| Basic Information | |
|---|---|
| Family ID | F073662 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PINLPNMLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.500 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (22.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (79.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02606 | LpxK | 81.67 |
| PF04413 | Glycos_transf_N | 6.67 |
| PF03717 | PBP_dimer | 0.83 |
| PF00664 | ABC_membrane | 0.83 |
| PF05726 | Pirin_C | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| PF00009 | GTP_EFTU | 0.83 |
| PF13177 | DNA_pol3_delta2 | 0.83 |
| PF00271 | Helicase_C | 0.83 |
| PF00107 | ADH_zinc_N | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| PF13419 | HAD_2 | 0.83 |
| PF06267 | DUF1028 | 0.83 |
| PF01709 | Transcrip_reg | 0.83 |
| PF03626 | COX4_pro | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG1663 | Tetraacyldisaccharide-1-P 4'-kinase (Lipid A 4'-kinase) | Cell wall/membrane/envelope biogenesis [M] | 81.67 |
| COG1519 | 3-deoxy-D-manno-octulosonic-acid transferase | Cell wall/membrane/envelope biogenesis [M] | 6.67 |
| COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.83 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.83 |
| COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.50 % |
| All Organisms | root | All Organisms | 27.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000251|LPjun08P16500mDRAFT_1032333 | Not Available | 563 | Open in IMG/M |
| 3300001522|Mariner_1049617 | Not Available | 914 | Open in IMG/M |
| 3300005593|Ga0066837_10348926 | Not Available | 516 | Open in IMG/M |
| 3300005604|Ga0066852_10120746 | Not Available | 928 | Open in IMG/M |
| 3300005605|Ga0066850_10248811 | Not Available | 634 | Open in IMG/M |
| 3300006077|Ga0081594_1242311 | Not Available | 634 | Open in IMG/M |
| 3300006090|Ga0082015_1041710 | Not Available | 742 | Open in IMG/M |
| 3300006308|Ga0068470_1423289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300006313|Ga0068472_10280085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005 | 4227 | Open in IMG/M |
| 3300006313|Ga0068472_10309288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1491 | Open in IMG/M |
| 3300006313|Ga0068472_10392818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2049 | Open in IMG/M |
| 3300006313|Ga0068472_10916761 | Not Available | 663 | Open in IMG/M |
| 3300006323|Ga0068497_1099472 | Not Available | 605 | Open in IMG/M |
| 3300006323|Ga0068497_1163970 | Not Available | 723 | Open in IMG/M |
| 3300006330|Ga0068483_1356044 | Not Available | 514 | Open in IMG/M |
| 3300006331|Ga0068488_1459714 | Not Available | 638 | Open in IMG/M |
| 3300006336|Ga0068502_1267866 | Not Available | 1132 | Open in IMG/M |
| 3300006336|Ga0068502_1305162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1453 | Open in IMG/M |
| 3300006336|Ga0068502_1451078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Thioglobus → unclassified Candidatus Thioglobus → Candidatus Thioglobus sp. NP1 | 649 | Open in IMG/M |
| 3300006336|Ga0068502_1757430 | Not Available | 711 | Open in IMG/M |
| 3300006338|Ga0068482_1457376 | Not Available | 746 | Open in IMG/M |
| 3300006338|Ga0068482_1722738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 622 | Open in IMG/M |
| 3300006341|Ga0068493_10197009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 10311 | Open in IMG/M |
