| Basic Information | |
|---|---|
| Family ID | F073744 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 39 residues |
| Representative Sequence | PPEVAASLIHSADERIPVSDLELGVGWLRHAAHAVLG |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.67 % |
| % of genes from short scaffolds (< 2000 bps) | 92.50 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00425 | Chorismate_bind | 30.00 |
| PF07136 | DUF1385 | 14.17 |
| PF02749 | QRPTase_N | 2.50 |
| PF01063 | Aminotran_4 | 2.50 |
| PF07687 | M20_dimer | 2.50 |
| PF01546 | Peptidase_M20 | 1.67 |
| PF01434 | Peptidase_M41 | 0.83 |
| PF00004 | AAA | 0.83 |
| PF00857 | Isochorismatase | 0.83 |
| PF05548 | Peptidase_M11 | 0.83 |
| PF02518 | HATPase_c | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3872 | Uncharacterized conserved protein YqhQ, DUF1385 family | Function unknown [S] | 14.17 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 5.00 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 2.50 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 2.50 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.83 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.67 % |
| All Organisms | root | All Organisms | 38.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459007|GJ61VE201B4RKI | Not Available | 501 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101945967 | Not Available | 565 | Open in IMG/M |
| 3300000858|JGI10213J12805_11021656 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300000887|AL16A1W_10353396 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300000953|JGI11615J12901_13307137 | Not Available | 501 | Open in IMG/M |
| 3300004114|Ga0062593_101899331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 658 | Open in IMG/M |
| 3300004479|Ga0062595_100188319 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300005176|Ga0066679_11040067 | Not Available | 508 | Open in IMG/M |
| 3300005178|Ga0066688_10822542 | Not Available | 579 | Open in IMG/M |
| 3300005179|Ga0066684_10397113 | Not Available | 926 | Open in IMG/M |
| 3300005531|Ga0070738_10372891 | Not Available | 571 | Open in IMG/M |
| 3300005535|Ga0070684_101513264 | Not Available | 632 | Open in IMG/M |
| 3300005535|Ga0070684_101826516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 573 | Open in IMG/M |
| 3300005542|Ga0070732_10134296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1470 | Open in IMG/M |
| 3300005546|Ga0070696_101279969 | Not Available | 622 | Open in IMG/M |
| 3300005552|Ga0066701_10872071 | Not Available | 534 | Open in IMG/M |
| 3300005554|Ga0066661_10480856 | Not Available | 754 | Open in IMG/M |
| 3300005554|Ga0066661_10942919 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005556|Ga0066707_10435990 | Not Available | 851 | Open in IMG/M |
| 3300005556|Ga0066707_10486443 | Not Available | 801 | Open in IMG/M |
| 3300005568|Ga0066703_10044365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2465 | Open in IMG/M |
| 3300005764|Ga0066903_108082506 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005834|Ga0068851_10223132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1060 | Open in IMG/M |
| 3300005896|Ga0075282_1028821 | Not Available | 742 | Open in IMG/M |
| 3300006028|Ga0070717_12078821 | Not Available | 511 | Open in IMG/M |
