil combined assembly	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental
3300019884	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2	Environmental
3300020012	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1	Environmental
3300020062	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1	Environmental
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300025552	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)	Environmental
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300025987	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 (SPAdes)	Environmental
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated
3300026308	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)	Environmental
3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Host-Associated
3300028710	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380	Environmental
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental
3300028722	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368	Environmental
3300028771	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369	Environmental
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated
3300032064	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17	Environmental
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental
3300034115	Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
L02_00207490	2170459007	Grass Soil	FFPSRDMDSETAARLIRSANERVPVSDLELGVRWLRHAAQTVCG
INPhiseqgaiiFebDRAFT_1019459672	3300000364	Soil	PPEVAASLIHSADERIPVADIELGVGWLRHAARAMLG*
JGI10213J12805_110216562	3300000858	Soil	PEVASRLIHSADERIAVEDLDLGVQFLRHVAATLGR*
AL16A1W_103533962	3300000887	Permafrost	VAASLIHSADERIPVSDLELGVGWLRHAAHAVLG*
JGI11615J12901_133071372	3300000953	Soil	RLIDSADERVPVEDLELGVSFLRHAAQEVCGIRL*
Ga0062593_1018993312	3300004114	Soil	GFFPSSGELPPEVAASLVHSADERIPVADLELGVSWLRHAAHAMLD*
Ga0062595_1001883193	3300004479	Soil	MRMQPELMAQLIHSADERIPIDDLELGLAWLRHAARTLLS*
Ga0066679_110400671	3300005176	Soil	FFPSTGELPPEVAASLIHSADERIPVADLELGVGWLRHAAHAVLG*
Ga0066688_108225421	3300005178	Soil	ARALDPQVSARLIHSANERVPVADLELGVRFLLHAARNVCG*
Ga0066684_103971131	3300005179	Soil	FPSTGELAPEVAASLIHSADERIPVSDLELGVGWLRHAAHAVLG*
Ga0070738_103728912	3300005531	Surface Soil	SRELDSETAARLIHSANERVPVADLELGVRWLRHAAQAVCG*
Ga0070684_1015132641	3300005535	Corn Rhizosphere	YGFFPSTGELPPEVAASLIHSADERIPVADLELGVGWLRHAAHAVLG*
Ga0070684_1018265161	3300005535	Corn Rhizosphere	YGFFPSTGELPPEVAASLIHSADERIPVADLELGVGWLRHAAHSVLG*
Ga0070732_101342961	3300005542	Surface Soil	DVAATLIHSADERIPVADLELGVEWMRHAATTLLA*
Ga0070696_1012799692	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	EAFGTVAYGFFPVTGELPPEEAALLEHAADERVPVSDLELGVDWLRHAAHAVLG*
Ga0066701_108720711	3300005552	Soil	AARLIHSADERIAVADLELGVSFLRHAAEKIGGLRSA*
Ga0066661_104808562	3300005554	Soil	AARLIHSADERIRVDDLALGLVCFRHVARTVCGG*
Ga0066661_109429192	3300005554	Soil	PSRVLAIETAARLIHSADERVPVEDLELGVSFLRHAAQTVL*