| 3300006341|Ga0068493_10408131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1875 | Open in IMG/M |
| 3300006341|Ga0068493_10445060 | Not Available | 749 | Open in IMG/M |
| 3300006341|Ga0068493_10642543 | Not Available | 1231 | Open in IMG/M |
| 3300006341|Ga0068493_11138110 | Not Available | 510 | Open in IMG/M |
| 3300006346|Ga0099696_1111680 | Not Available | 881 | Open in IMG/M |
| 3300006346|Ga0099696_1308454 | Not Available | 507 | Open in IMG/M |
| 3300006347|Ga0099697_1434103 | Not Available | 773 | Open in IMG/M |
| 3300006567|Ga0099958_1094216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1444 | Open in IMG/M |
| 3300007160|Ga0099959_1061362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3043 | Open in IMG/M |
| 3300007283|Ga0066366_10305716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 676 | Open in IMG/M |
| 3300007283|Ga0066366_10309623 | Not Available | 672 | Open in IMG/M |
| 3300007291|Ga0066367_1151989 | Not Available | 874 | Open in IMG/M |
| 3300007291|Ga0066367_1264550 | Not Available | 670 | Open in IMG/M |
| 3300007291|Ga0066367_1399950 | Not Available | 550 | Open in IMG/M |
| 3300007504|Ga0104999_1151152 | Not Available | 813 | Open in IMG/M |
| 3300007514|Ga0105020_1233429 | Not Available | 1238 | Open in IMG/M |
| 3300007515|Ga0105021_1149040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1363 | Open in IMG/M |
| 3300007777|Ga0105711_1156555 | Not Available | 875 | Open in IMG/M |
| 3300008629|Ga0115658_1067959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2114 | Open in IMG/M |
| 3300008735|Ga0115657_1029740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4476 | Open in IMG/M |
| 3300008954|Ga0115650_1357796 | Not Available | 692 | Open in IMG/M |
| 3300009104|Ga0117902_1108944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3010 | Open in IMG/M |
| 3300009104|Ga0117902_1402272 | Not Available | 1213 | Open in IMG/M |
| 3300009104|Ga0117902_1417808 | Not Available | 1180 | Open in IMG/M |
| 3300009108|Ga0117920_1027609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2950 | Open in IMG/M |
| 3300009109|Ga0117922_1070520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1882 | Open in IMG/M |
| 3300009126|Ga0118723_1211290 | Not Available | 1056 | Open in IMG/M |
| 3300009126|Ga0118723_1251366 | Not Available | 919 | Open in IMG/M |
| 3300009370|Ga0118716_1201692 | Not Available | 937 | Open in IMG/M |
| 3300009376|Ga0118722_1142290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1550 | Open in IMG/M |
| 3300009409|Ga0114993_10020783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5467 | Open in IMG/M |
| 3300009409|Ga0114993_10361707 | Not Available | 1095 | Open in IMG/M |
| 3300009409|Ga0114993_10607062 | Not Available | 804 | Open in IMG/M |
| 3300009481|Ga0114932_10586112 | Not Available | 653 | Open in IMG/M |
| 3300009703|Ga0114933_10444897 | Not Available | 845 | Open in IMG/M |
| 3300009703|Ga0114933_10926793 | Not Available | 553 | Open in IMG/M |
| 3300009705|Ga0115000_10044214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3069 | Open in IMG/M |
| 3300009706|Ga0115002_10326781 | Not Available | 1151 | Open in IMG/M |
| 3300009706|Ga0115002_10329614 | Not Available | 1145 | Open in IMG/M |
| 3300009706|Ga0115002_10491400 | Not Available | 894 | Open in IMG/M |
| 3300009786|Ga0114999_10174032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1805 | Open in IMG/M |