| 3300006032|Ga0066696_10664051 | Not Available | 672 | Open in IMG/M |
| 3300006195|Ga0075366_10108792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1667 | Open in IMG/M |
| 3300006578|Ga0074059_12132459 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300006755|Ga0079222_12195036 | Not Available | 549 | Open in IMG/M |
| 3300006791|Ga0066653_10641006 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006800|Ga0066660_11024810 | Not Available | 661 | Open in IMG/M |
| 3300006806|Ga0079220_10284564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
| 3300006853|Ga0075420_100733499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
| 3300006904|Ga0075424_100057570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4060 | Open in IMG/M |
| 3300006954|Ga0079219_12185094 | Not Available | 532 | Open in IMG/M |
| 3300009093|Ga0105240_11399148 | Not Available | 735 | Open in IMG/M |
| 3300009789|Ga0126307_11511203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300009840|Ga0126313_10652693 | Not Available | 850 | Open in IMG/M |
| 3300010036|Ga0126305_10027501 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
| 3300010152|Ga0126318_10546641 | Not Available | 752 | Open in IMG/M |
| 3300010323|Ga0134086_10235838 | Not Available | 693 | Open in IMG/M |
| 3300010333|Ga0134080_10609989 | Not Available | 532 | Open in IMG/M |
| 3300010336|Ga0134071_10753319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300010358|Ga0126370_10747932 | Not Available | 865 | Open in IMG/M |
| 3300010360|Ga0126372_12489227 | Not Available | 569 | Open in IMG/M |
| 3300010362|Ga0126377_11194425 | Not Available | 831 | Open in IMG/M |
| 3300010362|Ga0126377_11792697 | Not Available | 689 | Open in IMG/M |
| 3300010371|Ga0134125_11301539 | Not Available | 793 | Open in IMG/M |
| 3300010376|Ga0126381_101224406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1085 | Open in IMG/M |
| 3300010376|Ga0126381_104358429 | Not Available | 548 | Open in IMG/M |
| 3300010396|Ga0134126_12123493 | Not Available | 613 | Open in IMG/M |
| 3300010880|Ga0126350_12051990 | Not Available | 637 | Open in IMG/M |
| 3300011000|Ga0138513_100000907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2437 | Open in IMG/M |
| 3300011971|Ga0120175_1029841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300012096|Ga0137389_10326992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1301 | Open in IMG/M |
| 3300012198|Ga0137364_10698912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300012200|Ga0137382_11114484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300012204|Ga0137374_10501606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 942 | Open in IMG/M |
| 3300012212|Ga0150985_119412711 | Not Available | 841 | Open in IMG/M |
| 3300012358|Ga0137368_10508885 | Not Available | 775 | Open in IMG/M |
| 3300012684|Ga0136614_10271947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1263 | Open in IMG/M |
| 3300012897|Ga0157285_10088222 | Not Available | 832 | Open in IMG/M |
| 3300012923|Ga0137359_11354671 | Not Available | 600 | Open in IMG/M |
| 3300012951|Ga0164300_10395581 | Not Available | 757 | Open in IMG/M |
| 3300012961|Ga0164302_10598668 | Not Available | 799 | Open in IMG/M |
