| Basic Information | |
|---|---|
| Family ID | F073627 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 49 residues |
| Representative Sequence | NSSQQIQKGLWGKRPDGTAYGDMREEYCVYSIERTFWQGRPLGGIGGEGKK |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.50 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (7.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.167 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.99% β-sheet: 2.53% Coil/Unstructured: 78.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02276 | CytoC_RC | 74.17 |
| PF12704 | MacB_PCD | 2.50 |
| PF12543 | DUF3738 | 1.67 |
| PF00106 | adh_short | 0.83 |
| PF13505 | OMP_b-brl | 0.83 |
| PF00496 | SBP_bac_5 | 0.83 |
| PF07366 | SnoaL | 0.83 |
| PF00069 | Pkinase | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| PF03781 | FGE-sulfatase | 0.83 |
| PF00144 | Beta-lactamase | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.33 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.83 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01BBKID | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 2170459017|G14TP7Y02HT1LR | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300000891|JGI10214J12806_11575490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-69-10 | 1671 | Open in IMG/M |
| 3300004114|Ga0062593_102466744 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300004463|Ga0063356_105069594 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005175|Ga0066673_10752752 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
| 3300005332|Ga0066388_100846833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1500 | Open in IMG/M |
| 3300005332|Ga0066388_101550076 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300005334|Ga0068869_100191149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1610 | Open in IMG/M |
| 3300005337|Ga0070682_100383469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300005338|Ga0068868_100893570 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300005343|Ga0070687_100436145 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300005344|Ga0070661_101210270 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005353|Ga0070669_101830014 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005366|Ga0070659_100104764 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
| 3300005457|Ga0070662_101583889 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005518|Ga0070699_102211763 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005526|Ga0073909_10463375 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005536|Ga0070697_101113935 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005541|Ga0070733_10184814 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300005543|Ga0070672_101068163 | Not Available | 717 | Open in IMG/M |
| 3300005544|Ga0070686_101006814 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005615|Ga0070702_101534462 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005616|Ga0068852_101792488 | Not Available | 636 | Open in IMG/M |
| 3300005719|Ga0068861_101811876 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005834|Ga0068851_10542416 | Not Available | 702 | Open in IMG/M |
| 3300005840|Ga0068870_11190913 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005842|Ga0068858_100100461 | All Organisms → cellular organisms → Bacteria | 2698 | Open in IMG/M |
| 3300006050|Ga0075028_100602081 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300006057|Ga0075026_100677713 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006358|Ga0068871_100121572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2206 | Open in IMG/M |
| 3300006845|Ga0075421_100633787 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300006854|Ga0075425_100733895 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300006854|Ga0075425_100771562 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300006854|Ga0075425_102431944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300007788|Ga0099795_10213834 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300009012|Ga0066710_101633346 | Not Available | 985 | Open in IMG/M |
| 3300009090|Ga0099827_10921865 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300009094|Ga0111539_12581896 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009098|Ga0105245_12121383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 616 | Open in IMG/M |
| 3300009157|Ga0105092_10461148 | Not Available | 726 | Open in IMG/M |
| 3300009176|Ga0105242_11817679 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300009176|Ga0105242_12524676 | Not Available | 562 | Open in IMG/M |
| 3300009551|Ga0105238_12317183 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300010046|Ga0126384_11115413 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300010046|Ga0126384_11816144 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010048|Ga0126373_11903172 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300010048|Ga0126373_11981368 | Not Available | 645 | Open in IMG/M |