| 3300009786|Ga0114999_10471265 | Not Available | 974 | Open in IMG/M |
| 3300009786|Ga0114999_10705049 | Not Available | 755 | Open in IMG/M |
| 3300010883|Ga0133547_10205018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4196 | Open in IMG/M |
| 3300010883|Ga0133547_10287105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3427 | Open in IMG/M |
| 3300010883|Ga0133547_11842851 | Not Available | 1116 | Open in IMG/M |
| 3300012950|Ga0163108_10273183 | Not Available | 1087 | Open in IMG/M |
| 3300012954|Ga0163111_10717464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → alpha proteobacterium HIMB59 | 945 | Open in IMG/M |
| 3300012954|Ga0163111_12310291 | Not Available | 545 | Open in IMG/M |
| 3300013110|Ga0171652_1049850 | Not Available | 1102 | Open in IMG/M |
| 3300013110|Ga0171652_1097945 | Not Available | 641 | Open in IMG/M |
| 3300013115|Ga0171651_1004684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 7538 | Open in IMG/M |
| 3300020254|Ga0211669_1042073 | Not Available | 638 | Open in IMG/M |
| 3300020369|Ga0211709_10128945 | Not Available | 774 | Open in IMG/M |
| 3300020369|Ga0211709_10185917 | Not Available | 628 | Open in IMG/M |
| 3300020375|Ga0211656_10157057 | Not Available | 694 | Open in IMG/M |
| 3300020399|Ga0211623_10315755 | Not Available | 557 | Open in IMG/M |
| 3300020412|Ga0211552_10096180 | Not Available | 1006 | Open in IMG/M |
| 3300020415|Ga0211553_10034764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2211 | Open in IMG/M |
| 3300020427|Ga0211603_10250725 | Not Available | 669 | Open in IMG/M |
| 3300020428|Ga0211521_10223629 | Not Available | 854 | Open in IMG/M |
| 3300020444|Ga0211578_10450052 | Not Available | 539 | Open in IMG/M |
| 3300020445|Ga0211564_10394998 | Not Available | 679 | Open in IMG/M |
| 3300021068|Ga0206684_1110893 | Not Available | 923 | Open in IMG/M |
| 3300021084|Ga0206678_10155671 | Not Available | 1155 | Open in IMG/M |
| 3300022225|Ga0187833_10619691 | Not Available | 535 | Open in IMG/M |
| 3300022227|Ga0187827_10258375 | Not Available | 1144 | Open in IMG/M |
| 3300022227|Ga0187827_10359875 | Not Available | 916 | Open in IMG/M |
| 3300025235|Ga0208206_1042374 | Not Available | 580 | Open in IMG/M |
| 3300026074|Ga0208747_1001726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6568 | Open in IMG/M |
| 3300026262|Ga0207990_1113920 | Not Available | 670 | Open in IMG/M |
| 3300027827|Ga0209035_10648483 | Not Available | 500 | Open in IMG/M |
| 3300027844|Ga0209501_10417567 | Not Available | 790 | Open in IMG/M |
| 3300027847|Ga0209402_10278963 | Not Available | 1053 | Open in IMG/M |
| 3300028487|Ga0257109_1062349 | Not Available | 1175 | Open in IMG/M |
| 3300028489|Ga0257112_10109349 | Not Available | 1001 | Open in IMG/M |
| 3300028535|Ga0257111_1008920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3658 | Open in IMG/M |
| 3300028535|Ga0257111_1113496 | Not Available | 848 | Open in IMG/M |
| 3300028535|Ga0257111_1178897 | Not Available | 638 | Open in IMG/M |
| 3300028535|Ga0257111_1218771 | Not Available | 561 | Open in IMG/M |
| 3300031800|Ga0310122_10139926 | Not Available | 1168 | Open in IMG/M |
| 3300031801|Ga0310121_10059468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2544 | Open in IMG/M |
| 3300031802|Ga0310123_10444987 | Not Available | 825 | Open in IMG/M |