| 3300012972|Ga0134077_10424039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300012984|Ga0164309_11935222 | Not Available | 505 | Open in IMG/M |
| 3300012987|Ga0164307_10415018 | Not Available | 996 | Open in IMG/M |
| 3300012987|Ga0164307_10540730 | Not Available | 888 | Open in IMG/M |
| 3300012988|Ga0164306_10791076 | Not Available | 763 | Open in IMG/M |
| 3300013100|Ga0157373_10299034 | Not Available | 1142 | Open in IMG/M |
| 3300013104|Ga0157370_12058501 | Not Available | 512 | Open in IMG/M |
| 3300013297|Ga0157378_11659116 | Not Available | 686 | Open in IMG/M |
| 3300013307|Ga0157372_10887096 | Not Available | 1035 | Open in IMG/M |
| 3300013772|Ga0120158_10066634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2356 | Open in IMG/M |
| 3300013772|Ga0120158_10167097 | Not Available | 1193 | Open in IMG/M |
| 3300014745|Ga0157377_11522631 | Not Available | 533 | Open in IMG/M |
| 3300014823|Ga0120170_1098822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300014969|Ga0157376_12990430 | Not Available | 512 | Open in IMG/M |
| 3300015052|Ga0137411_1381272 | All Organisms → cellular organisms → Bacteria | 4323 | Open in IMG/M |
| 3300015372|Ga0132256_102273474 | Not Available | 646 | Open in IMG/M |
| 3300015373|Ga0132257_100377901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1718 | Open in IMG/M |
| 3300017959|Ga0187779_10979761 | Not Available | 586 | Open in IMG/M |
| 3300017974|Ga0187777_10360890 | Not Available | 1000 | Open in IMG/M |
| 3300017974|Ga0187777_10981709 | Not Available | 610 | Open in IMG/M |
| 3300017974|Ga0187777_11026547 | Not Available | 597 | Open in IMG/M |
| 3300018089|Ga0187774_11236886 | Not Available | 537 | Open in IMG/M |
| 3300018433|Ga0066667_11549173 | Not Available | 588 | Open in IMG/M |
| 3300018468|Ga0066662_12975751 | Not Available | 503 | Open in IMG/M |
| 3300018481|Ga0190271_13417740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300019884|Ga0193741_1007772 | All Organisms → cellular organisms → Bacteria | 2838 | Open in IMG/M |
| 3300020012|Ga0193732_1078062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300020062|Ga0193724_1024968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1273 | Open in IMG/M |
| 3300020082|Ga0206353_11047909 | Not Available | 713 | Open in IMG/M |
| 3300020082|Ga0206353_11458223 | Not Available | 574 | Open in IMG/M |
| 3300021560|Ga0126371_11348306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300025552|Ga0210142_1072595 | Not Available | 672 | Open in IMG/M |
| 3300025904|Ga0207647_10612648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300025909|Ga0207705_10451773 | Not Available | 996 | Open in IMG/M |
| 3300025917|Ga0207660_10225940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. CNZ285 | 1471 | Open in IMG/M |
| 3300025929|Ga0207664_11934669 | Not Available | 512 | Open in IMG/M |
| 3300025939|Ga0207665_10314931 | Not Available | 1173 | Open in IMG/M |
| 3300025949|Ga0207667_10716877 | Not Available | 1002 | Open in IMG/M |
| 3300025949|Ga0207667_12121573 | Not Available | 520 | Open in IMG/M |
| 3300025987|Ga0208906_1021577 | Not Available | 557 | Open in IMG/M |
| 3300026035|Ga0207703_11914923 | Not Available | 569 | Open in IMG/M |
| 3300026041|Ga0207639_10523594 | Not Available | 1086 | Open in IMG/M |