| 3300010329|Ga0134111_10555954 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010343|Ga0074044_10880905 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300010362|Ga0126377_11494914 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010373|Ga0134128_12254957 | Not Available | 600 | Open in IMG/M |
| 3300010375|Ga0105239_12054178 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300010379|Ga0136449_102220120 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300010398|Ga0126383_13503740 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010398|Ga0126383_13620778 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010401|Ga0134121_10854830 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300010403|Ga0134123_11017666 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300011119|Ga0105246_12361495 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300011120|Ga0150983_13488884 | Not Available | 745 | Open in IMG/M |
| 3300011120|Ga0150983_15602415 | Not Available | 523 | Open in IMG/M |
| 3300011120|Ga0150983_15972292 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012199|Ga0137383_10304370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
| 3300012202|Ga0137363_11563807 | Not Available | 551 | Open in IMG/M |
| 3300012205|Ga0137362_11007673 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012206|Ga0137380_10486693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1088 | Open in IMG/M |
| 3300012357|Ga0137384_11550552 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012469|Ga0150984_101917745 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300012913|Ga0157298_10113093 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300012918|Ga0137396_10752138 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012971|Ga0126369_10246225 | Not Available | 1756 | Open in IMG/M |
| 3300014158|Ga0181521_10379277 | Not Available | 702 | Open in IMG/M |
| 3300014166|Ga0134079_10297639 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300014745|Ga0157377_11707660 | Not Available | 508 | Open in IMG/M |
| 3300014968|Ga0157379_12431812 | Not Available | 523 | Open in IMG/M |
| 3300015373|Ga0132257_102752755 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300016270|Ga0182036_10315792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1193 | Open in IMG/M |
| 3300017656|Ga0134112_10218387 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300017975|Ga0187782_10372995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
| 3300018044|Ga0187890_10761379 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300018061|Ga0184619_10352217 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300018066|Ga0184617_1158350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300021086|Ga0179596_10174374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1036 | Open in IMG/M |
| 3300021181|Ga0210388_11260754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300021402|Ga0210385_11321063 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021432|Ga0210384_10445797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
| 3300021444|Ga0213878_10443595 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300021560|Ga0126371_13225773 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300022214|Ga0224505_10113080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300022508|Ga0222728_1085317 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300022717|Ga0242661_1084738 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300022722|Ga0242657_1197837 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300025289|Ga0209002_10362851 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300025905|Ga0207685_10736831 | Not Available | 539 | Open in IMG/M |
| 3300025926|Ga0207659_10517386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300025927|Ga0207687_11332048 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300025930|Ga0207701_10415378 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300025930|Ga0207701_10811108 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300025935|Ga0207709_10865323 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300026023|Ga0207677_12011733 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300027911|Ga0209698_11381691 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300028381|Ga0268264_12128274 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300030760|Ga0265762_1143536 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300030945|Ga0075373_10926707 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031090|Ga0265760_10174629 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031128|Ga0170823_16234948 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300031231|Ga0170824_119980349 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031366|Ga0307506_10362926 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031474|Ga0170818_103430755 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031474|Ga0170818_104829604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300031708|Ga0310686_109102611 | Not Available | 521 | Open in IMG/M |
| 3300031708|Ga0310686_119668651 | Not Available | 1146 | Open in IMG/M |
| 3300031716|Ga0310813_10494450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1068 | Open in IMG/M |