| 3300031802|Ga0310123_10447715 | Not Available | 822 | Open in IMG/M |
| 3300031802|Ga0310123_10934813 | Not Available | 507 | Open in IMG/M |
| 3300031802|Ga0310123_10940421 | Not Available | 505 | Open in IMG/M |
| 3300031803|Ga0310120_10151610 | Not Available | 1296 | Open in IMG/M |
| 3300031803|Ga0310120_10583277 | Not Available | 551 | Open in IMG/M |
| 3300031861|Ga0315319_10231320 | Not Available | 932 | Open in IMG/M |
| 3300031861|Ga0315319_10359774 | Not Available | 732 | Open in IMG/M |
| 3300032006|Ga0310344_10125284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2154 | Open in IMG/M |
| 3300032011|Ga0315316_10057396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3118 | Open in IMG/M |
| 3300032011|Ga0315316_10137196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2022 | Open in IMG/M |
| 3300032048|Ga0315329_10491471 | Not Available | 653 | Open in IMG/M |
| 3300032278|Ga0310345_10963202 | Not Available | 833 | Open in IMG/M |
| 3300032278|Ga0310345_12371710 | Not Available | 512 | Open in IMG/M |
| 3300032360|Ga0315334_11325364 | Not Available | 620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.50% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 14.17% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 13.33% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.17% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 8.33% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 6.67% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 5.00% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.50% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.67% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.83% |
| Water Column | Environmental → Aquatic → Marine → Coastal → Unclassified → Water Column | 0.83% |
| Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 0.83% |
| Diffuse Hydrothermal Fluid | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid | 0.83% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000251 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P16 500m | Environmental | Open in IMG/M |
| 3300001522 | Hydrothermal vent plume microbial communities from Mariner/Tui Malila, Pacific Ocean, of black smokers | Environmental | Open in IMG/M |
| 3300005593 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 | Environmental | Open in IMG/M |
| 3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300006077 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid B | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006323 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0500m | Environmental | Open in IMG/M |
| 3300006330 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_1000m | Environmental | Open in IMG/M |
| 3300006331 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006346 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0770m | Environmental | Open in IMG/M |
| 3300006347 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_1000m | Environmental | Open in IMG/M |
| 3300006567 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770m | Environmental | Open in IMG/M |
| 3300007160 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_1000m | Environmental | Open in IMG/M |