Ga0066707_104359901	3300005556	Soil	PSTGELPPEVAATLIHSADERIPVSDLELAVGWLRYAAHAVLS*
Ga0066707_104864431	3300005556	Soil	GELPPEVAASLIHSADERIPVADLELGVGWLRHAAHAVLG*
Ga0066703_100443654	3300005568	Soil	LAATLIHSADERVPVSDLELGVDWLRHVARTVCA*
Ga0066903_1080825062	3300005764	Tropical Forest Soil	TGELPSEVAASLVHSADERIPVADLEFGVSWLRHAAHAVLG*
Ga0068851_102231321	3300005834	Corn Rhizosphere	STGELPAEVAASLVHSHDERIPVSDLEHALDWLRFAARAILG*
Ga0075282_10288212	3300005896	Rice Paddy Soil	FPMSGTMPVDVINSLVHSADERIAIADLELGVRWLRHAAVSVLG*
Ga0070717_120788211	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	TGDLPPGVATLLVHSADERVPVSDLELGVDWLRHAAHSVLG*
Ga0066696_106640512	3300006032	Soil	PYDVAATLIHSADERIPVADLELGLDWLRYAAQTVLV*
Ga0075366_101087921	3300006195	Populus Endosphere	LIHSADERIEVEDLELGVRFLRHAAVEVGSLPSAA*
Ga0074059_121324593	3300006578	Soil	ELAARLIHSADERIPVEDLELGVSFMRHAAQAMLT*
Ga0079222_121950361	3300006755	Agricultural Soil	ETAARLIHSANERVPVSDLELGVRWLRHAAQTVCA*
Ga0066653_106410062	3300006791	Soil	RLIHSADERVPVEDLELGVDFLRHAARTLLGPAG*
Ga0066660_110248101	3300006800	Soil	MPAEIAAKLVHSADERIPVTDLELGVEWMRYAARALLG*
Ga0079220_102845641	3300006806	Agricultural Soil	PPEVATLLIHSADERVPVSDLELGVDWLRHAAHVVLG*
Ga0075420_1007334992	3300006853	Populus Rhizosphere	TAARLIHSADERVPVDDLELGVSFLRAAAQSLLRA*
Ga0075424_1000575701	3300006904	Populus Rhizosphere	AARLIHSADERIAVDDLDLGLQFLRYAAVRVCGGASTA*
Ga0079219_121850942	3300006954	Agricultural Soil	PPEVAARLIHSHDERVPVADVELGLRWLLHAARTVCG*
Ga0105240_113991482	3300009093	Corn Rhizosphere	PSRTMAPEVAARLIHSANERVPVADVELGLRWLLQAARSVCG*
Ga0126307_115112032	3300009789	Serpentine Soil	MDLRVAARLIHSANERVPVEDLDLGVRFLRHAARAICA*
Ga0126313_106526932	3300009840	Serpentine Soil	FPACALDPAVAARLIHSANERVPVADLELGVRFLRHASLATCR*
Ga0126305_100275015	3300010036	Serpentine Soil	ACALDPAVAARLIHSANERVPVADLELGVRFLRHASLATCR*
Ga0126318_105466411	3300010152	Soil	FPSTGELPPEVAASLVHSADERIPVSDLELGVSWLRHAAHAVLG*
Ga0134086_102358381	3300010323	Grasslands Soil	DVAAALIHSADERVPTADLELGVEWLRHAAHAVCG*
Ga0134080_106099892	3300010333	Grasslands Soil	LRVMDAELAVRLIHSADERIPVEDLELAVSFMRHAAQAMLA*
Ga0134071_107533192	3300010336	Grasslands Soil	LAARLIHSADERIPVEDLELGVSFLRHAAHQIGAP*
Ga0126370_107479321	3300010358	Tropical Forest Soil	ELPPEVAAGLVHSADERVPVSDLEVGVGWLRHAARAVLG*
Ga0126372_124892271	3300010360	Tropical Forest Soil	EVAAELVHSADERIPVSDLEAGVSWLRYAARAVLG*
Ga0126377_111944252	3300010362	Tropical Forest Soil	LSPEVAAELVHSADERIPVSDLEAGVSWLRHAARAVLG*
Ga0126377_117926971	3300010362	Tropical Forest Soil	ELPPEVAAGLVHSADERIPVSDLRAGVSWLRFAARAVLS*
Ga0134125_113015392	3300010371	Terrestrial Soil	EVAARLIHSANERVPVADVELGLRWLLQAARSVCG*
Ga0126381_1012244061	3300010376	Tropical Forest Soil	LPPEVAASLVHSADERVPVSDLELGVSWLRHAAQSVLG*
Ga0126381_1043584292	3300010376	Tropical Forest Soil	GELPPEVAASLIHSADERIPVADLEYGVSWLRYAAHAVLG*
Ga0134126_121234932	3300010396	Terrestrial Soil	TGDLPPEVAALLVHSADERVPVSDLELGVDWLRHAAHSILG*
Ga0126350_120519901	3300010880	Boreal Forest Soil	PMRTMPADVSATLIHSADERIPVDDLALNVDWFRFAAHAMLA*