| 3300026308|Ga0209265_1084361 | Not Available | 893 | Open in IMG/M |
| 3300028563|Ga0265319_1038018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1637 | Open in IMG/M |
| 3300028710|Ga0307322_10000828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6266 | Open in IMG/M |
| 3300028719|Ga0307301_10115412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
| 3300028722|Ga0307319_10248295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300028771|Ga0307320_10134803 | Not Available | 950 | Open in IMG/M |
| 3300028799|Ga0307284_10042019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1577 | Open in IMG/M |
| 3300028881|Ga0307277_10504219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300028885|Ga0307304_10012398 | All Organisms → cellular organisms → Bacteria | 2733 | Open in IMG/M |
| 3300032002|Ga0307416_101243310 | Not Available | 850 | Open in IMG/M |
| 3300032064|Ga0318510_10423086 | Not Available | 569 | Open in IMG/M |
| 3300033004|Ga0335084_11494728 | Not Available | 668 | Open in IMG/M |
| 3300034115|Ga0364945_0240733 | Not Available | 557 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.83% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.33% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.67% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.67% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.83% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011971 | Permafrost microbial communities from Nunavut, Canada - A7_80cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025987 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L02_00207490 | 2170459007 | Grass Soil | FFPSRDMDSETAARLIRSANERVPVSDLELGVRWLRHAAQTVCG |
| INPhiseqgaiiFebDRAFT_1019459672 | 3300000364 | Soil | PPEVAASLIHSADERIPVADIELGVGWLRHAARAMLG* |
| JGI10213J12805_110216562 | 3300000858 | Soil | PEVASRLIHSADERIAVEDLDLGVQFLRHVAATLGR* |
| AL16A1W_103533962 | 3300000887 | Permafrost | VAASLIHSADERIPVSDLELGVGWLRHAAHAVLG* |
| JGI11615J12901_133071372 | 3300000953 | Soil | RLIDSADERVPVEDLELGVSFLRHAAQEVCGIRL* |
| Ga0062593_1018993312 | 3300004114 | Soil | GFFPSSGELPPEVAASLVHSADERIPVADLELGVSWLRHAAHAMLD* |
| Ga0062595_1001883193 | 3300004479 | Soil | MRMQPELMAQLIHSADERIPIDDLELGLAWLRHAARTLLS* |
| Ga0066679_110400671 | 3300005176 | Soil | FFPSTGELPPEVAASLIHSADERIPVADLELGVGWLRHAAHAVLG* |
| Ga0066688_108225421 | 3300005178 | Soil | ARALDPQVSARLIHSANERVPVADLELGVRFLLHAARNVCG* |
| Ga0066684_103971131 | 3300005179 | Soil | FPSTGELAPEVAASLIHSADERIPVSDLELGVGWLRHAAHAVLG* |
| Ga0070738_103728912 | 3300005531 | Surface Soil | SRELDSETAARLIHSANERVPVADLELGVRWLRHAAQAVCG* |
| Ga0070684_1015132641 | 3300005535 | Corn Rhizosphere | YGFFPSTGELPPEVAASLIHSADERIPVADLELGVGWLRHAAHAVLG* |
| Ga0070684_1018265161 | 3300005535 | Corn Rhizosphere | YGFFPSTGELPPEVAASLIHSADERIPVADLELGVGWLRHAAHSVLG* |
| Ga0070732_101342961 | 3300005542 | Surface Soil | DVAATLIHSADERIPVADLELGVEWMRHAATTLLA* |
| Ga0070696_1012799692 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EAFGTVAYGFFPVTGELPPEEAALLEHAADERVPVSDLELGVDWLRHAAHAVLG* |
| Ga0066701_108720711 | 3300005552 | Soil | AARLIHSADERIAVADLELGVSFLRHAAEKIGGLRSA* |
| Ga0066661_104808562 | 3300005554 | Soil | AARLIHSADERIRVDDLALGLVCFRHVARTVCGG* |
| Ga0066661_109429192 | 3300005554 | Soil | PSRVLAIETAARLIHSADERVPVEDLELGVSFLRHAAQTVL* |