| 3300007283 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300007504 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007515 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300007777 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300008629 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300008735 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300008954 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009108 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300009109 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300009126 | Combined Assembly of Gp0139357, Gp0139356 | Environmental | Open in IMG/M |
| 3300009370 | Combined Assembly of Gp0127930, Gp0127931 | Environmental | Open in IMG/M |
| 3300009376 | Combined Assembly of Gp0137079, Gp0137080 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013110 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300013115 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300020254 | Marine microbial communities from Tara Oceans - TARA_B100001013 (ERX555924-ERR599085) | Environmental | Open in IMG/M |
| 3300020369 | Marine microbial communities from Tara Oceans - TARA_B100000446 (ERX556016-ERR599044) | Environmental | Open in IMG/M |
| 3300020375 | Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX555974-ERR599132) | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300020412 | Marine microbial communities from Tara Oceans - TARA_B100001167 (ERX556053-ERR599047) | Environmental | Open in IMG/M |
| 3300020415 | Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166) | Environmental | Open in IMG/M |
| 3300020427 | Marine microbial communities from Tara Oceans - TARA_B000000460 (ERX555922-ERR598960) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020444 | Marine microbial communities from Tara Oceans - TARA_B100001245 (ERX556114-ERR598980) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025235 | Marine microbial communities from the Deep Pacific Ocean - MP1483 (SPAdes) | Environmental | Open in IMG/M |
| 3300026074 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026262 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028487 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
| 3300031861 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPjun08P16500mDRAFT_10323331 | 3300000251 | Marine | SKFPNPILIFCLIIFFDQKRGPINLPNMLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI* |
| Mariner_10496171 | 3300001522 | Hydrothermal Vent Plume | ILPRFDAFLRPIILKMQNKEIILVNSKKYLIIFI* |
| Ga0066837_103489262 | 3300005593 | Marine | NNGPINFPKMAPRFEAFFRPIILKMMNKEIILMNSKKYLIVFI* |
| Ga0066852_101207461 | 3300005604 | Marine | TLPRFDAFLKPIILKIQNNEIILTHSKKYLIIFI* |
| Ga0066850_102488111 | 3300005605 | Marine | DLKNGPINFPRMLPIFDAFLRPIILNMQNSDIILINSKKYLITFI* |
| Ga0081594_12423112 | 3300006077 | Diffuse Hydrothermal Fluid | INLPSMLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI* |
| Ga0082015_10417101 | 3300006090 | Marine | FPKMAPKFEAFFRPIILKMVNKEIIPMNSKKYLIVFI* |
| Ga0068470_14232892 | 3300006308 | Marine | PINLPSMLPRFDAFLRPTILNMQNKEIMLINSKKYLIIFI* |
| Ga0068472_102800855 | 3300006313 | Marine | DLNSGPTNLPSILPIFDAFLRPIILKIENKEIMHINSKK* |
| Ga0068472_103092881 | 3300006313 | Marine | KYFPNKDPRLDELVRPIILNIENKEIMLMNSKKYLIIFI* |
| Ga0068472_103928184 | 3300006313 | Marine | PRTLPRLDAFLRPIILKIQNNEIMLINSKKYLMIFI* |
| Ga0068472_109167612 | 3300006313 | Marine | PRMLPRLDAFLSPIILKMQNKEIIIINSKKYFIIFIYFFLLIL* |
| Ga0068497_10994721 | 3300006323 | Marine | VIFFDLKKGPIDFPNKLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI* |