Ga0138513_1000009072	3300011000	Soil	MEPEVAARLIHSADERIELDDLELGMRFLRHAASALPSLP*
Ga0120175_10298412	3300011971	Permafrost	MDAELAARLIHSADERIPVEDLELAVSFMRHAAQAMLA*
Ga0137389_103269921	3300012096	Vadose Zone Soil	AEAALLIHSANVRVQVDDLELGVRFLRHAAHAMLG*
Ga0137364_106989121	3300012198	Vadose Zone Soil	ELAARLIHSADERIPVEDLELGVSFLRYAAQAMVA*
Ga0137382_111144841	3300012200	Vadose Zone Soil	MDAEVAARLIHSADERVPVDDLETGVEWLRHAARHVLAG*
Ga0137374_105016062	3300012204	Vadose Zone Soil	EVAARLIHSANERVPVEDLDLGVRFLRHAAQAICG*
Ga0150985_1194127111	3300012212	Avena Fatua Rhizosphere	PEVAGSLIHSADERIPVADIELGVGWLRHAARAMLG*
Ga0137368_105088851	3300012358	Vadose Zone Soil	PARAMHPAQAALLIHSANERVPVEDLDLGVRFVRHAARALLG*
Ga0136614_102719471	3300012684	Polar Desert Sand	SARLIHSADERLAIDDLELGVRFLRHVATELGRGN*
Ga0157285_100882222	3300012897	Soil	ELAARLIHSADERVPVDDLELGVEFLRAAAAGAGAR*
Ga0137359_113546711	3300012923	Vadose Zone Soil	AYGFFPSTGELPPEVAATLIHSADERIPVSDLELAVGWLRYAAHAVLS*
Ga0164300_103955811	3300012951	Soil	ELMAQLIHSADERILIDDLELGLAWLRHAARTLLS*
Ga0164302_105986681	3300012961	Soil	MDPETAARLIHSANERVPVSDLEPGVRWLRHAAQAVCA*
Ga0134077_104240391	3300012972	Grasslands Soil	LAARLIHSADERIPVEDLELGARFLLHVVRTLEG*
Ga0164309_119352222	3300012984	Soil	PEVAASLIHSADERIPVADLELGVGWLRHAARAMLG*
Ga0164307_104150182	3300012987	Soil	SRAMPAELAARLIHSADERIPVEDLELGVSFMRHAAQAMLT*
Ga0164307_105407301	3300012987	Soil	SRAMDAETAARLIHSANERVPVSDLQLGVRWLRHAAQAVCA*
Ga0164306_107910761	3300012988	Soil	PPEVAASLIHSADERIPVTDIELGVGWLRHAARAMLG*
Ga0157373_102990342	3300013100	Corn Rhizosphere	LRTMPAEVAATLIHSADERAAVDDLELGVDWLRFAARAVLA*
Ga0157370_120585011	3300013104	Corn Rhizosphere	GTVAYGFFPSTGELPAEVAASLIHSHDERIPVSDLEHALDWLRFAARAILG*
Ga0157378_116591162	3300013297	Miscanthus Rhizosphere	LPPEVAASLIHSADERIPVADIELGVGWLRHAARAMLG*
Ga0157372_108870961	3300013307	Corn Rhizosphere	RAMEPEVAARLIHSANERVPVADVELGLRWLLHAARTVCG*
Ga0120158_100666341	3300013772	Permafrost	EAAARLIHSADERVPVADLELGVRWLLHVARSVCA*
Ga0120158_101670971	3300013772	Permafrost	MPAEVAAQLIHSADERIPVDDLELGLDWLRFVARAVCG*
Ga0157377_115226311	3300014745	Miscanthus Rhizosphere	TAARLIHSADERVPVEDLELGVEFLRHAAKSLLSTA*
Ga0120170_10988222	3300014823	Permafrost	PPEVAASLIHSADERIPVSDLELGVGWLRHAAHAVLG*
Ga0157376_129904301	3300014969	Miscanthus Rhizosphere	GELPAEVAASLIHSHDERIPVSDLEHALDWLRFAAGAILG*
Ga0137411_13812729	3300015052	Vadose Zone Soil	MAPMEAAQLIHSADERVPVDDLELGLDWLRFAAGAVCG*
Ga0132256_1022734741	3300015372	Arabidopsis Rhizosphere	PELVARLEHSADERIPVDDLELGVDALRHVALALL*
Ga0132257_1003779011	3300015373	Arabidopsis Rhizosphere	ETAARLIHSADERVPVEDLELGVDFLRHAAKSLLSTA*
Ga0187779_109797611	3300017959	Tropical Peatland	EVAATLIHSADERIPVADLELGVRWLRHAADAMLG
Ga0187777_103608901	3300017974	Tropical Peatland	LPPEVAASLIHSADERVPVSDLELGVGWLRHAALAVLG
Ga0187777_109817092	3300017974	Tropical Peatland	GELPADVAATLIHSADERIPVADLELGVQWLRHATQSMLG
Ga0187777_110265472	3300017974	Tropical Peatland	DPELAARLIHSADERVPVADLELGVRFLRHAAQTVCA