| Ga0066707_104359901 | 3300005556 | Soil | PSTGELPPEVAATLIHSADERIPVSDLELAVGWLRYAAHAVLS* |
| Ga0066707_104864431 | 3300005556 | Soil | GELPPEVAASLIHSADERIPVADLELGVGWLRHAAHAVLG* |
| Ga0066703_100443654 | 3300005568 | Soil | LAATLIHSADERVPVSDLELGVDWLRHVARTVCA* |
| Ga0066903_1080825062 | 3300005764 | Tropical Forest Soil | TGELPSEVAASLVHSADERIPVADLEFGVSWLRHAAHAVLG* |
| Ga0068851_102231321 | 3300005834 | Corn Rhizosphere | STGELPAEVAASLVHSHDERIPVSDLEHALDWLRFAARAILG* |
| Ga0075282_10288212 | 3300005896 | Rice Paddy Soil | FPMSGTMPVDVINSLVHSADERIAIADLELGVRWLRHAAVSVLG* |
| Ga0070717_120788211 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TGDLPPGVATLLVHSADERVPVSDLELGVDWLRHAAHSVLG* |
| Ga0066696_106640512 | 3300006032 | Soil | PYDVAATLIHSADERIPVADLELGLDWLRYAAQTVLV* |
| Ga0075366_101087921 | 3300006195 | Populus Endosphere | LIHSADERIEVEDLELGVRFLRHAAVEVGSLPSAA* |
| Ga0074059_121324593 | 3300006578 | Soil | ELAARLIHSADERIPVEDLELGVSFMRHAAQAMLT* |
| Ga0079222_121950361 | 3300006755 | Agricultural Soil | ETAARLIHSANERVPVSDLELGVRWLRHAAQTVCA* |
| Ga0066653_106410062 | 3300006791 | Soil | RLIHSADERVPVEDLELGVDFLRHAARTLLGPAG* |
| Ga0066660_110248101 | 3300006800 | Soil | MPAEIAAKLVHSADERIPVTDLELGVEWMRYAARALLG* |
| Ga0079220_102845641 | 3300006806 | Agricultural Soil | PPEVATLLIHSADERVPVSDLELGVDWLRHAAHVVLG* |
| Ga0075420_1007334992 | 3300006853 | Populus Rhizosphere | TAARLIHSADERVPVDDLELGVSFLRAAAQSLLRA* |
| Ga0075424_1000575701 | 3300006904 | Populus Rhizosphere | AARLIHSADERIAVDDLDLGLQFLRYAAVRVCGGASTA* |
| Ga0079219_121850942 | 3300006954 | Agricultural Soil | PPEVAARLIHSHDERVPVADVELGLRWLLHAARTVCG* |
| Ga0105240_113991482 | 3300009093 | Corn Rhizosphere | PSRTMAPEVAARLIHSANERVPVADVELGLRWLLQAARSVCG* |
| Ga0126307_115112032 | 3300009789 | Serpentine Soil | MDLRVAARLIHSANERVPVEDLDLGVRFLRHAARAICA* |
| Ga0126313_106526932 | 3300009840 | Serpentine Soil | FPACALDPAVAARLIHSANERVPVADLELGVRFLRHASLATCR* |
| Ga0126305_100275015 | 3300010036 | Serpentine Soil | ACALDPAVAARLIHSANERVPVADLELGVRFLRHASLATCR* |
| Ga0126318_105466411 | 3300010152 | Soil | FPSTGELPPEVAASLVHSADERIPVSDLELGVSWLRHAAHAVLG* |
| Ga0134086_102358381 | 3300010323 | Grasslands Soil | DVAAALIHSADERVPTADLELGVEWLRHAAHAVCG* |
| Ga0134080_106099892 | 3300010333 | Grasslands Soil | LRVMDAELAVRLIHSADERIPVEDLELAVSFMRHAAQAMLA* |
| Ga0134071_107533192 | 3300010336 | Grasslands Soil | LAARLIHSADERIPVEDLELGVSFLRHAAHQIGAP* |
| Ga0126370_107479321 | 3300010358 | Tropical Forest Soil | ELPPEVAAGLVHSADERVPVSDLEVGVGWLRHAARAVLG* |
| Ga0126372_124892271 | 3300010360 | Tropical Forest Soil | EVAAELVHSADERIPVSDLEAGVSWLRYAARAVLG* |
| Ga0126377_111944252 | 3300010362 | Tropical Forest Soil | LSPEVAAELVHSADERIPVSDLEAGVSWLRHAARAVLG* |
| Ga0126377_117926971 | 3300010362 | Tropical Forest Soil | ELPPEVAAGLVHSADERIPVSDLRAGVSWLRFAARAVLS* |
| Ga0134125_113015392 | 3300010371 | Terrestrial Soil | EVAARLIHSANERVPVADVELGLRWLLQAARSVCG* |
| Ga0126381_1012244061 | 3300010376 | Tropical Forest Soil | LPPEVAASLVHSADERVPVSDLELGVSWLRHAAQSVLG* |
| Ga0126381_1043584292 | 3300010376 | Tropical Forest Soil | GELPPEVAASLIHSADERIPVADLEYGVSWLRYAAHAVLG* |
| Ga0134126_121234932 | 3300010396 | Terrestrial Soil | TGDLPPEVAALLVHSADERVPVSDLELGVDWLRHAAHSILG* |