| Ga0068497_11639701 | 3300006323 | Marine | SIAPRLDAFLSPIILKMQNKEIMLINSKKYLIIFI* |
| Ga0068483_13560442 | 3300006330 | Marine | SLPSTLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI* |
| Ga0068488_14597143 | 3300006331 | Marine | DLNNGPIYLPRILPRFDAFRKPIILNIENKEIMLMNSKKYLIIFI* |
| Ga0068502_12678663 | 3300006336 | Marine | FPRILPTLDAFLKPIILKMQNNEIMLINSKKYLIIFI* |
| Ga0068502_13051621 | 3300006336 | Marine | YLPSTLPRLDAFLKPIILKILNREIMLINSKKYLTIFI* |
| Ga0068502_14510781 | 3300006336 | Marine | SVIFFDLKKGPISLPSILPRFDAFLRPTILKMQNKEIMLINSKKYLIIFI* |
| Ga0068502_17574302 | 3300006336 | Marine | LDAFFSPIILKMQNKEIIITNSKKYFIIFIYFFLLIL* |
| Ga0068482_14573761 | 3300006338 | Marine | TDLPKILPRFDAFLRPIILKIENKEIMLMNSKKYLIIFI* |
| Ga0068482_17227383 | 3300006338 | Marine | LKPVINLPNMLPRFDAFLRPIILKMQNKEIMLMNSKKYLTIFI* |
| Ga0068493_101970091 | 3300006341 | Marine | NPIFIFCLVIFFDLNNGPIDLPKKLPRFDAFLRPIILKIQNKEIMLMNSKKYLITLYDSIY* |
| Ga0068493_104081311 | 3300006341 | Marine | TLPRLDAFLRPIILKMQNNEIMLINSKKYLIIFI* |
| Ga0068493_104450601 | 3300006341 | Marine | IFFLITSFDLNKGPINLPSMLPRFDAFFRPIILKIQNKEITLMNSKKYLKIFI* |
| Ga0068493_106425433 | 3300006341 | Marine | PTNLPSKLPRFDAFLRPIILKIENKEIMLMNSKKYLIIFI* |
| Ga0068493_111381102 | 3300006341 | Marine | LVISFDLNNGPIDLPKILPRLDAFLRPIILKIQNKEIMLINSKKYLTIFI* |
| Ga0099696_11116801 | 3300006346 | Marine | FDLNNGPINLPRTLPRFDAFFRPIILKIENKEIMLINSKKYLIIFI* |
| Ga0099696_13084541 | 3300006346 | Marine | RMLPRFDAFFRPIILKIQNKEIIVMNSKKYLIIFI* |
| Ga0099697_14341031 | 3300006347 | Marine | GPTDFPRILPTLDAFLKPIILKMQNNEIMLINSKKYLIIFI* |
| Ga0099958_10942163 | 3300006567 | Marine | PTDFPRILPTLDAFLKPIILKMQNNEIMLINSKKYLIIFI* |
| Ga0099959_10613621 | 3300007160 | Marine | NNGPIDLPKILPRLDAFLRPIILKIQNNEIMLINSKKYLIIFI* |
| Ga0066366_103057161 | 3300007283 | Marine | NKGPTTLPIILPRLDAFLRPKILKIQNNDMIAADSKKYFTIFI* |
| Ga0066366_103096231 | 3300007283 | Marine | NNGPIVFPKMLPRFDALRNPIILKIENNEIMLINSKKYLIIFI* |
| Ga0066367_11519891 | 3300007291 | Marine | MISFDLNKGPIDLTIILPRLDAFLRPIILNIQNKEITIINSKKYLIIFI* |
| Ga0066367_12645502 | 3300007291 | Marine | FDLNSGPINLPSILPRFDAFLRPTILKIQNKEIMLMNSKKYLTIFI* |
| Ga0066367_13999502 | 3300007291 | Marine | NGPISFPKTLPRFEAFLNPIILKIQNNEIMLINSKKYLTIFI* |
| Ga0104999_11511522 | 3300007504 | Water Column | FMIFFDLNIGPKNFPMRPPMLDAFFKPIILKIQNKEITLINSKKYFIIFI* |
| Ga0105020_12334293 | 3300007514 | Marine | ISPNPVLIFCLIIFFDLNSGPIDLPKILPILDAFLRPIILKMQNNEIMHINSKKYLIIFI |
| Ga0105021_11490403 | 3300007515 | Marine | KALPRFEAFFRPIILKIQNSEIILTNSKKYLIIFI* |
| Ga0105711_11565551 | 3300007777 | Diffuse Vent Fluid, Hydrothermal Vents | KPPRFDAFLRPIILKMQNKEIILTNSKKYLIIFI* |
| Ga0115658_10679591 | 3300008629 | Marine | IFFDLKNGPTDIPKTLPRFDAFFKPIILNIQNKEIIHINSKKYLNIFI* |
| Ga0115657_10297401 | 3300008735 | Marine | FDLNIGPIDFPIIQPRLDAFLRPIILNIQNREIMIINSKKYLIIFI* |
| Ga0115650_13577962 | 3300008954 | Marine | LTIIFDLNKGPMNLPKIPPRYDAFFKPIILKIQNNEIMLINSKKYLKIFI* |
| Ga0117902_11089441 | 3300009104 | Marine | LNIGPKNFPMRPPMLDAFFKPIILKIQNKEITLINSKKYFIIFI* |
| Ga0117902_14022721 | 3300009104 | Marine | PSTLPRLEAFLRPIILKIQNREIMLINSKKYLIIFI* |
| Ga0117902_14178081 | 3300009104 | Marine | IFCLVISLDLNKGPINLPSILPRLEAFLRPIILNIKNKEIILINSKKYLIIFI* |
| Ga0117920_10276094 | 3300009108 | Marine | NSGPTNLPSTLPRSEAFLRPIILKIQKKEIMLINSKKYLTIFI* |
| Ga0117922_10705203 | 3300009109 | Marine | NPILIFCFVVFLDLKKGPNNLPSILPRLEAYLSPIILKIQKREITLVNSIKYFKIFI* |