Ga0187774_112368862	3300018089	Tropical Peatland	PARAMPPDLAASLIHAADERVPVSDLELGVEWLRHVARTVVG
Ga0066667_115491731	3300018433	Grasslands Soil	RAMDPEVASRLVHSADERVPVEDLELGVEWMRFGAEHLLSG
Ga0066662_129757512	3300018468	Grasslands Soil	PAEVAATLIHSADERIPVTDLELGVNWLRHAAQRVLA
Ga0190271_134177401	3300018481	Soil	MEAELAARLIHSADERIPIDDLELTVAAYRHVALTLS
Ga0193741_10077724	3300019884	Soil	RTMEPEIAARLIHAADERIELEDLELGVRFLRHAAEGVASLP
Ga0193732_10780621	3300020012	Soil	MPAELAARLIHSADERIPVEDLELGVSFMRHAAQAMLT
Ga0193724_10249681	3300020062	Soil	QLAATLIHSADERVPSSDLELGVDWLRHVARTLGG
Ga0206353_110479091	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	TMAPEVAARLIHSANERVPVADVELGLRWLLQAARSVCG
Ga0206353_114582232	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	PYRAMTPALAATLIHSADERVPVSDLELGVDWLRHAARTVCA
Ga0126371_113483062	3300021560	Tropical Forest Soil	MTAEMPPEVAAYLVHSADERVPVADLEFGVRWLRHAAHAVLG
Ga0210142_10725951	3300025552	Natural And Restored Wetlands	AARLIHSADERVPVADLELGVRFLRHAARAVCGADAH
Ga0207647_106126482	3300025904	Corn Rhizosphere	MDPEVASRLIHSADERVPVADVELGLRWLLHAARTVCG
Ga0207705_104517731	3300025909	Corn Rhizosphere	PELMAALIHSADERIPVDDLELGTTWLRHAARTLLS
Ga0207660_102259401	3300025917	Corn Rhizosphere	SELMAAVIHSADERVPIDDLELGVTWLRHAARTLLS
Ga0207664_119346691	3300025929	Agricultural Soil	RDLDSEIAARLIHSADERVPVTDLELGVRWLRHAAQTVCA
Ga0207665_103149312	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	RAMTPALAATLIHSADERVPVSDLELGVDWLRHAARTVCA
Ga0207667_107168772	3300025949	Corn Rhizosphere	DAETAARLIHSANERVPVSDLELGTRWLRHAAQSVCD
Ga0207667_121215731	3300025949	Corn Rhizosphere	GELPAEVAASLIHSHDERIPVSDLEHALGWLRHAARAVLA
Ga0208906_10215772	3300025987	Rice Paddy Soil	MPADVIAQLIHSADERIPVDDLVLGLDWLRYAAKTLLA
Ga0207703_119149232	3300026035	Switchgrass Rhizosphere	AELAARLIHSADERIPVEDLELGVSFMRHAAQAMLV
Ga0207639_105235941	3300026041	Corn Rhizosphere	PSSGELPPEVAASLIHSADERIPVADIELGVGWLRHAARAMLG
Ga0209265_10843612	3300026308	Soil	MPSEEAALLIHSADERVPVADLELGVDWLRHAAHAVLG
Ga0265319_10380181	3300028563	Rhizosphere	AEVAAHLIHSADERVPVDDLELGVDWLRFAARAVCG
Ga0307322_100008289	3300028710	Soil	AELAARLIHSADERIPVEDLELGVSFMRHAAQAMLT
Ga0307301_101154121	3300028719	Soil	VMDAELAARLIHSADERIPVEDLELAVSFMRHAAQAMLA
Ga0307319_102482952	3300028722	Soil	PETAALLIHSANERVPVDDLELGVGFLRHAARVIGGIRL
Ga0307320_101348032	3300028771	Soil	PSLVMPIETAARLIHSADERVPVEDLELGVSFMRHAAQTVLGS
Ga0307284_100420191	3300028799	Soil	ELAARLIHSADERIPVEDLELAVSFMRSAAQAMLA
Ga0307277_105042191	3300028881	Soil	AELAARLIHSADERIPVEDLELAVGFMRHAAQAMLA
Ga0307304_100123981	3300028885	Soil	MPIETAARLIHSADERVPVEDLELGVSFMRHAAQTVLGS
Ga0307416_1012433101	3300032002	Rhizosphere	RAMHPAEAALLIHSADERVPAEDLELGVRFLRQAARTLLR
Ga0318510_104230862	3300032064	Soil	FPSTGELPPEIAASLIHSADERIPVSDLELGVSWLRHAARSILG
Ga0335084_114947282	3300033004	Soil	AARLIHSANERIEVDDLELGVEFLRHVARTVGEPA
Ga0364945_0240733_10_126	3300034115	Sediment	MDPEVAAKLIHSADERIEVEDLELGVRFLRHVAATLGR