| Ga0126350_120519901 | 3300010880 | Boreal Forest Soil | PMRTMPADVSATLIHSADERIPVDDLALNVDWFRFAAHAMLA* |
| Ga0138513_1000009072 | 3300011000 | Soil | MEPEVAARLIHSADERIELDDLELGMRFLRHAASALPSLP* |
| Ga0120175_10298412 | 3300011971 | Permafrost | MDAELAARLIHSADERIPVEDLELAVSFMRHAAQAMLA* |
| Ga0137389_103269921 | 3300012096 | Vadose Zone Soil | AEAALLIHSANVRVQVDDLELGVRFLRHAAHAMLG* |
| Ga0137364_106989121 | 3300012198 | Vadose Zone Soil | ELAARLIHSADERIPVEDLELGVSFLRYAAQAMVA* |
| Ga0137382_111144841 | 3300012200 | Vadose Zone Soil | MDAEVAARLIHSADERVPVDDLETGVEWLRHAARHVLAG* |
| Ga0137374_105016062 | 3300012204 | Vadose Zone Soil | EVAARLIHSANERVPVEDLDLGVRFLRHAAQAICG* |
| Ga0150985_1194127111 | 3300012212 | Avena Fatua Rhizosphere | PEVAGSLIHSADERIPVADIELGVGWLRHAARAMLG* |
| Ga0137368_105088851 | 3300012358 | Vadose Zone Soil | PARAMHPAQAALLIHSANERVPVEDLDLGVRFVRHAARALLG* |
| Ga0136614_102719471 | 3300012684 | Polar Desert Sand | SARLIHSADERLAIDDLELGVRFLRHVATELGRGN* |
| Ga0157285_100882222 | 3300012897 | Soil | ELAARLIHSADERVPVDDLELGVEFLRAAAAGAGAR* |
| Ga0137359_113546711 | 3300012923 | Vadose Zone Soil | AYGFFPSTGELPPEVAATLIHSADERIPVSDLELAVGWLRYAAHAVLS* |
| Ga0164300_103955811 | 3300012951 | Soil | ELMAQLIHSADERILIDDLELGLAWLRHAARTLLS* |
| Ga0164302_105986681 | 3300012961 | Soil | MDPETAARLIHSANERVPVSDLEPGVRWLRHAAQAVCA* |
| Ga0134077_104240391 | 3300012972 | Grasslands Soil | LAARLIHSADERIPVEDLELGARFLLHVVRTLEG* |
| Ga0164309_119352222 | 3300012984 | Soil | PEVAASLIHSADERIPVADLELGVGWLRHAARAMLG* |
| Ga0164307_104150182 | 3300012987 | Soil | SRAMPAELAARLIHSADERIPVEDLELGVSFMRHAAQAMLT* |
| Ga0164307_105407301 | 3300012987 | Soil | SRAMDAETAARLIHSANERVPVSDLQLGVRWLRHAAQAVCA* |
| Ga0164306_107910761 | 3300012988 | Soil | PPEVAASLIHSADERIPVTDIELGVGWLRHAARAMLG* |
| Ga0157373_102990342 | 3300013100 | Corn Rhizosphere | LRTMPAEVAATLIHSADERAAVDDLELGVDWLRFAARAVLA* |
| Ga0157370_120585011 | 3300013104 | Corn Rhizosphere | GTVAYGFFPSTGELPAEVAASLIHSHDERIPVSDLEHALDWLRFAARAILG* |
| Ga0157378_116591162 | 3300013297 | Miscanthus Rhizosphere | LPPEVAASLIHSADERIPVADIELGVGWLRHAARAMLG* |
| Ga0157372_108870961 | 3300013307 | Corn Rhizosphere | RAMEPEVAARLIHSANERVPVADVELGLRWLLHAARTVCG* |
| Ga0120158_100666341 | 3300013772 | Permafrost | EAAARLIHSADERVPVADLELGVRWLLHVARSVCA* |
| Ga0120158_101670971 | 3300013772 | Permafrost | MPAEVAAQLIHSADERIPVDDLELGLDWLRFVARAVCG* |
| Ga0157377_115226311 | 3300014745 | Miscanthus Rhizosphere | TAARLIHSADERVPVEDLELGVEFLRHAAKSLLSTA* |
| Ga0120170_10988222 | 3300014823 | Permafrost | PPEVAASLIHSADERIPVSDLELGVGWLRHAAHAVLG* |
| Ga0157376_129904301 | 3300014969 | Miscanthus Rhizosphere | GELPAEVAASLIHSHDERIPVSDLEHALDWLRFAAGAILG* |
| Ga0137411_13812729 | 3300015052 | Vadose Zone Soil | MAPMEAAQLIHSADERVPVDDLELGLDWLRFAAGAVCG* |
| Ga0132256_1022734741 | 3300015372 | Arabidopsis Rhizosphere | PELVARLEHSADERIPVDDLELGVDALRHVALALL* |
| Ga0132257_1003779011 | 3300015373 | Arabidopsis Rhizosphere | ETAARLIHSADERVPVEDLELGVDFLRHAAKSLLSTA* |
| Ga0187779_109797611 | 3300017959 | Tropical Peatland | EVAATLIHSADERIPVADLELGVRWLRHAADAMLG |
| Ga0187777_103608901 | 3300017974 | Tropical Peatland | LPPEVAASLIHSADERVPVSDLELGVGWLRHAALAVLG |
| Ga0187777_109817092 | 3300017974 | Tropical Peatland | GELPADVAATLIHSADERIPVADLELGVQWLRHATQSMLG |
| Ga0187777_110265472 | 3300017974 | Tropical Peatland | DPELAARLIHSADERVPVADLELGVRFLRHAAQTVCA |