| Ga0118723_12112902 | 3300009126 | Marine | SFDLNNGPINFPKMAPTFEAFFRPIILKMVNKEIILMNSKKYLIVFI* |
| Ga0118723_12513661 | 3300009126 | Marine | MLPRFDAFLKPIILKIENREIIIINSKKYLMIFI* |
| Ga0118716_12016922 | 3300009370 | Marine | KIPPRYDAFFKPIILKIQNNEIMLINSKKYLKIFI* |
| Ga0118722_11422903 | 3300009376 | Marine | KIPPAIDEFLRPIILNMQNSEMILINSKKYLIIFIIFS* |
| Ga0114993_100207831 | 3300009409 | Marine | LDLNSGPTSLPSTLPKSDAYLRPIILKIKNREIILINSIKYFMTFI* |
| Ga0114993_103617072 | 3300009409 | Marine | FPIIPPRLDAFLRPIILKIQNKEITLINSKKYLMGFI* |
| Ga0114993_106070622 | 3300009409 | Marine | FFDLNNGKIDLPKILPRFDAFLRPTILKIQNNEIMIINSKKYLTIFI* |
| Ga0114932_105861122 | 3300009481 | Deep Subsurface | KMLPRLDAFFRPIILNIQNKEITLINSKKYLIIFI* |
| Ga0114933_104448972 | 3300009703 | Deep Subsurface | FFDLNNGPTIIPKKLPRLEAFLGPIILKITNKDIILINSTRYFINFI* |
| Ga0114933_109267932 | 3300009703 | Deep Subsurface | IFCLIIFFDLNIGPINFPKIDPRFDAFLKPIILKIQNNEITLTNSKKYLIIFI* |
| Ga0115000_100442144 | 3300009705 | Marine | IMLPRFEAFLRPIILNMQNNEITLINSKKYFMVFI* |
| Ga0115002_103267812 | 3300009706 | Marine | LIIFFDLNSGPTDFPSILPTLDAFLKPIILKMKNNEIMLINSKKYLIIFI* |
| Ga0115002_103296142 | 3300009706 | Marine | LIIFFDLNNGPISLPKALPRFDAFFKPIILKIQNSEIMLTNSKKYLIIFI* |
| Ga0115002_104914001 | 3300009706 | Marine | DPRFDAFLRPNILNMENKEIMIINSKKYLIIFIYIF* |
| Ga0114999_101740321 | 3300009786 | Marine | DLPKMLPRLDAFLRPIILKIQNNEIMLINSKKYLTIFI* |
| Ga0114999_104712652 | 3300009786 | Marine | LNKGPIDLTIILPRLDAFLRPIILNIQNKEITIINSKKYLIIFI* |
| Ga0114999_107050491 | 3300009786 | Marine | FPIMLPSLDAFLRPTILKIQNKDITLTNSKKDLIVFI* |
| Ga0133547_102050181 | 3300010883 | Marine | SGPIACPRTLPRLDAFLRPIILKIQNNEIMLINSKKYLMIFI* |
| Ga0133547_102871054 | 3300010883 | Marine | PRLDAFFRPIILKIKNKEITLINSKKYLTTFIQFF* |
| Ga0133547_118428511 | 3300010883 | Marine | IFFDLNNGPISLPKILPRLDAFLKPIILKIQNNEIIVINSKKYLIIFI* |
| Ga0163108_102731831 | 3300012950 | Seawater | PSNFPKTLPRLEAFLKPIILNIQNNEIIIVNSKKYLINFI* |
| Ga0163111_107174641 | 3300012954 | Surface Seawater | KKGPTSFPKTPPKLEAFLKPIILNIQKKEIIIVNSKKYLINFI* |
| Ga0163111_123102911 | 3300012954 | Surface Seawater | NNGPTSFPKMLPRFDAFFNPIILKIQNNEIILINSKKYLIVFI* |
| Ga0171652_10498502 | 3300013110 | Marine | LKKGPANFPKTLPRLEAFLRPIILNIQNKEIIIVNSKKYLKIFI* |
| Ga0171652_10979451 | 3300013110 | Marine | GPIDFPITLPTFDAFLRPIILKIQNKEIIDINSKKYLIIFI* |
| Ga0171651_10046841 | 3300013115 | Marine | FDLKRGPKIFPRKPPKFEAFLSPIILNMQNKEIMLINSKKYLIIFI* |
| Ga0211669_10420731 | 3300020254 | Marine | INLPNMLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI |
| Ga0211709_101289451 | 3300020369 | Marine | RGPINLPNMLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI |
| Ga0211709_101859171 | 3300020369 | Marine | THFPKILPTFDAFLKPNILKIQNNEIILINSKKYLTIFI |
| Ga0211656_101570571 | 3300020375 | Marine | LPNMLPRFDAFLRPIILKIQNKEIMLINSKKYLIIFI |
| Ga0211623_103157552 | 3300020399 | Marine | DAFFSPIILKMQNKEIITINSKKYFTIFINFFLLIL |
| Ga0211552_100961802 | 3300020412 | Marine | DLKIGPINLPNMLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI |
| Ga0211553_100347641 | 3300020415 | Marine | PINLPNMLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI |
| Ga0211603_102507251 | 3300020427 | Marine | NNGPINLPNRPPKLEAFLIPIILKMQKREIMLTNSKKYLIIFI |
| Ga0211521_102236291 | 3300020428 | Marine | IFPNPVFIFFFIIFFDLKRGPIKDPNTLPRFDAFLRPSILNKTNKEVIVMNSKKYLIIFI |