| Ga0187774_112368862 | 3300018089 | Tropical Peatland | PARAMPPDLAASLIHAADERVPVSDLELGVEWLRHVARTVVG |
| Ga0066667_115491731 | 3300018433 | Grasslands Soil | RAMDPEVASRLVHSADERVPVEDLELGVEWMRFGAEHLLSG |
| Ga0066662_129757512 | 3300018468 | Grasslands Soil | PAEVAATLIHSADERIPVTDLELGVNWLRHAAQRVLA |
| Ga0190271_134177401 | 3300018481 | Soil | MEAELAARLIHSADERIPIDDLELTVAAYRHVALTLS |
| Ga0193741_10077724 | 3300019884 | Soil | RTMEPEIAARLIHAADERIELEDLELGVRFLRHAAEGVASLP |
| Ga0193732_10780621 | 3300020012 | Soil | MPAELAARLIHSADERIPVEDLELGVSFMRHAAQAMLT |
| Ga0193724_10249681 | 3300020062 | Soil | QLAATLIHSADERVPSSDLELGVDWLRHVARTLGG |
| Ga0206353_110479091 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | TMAPEVAARLIHSANERVPVADVELGLRWLLQAARSVCG |
| Ga0206353_114582232 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | PYRAMTPALAATLIHSADERVPVSDLELGVDWLRHAARTVCA |
| Ga0126371_113483062 | 3300021560 | Tropical Forest Soil | MTAEMPPEVAAYLVHSADERVPVADLEFGVRWLRHAAHAVLG |
| Ga0210142_10725951 | 3300025552 | Natural And Restored Wetlands | AARLIHSADERVPVADLELGVRFLRHAARAVCGADAH |
| Ga0207647_106126482 | 3300025904 | Corn Rhizosphere | MDPEVASRLIHSADERVPVADVELGLRWLLHAARTVCG |
| Ga0207705_104517731 | 3300025909 | Corn Rhizosphere | PELMAALIHSADERIPVDDLELGTTWLRHAARTLLS |
| Ga0207660_102259401 | 3300025917 | Corn Rhizosphere | SELMAAVIHSADERVPIDDLELGVTWLRHAARTLLS |
| Ga0207664_119346691 | 3300025929 | Agricultural Soil | RDLDSEIAARLIHSADERVPVTDLELGVRWLRHAAQTVCA |
| Ga0207665_103149312 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RAMTPALAATLIHSADERVPVSDLELGVDWLRHAARTVCA |
| Ga0207667_107168772 | 3300025949 | Corn Rhizosphere | DAETAARLIHSANERVPVSDLELGTRWLRHAAQSVCD |
| Ga0207667_121215731 | 3300025949 | Corn Rhizosphere | GELPAEVAASLIHSHDERIPVSDLEHALGWLRHAARAVLA |
| Ga0208906_10215772 | 3300025987 | Rice Paddy Soil | MPADVIAQLIHSADERIPVDDLVLGLDWLRYAAKTLLA |
| Ga0207703_119149232 | 3300026035 | Switchgrass Rhizosphere | AELAARLIHSADERIPVEDLELGVSFMRHAAQAMLV |
| Ga0207639_105235941 | 3300026041 | Corn Rhizosphere | PSSGELPPEVAASLIHSADERIPVADIELGVGWLRHAARAMLG |
| Ga0209265_10843612 | 3300026308 | Soil | MPSEEAALLIHSADERVPVADLELGVDWLRHAAHAVLG |
| Ga0265319_10380181 | 3300028563 | Rhizosphere | AEVAAHLIHSADERVPVDDLELGVDWLRFAARAVCG |
| Ga0307322_100008289 | 3300028710 | Soil | AELAARLIHSADERIPVEDLELGVSFMRHAAQAMLT |
| Ga0307301_101154121 | 3300028719 | Soil | VMDAELAARLIHSADERIPVEDLELAVSFMRHAAQAMLA |
| Ga0307319_102482952 | 3300028722 | Soil | PETAALLIHSANERVPVDDLELGVGFLRHAARVIGGIRL |
| Ga0307320_101348032 | 3300028771 | Soil | PSLVMPIETAARLIHSADERVPVEDLELGVSFMRHAAQTVLGS |
| Ga0307284_100420191 | 3300028799 | Soil | ELAARLIHSADERIPVEDLELAVSFMRSAAQAMLA |
| Ga0307277_105042191 | 3300028881 | Soil | AELAARLIHSADERIPVEDLELAVGFMRHAAQAMLA |
| Ga0307304_100123981 | 3300028885 | Soil | MPIETAARLIHSADERVPVEDLELGVSFMRHAAQTVLGS |
| Ga0307416_1012433101 | 3300032002 | Rhizosphere | RAMHPAEAALLIHSADERVPAEDLELGVRFLRQAARTLLR |
| Ga0318510_104230862 | 3300032064 | Soil | FPSTGELPPEIAASLIHSADERIPVSDLELGVSWLRHAARSILG |
| Ga0335084_114947282 | 3300033004 | Soil | AARLIHSANERIEVDDLELGVEFLRHVARTVGEPA |
| Ga0364945_0240733_10_126 | 3300034115 | Sediment | MDPEVAAKLIHSADERIEVEDLELGVRFLRHVAATLGR |
| ⦗Top⦘ |