| Ga0211578_104500521 | 3300020444 | Marine | IFFDLNNGPIDFPKMLPRLDAFLNPIILKIKNNEIMLINSKKYLIIFI |
| Ga0211564_103949982 | 3300020445 | Marine | KTLPRLEAFLKPIILNIQNNEIIIVNSKKYLINFI |
| Ga0206684_11108932 | 3300021068 | Seawater | IIFFDLNSGPTDFPRILPTLDAFLKPIILKMQNNEIMLINSKKYLIIFI |
| Ga0206678_101556713 | 3300021084 | Seawater | TDFPRTLPTLDAFLKPIILKMQNNEIMLINSKKYLIIFI |
| Ga0187833_106196911 | 3300022225 | Seawater | CLDLNNGPINLPRMLPRFDAFFRPIILKIQNKEIIVTNSKKYLIIFI |
| Ga0187827_102583751 | 3300022227 | Seawater | FDLNNGPINFPKMAPRFEAFFRPIILKMVNKEIILMNSKKYLIVFI |
| Ga0187827_103598752 | 3300022227 | Seawater | SFDLNNGPINFPKMAPRFEAFFRPIILKMANKEIILMNSKKYLIVFI |
| Ga0208206_10423742 | 3300025235 | Deep Ocean | PSMLPRFDAFLRPTILKMQNKEIMLINSKKYLIIFI |
| Ga0208747_10017261 | 3300026074 | Marine | LIFCLIIFFDLKRGPINLPNMLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI |
| Ga0207990_11139201 | 3300026262 | Marine | FDLKRGPINLPNMLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI |
| Ga0209035_106484831 | 3300027827 | Marine | NLPSMPPRFDAFFRPIILKILNKEITLMNSKKYLKIFI |
| Ga0209501_104175672 | 3300027844 | Marine | PKIDPRFDAFLRPNILNMENKEIMIINSKKYLIIFIYIF |
| Ga0209402_102789631 | 3300027847 | Marine | DLKKGPISFPKIDPRFDAFLRPNILNMENKEIMIINSKKYLMIFIYIF |
| Ga0257109_10623493 | 3300028487 | Marine | GPTDFPRILPTLDAFLKPIILKMQNNEIMLINSKKYLIIFI |
| Ga0257112_101093491 | 3300028489 | Marine | NSGPIILPIMLPREDAFLRPIILKIQNKEIMLINSKKYLIIFI |
| Ga0257111_10089201 | 3300028535 | Marine | RTLPTLDAFLKPIILKMQNNEIMLINSKKYLIIFI |
| Ga0257111_11134962 | 3300028535 | Marine | SLDLNSGPKSFPIDPPKFEAFFRPIILKIQKKEITVINSKKYLKIFI |
| Ga0257111_11788971 | 3300028535 | Marine | GPINFPKILPVFDAFLKPIILKIQNNEMMLINSKKYLKIFI |
| Ga0257111_12187711 | 3300028535 | Marine | GPITFPRMLPRLDAFFSPIILKMQNKEIITINSKKYFTIFIYLFLLIL |
| Ga0310122_101399263 | 3300031800 | Marine | NLPNTLPRFDAFLRPIILKMQNKEIILVNSKKYLIIFI |
| Ga0310121_100594684 | 3300031801 | Marine | LPNMLPRFDAFLRPIILKMQNKEIMLINSKKYLIIFI |
| Ga0310123_104449871 | 3300031802 | Marine | ILFSYFFDLKRGPINLPSTLPRFDAFLRPIILNMQNKEIMLTNSKKYLIIFI |
| Ga0310123_104477151 | 3300031802 | Marine | PINLPRILPRFDAFFRPTILKIENKEIILINSKKYLIIFI |
| Ga0310123_109348132 | 3300031802 | Marine | SVLPRLDAFLRPIILKIQNKEITLMNSKKYLIIFI |
| Ga0310123_109404212 | 3300031802 | Marine | KILPRLDAFLSPIILKIQNKEIMLMNSKKYLIIFI |
| Ga0310120_101516103 | 3300031803 | Marine | LNNGPINFPKILPVFDAFLKPIILKIQNNEMMLINSKKYLKIFI |
| Ga0310120_105832771 | 3300031803 | Marine | CLIIFFDLKKGPITFPRMLPRLDAFLSPIILKMQNKEIIIINSKKYFIIFINFFLLIL |
| Ga0315319_102313201 | 3300031861 | Seawater | RGPISLPSILPRFDAFLRPTILKMQNKEIMLINSKKYLIIFI |
| Ga0315319_103597742 | 3300031861 | Seawater | PKNLPSILPRFDAFFKPIILKIQKKEIILMNSKKYLKIFI |
| Ga0310344_101252841 | 3300032006 | Seawater | PKILPRLDAFLSPIILKIEKSEIILINSKKYLNNFI |
| Ga0315316_100573961 | 3300032011 | Seawater | GPINLPSKLPRLDAFLRPIILKIQNKEIMLINSKKYLIIFIQFFLFHQ |
| Ga0315316_101371961 | 3300032011 | Seawater | LIIFFDLNNGPIYTPRMLPRFDAFLNPIILKIQNNEIMIINSKKYLIIFI |
| Ga0315329_104914712 | 3300032048 | Seawater | FFDLKKGPITFPRMLPRLDAFFSPIILKMQNKEIITINSKKYFTIFINFFLLIL |
| Ga0310345_109632021 | 3300032278 | Seawater | KGPINFPKTPPRLEAFLRPIILNIQNKEIIIVNSKKYLINFI |
| Ga0310345_123717101 | 3300032278 | Seawater | PSIAPRLDAFLSPIILKMQNKEIMLINSKKYLIIFI |
| Ga0315334_113253641 | 3300032360 | Seawater | GPINLPRILPRFDAFFRPIILKMQNKEIILMNSKKYLKIFI |
| ⦗Top⦘ |