| 3300031754|Ga0307475_10875017 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031820|Ga0307473_10862360 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031823|Ga0307478_10458807 | Not Available | 1060 | Open in IMG/M |
| 3300032160|Ga0311301_12622788 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300032261|Ga0306920_103916634 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300032515|Ga0348332_13172005 | Not Available | 1565 | Open in IMG/M |
| 3300034090|Ga0326723_0411775 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.83% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.83% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.83% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_992560 | 2040502001 | Soil | GKKVVLKLLNSSQQIQKGLWGKRPDGTAYGDIREEYCVYSIERTFWQGRPLDGVGGESKK |
| 4ZMR_00725390 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | NLMNSSQQIQKGLWGKRPDGTAYGDMREEYCVYSIERTFWQGRPLEGIGGEGKK |
| JGI10214J12806_115754901 | 3300000891 | Soil | NSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERTFWQGRPLDGIGGIGGDQK* |
| Ga0062593_1024667441 | 3300004114 | Soil | GKKVLKLMNSSQQIQRGLWGQRPDGTAYGDIREEYCVYSIERLFWQGRPLEGIGGEGKK* |
| Ga0063356_1050695942 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GLWGQRPDGTAYGDIREEYCVYSIERLFWQGRPLEGIGGEGKK* |
| Ga0066673_107527521 | 3300005175 | Soil | WGQRPDGTAYGDMREEYCVYSIERTFWQGRPLDGIGGTSGDKK* |
| Ga0066388_1008468331 | 3300005332 | Tropical Forest Soil | KVLKLMNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERAFWQGRPLEGIGGDKK* |
| Ga0066388_1015500761 | 3300005332 | Tropical Forest Soil | KVLKLMNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERTFWQGRPLEGIGGDKK* |
| Ga0068869_1001911492 | 3300005334 | Miscanthus Rhizosphere | LMNSSQQIQKGLWGKRPDGTAYGDMREEYCVYSIERSFWQGRPLDGVDGEDKK* |
| Ga0070682_1003834692 | 3300005337 | Corn Rhizosphere | LLNSSQQIQKGLWGKRADGTAYGDMREEYCVWSIERTFWQGRPLDGVGGDDKK* |
| Ga0068868_1008935701 | 3300005338 | Miscanthus Rhizosphere | QQIQKGLWGKRPDGTAYGDMREEYCVYSIERSFWQGRPLDGVGGEDKK* |
| Ga0070687_1004361451 | 3300005343 | Switchgrass Rhizosphere | GLWGQRPDGTAYGDMREEYCVYSIERSFWQGRPLDGIGGTGGDKK* |
| Ga0070661_1012102702 | 3300005344 | Corn Rhizosphere | MNSSQQIQKGLWGQRPDGSAYGDMREEYCVYSIERTFWQGRPLEGVGGEDKK* |
| Ga0070669_1018300142 | 3300005353 | Switchgrass Rhizosphere | GKKVLKLMNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERAFWQGRPLEGVGGEDNK* |
| Ga0070659_1001047643 | 3300005366 | Corn Rhizosphere | MNSSQQIQKGLWGKRADGTAYGDMREEYCVYSIERSFWQGRPLDGVGGEDKK* |
| Ga0070662_1015838891 | 3300005457 | Corn Rhizosphere | SQQIQRGLWGQRPDGTAYGDIREEYCVYSIERLFWQGRPLEGIGGEGKK* |
| Ga0070699_1022117631 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KVLNLMNSSQQIQRGLWGKRPDGTAYGDMREEYCVYSIERAFWQGRPLEGIGGESKK* |
| Ga0073909_104633751 | 3300005526 | Surface Soil | DGTAYGDIREEYCVYSIERTFWQGRPLDGIGGEGKK* |
| Ga0070697_1011139351 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | NSSQQIQKGLWGKRPDGTAYGDMREEYCVYSIERTFWQGRPLGGIGGEGKK* |
| Ga0070733_101848143 | 3300005541 | Surface Soil | SQQIQKGLWGRRPDGTAYGDMREEYCVYSIERKFWEGRPLGGIGGEDKK* |
| Ga0070672_1010681632 | 3300005543 | Miscanthus Rhizosphere | KLMNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIEQSFWQGRPLDGVGGEDKK* |
| Ga0070686_1010068142 | 3300005544 | Switchgrass Rhizosphere | QKGLWGQRPDGTAYGDMREEYCVYSIERAFWQGRPLEGIGGEGKK* |
| Ga0070702_1015344621 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIEQLFWQGRPLDGIGGEDKK* |
| Ga0068852_1017924881 | 3300005616 | Corn Rhizosphere | GLWGKRVDGTAYGDMREEYCVWSIERKFWEGRPLDGVGGDDKK* |
| Ga0068861_1018118762 | 3300005719 | Switchgrass Rhizosphere | QQIQKGLWGQRPDGTAYGDMREEYCVYSIERTFWQGRPLEGIGGDKK* |
| Ga0068851_105424162 | 3300005834 | Corn Rhizosphere | RADGTAYGDMREEYCVWSIERTFWQGRPLDGVGGDDKK* |
| Ga0068870_111909131 | 3300005840 | Miscanthus Rhizosphere | IQRGLWGQRPDGTAYGDMREEYCVYSIERAFWQGRPLEGVGGEDNK* |
| Ga0068858_1001004615 | 3300005842 | Switchgrass Rhizosphere | MNSSQQVQKGLWGKRPDGTAYGDIREEYCVYSIERSFWQGRPLDGVGGDAK* |
| Ga0075028_1006020811 | 3300006050 | Watersheds | GLWGKRPDGTAYGDIREEYCVYSIERTFWQGRPLGGIGGEGKK* |
| Ga0075026_1006777132 | 3300006057 | Watersheds | QQIQKGLWGKRPDGTAYGDIREEYCVYSIERAFWQGRPLEGVGGEGKK* |
| Ga0068871_1001215724 | 3300006358 | Miscanthus Rhizosphere | WSGKKVLKLINSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERTFWQGRPLDGIGGDKK |
| Ga0075421_1006337872 | 3300006845 | Populus Rhizosphere | QIQKGLWGQRPDGTAYGDMREEYCVYSIERSFWQGRPLEGISGDKK* |
| Ga0075425_1007338951 | 3300006854 | Populus Rhizosphere | LKLMNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERAFWQGRPLEGIGGEGKK* |
| Ga0075425_1007715621 | 3300006854 | Populus Rhizosphere | QIQKGLWGQRPDGTAYGDMREEYCVYSIERTFWQGRPLEGIGGDKK* |
| Ga0075425_1024319442 | 3300006854 | Populus Rhizosphere | GTAYGDIREEYCVYSIERTFWKGRPLEGIGGEGKK* |
| Ga0099795_102138341 | 3300007788 | Vadose Zone Soil | GTAYGDIREEYCVYSIERTFWQGRPLGGIGGEGKK* |
| Ga0066710_1016333462 | 3300009012 | Grasslands Soil | GKRPDGTAFGDIREEYCVYSIERTFWQGRPREGIGGEGKK |
| Ga0099827_109218652 | 3300009090 | Vadose Zone Soil | WGKRPDGTAYGDMREEYCVYSIERHFWEGRPLGGVGGEDKK* |
| Ga0111539_125818962 | 3300009094 | Populus Rhizosphere | GLWGQRPDGTAYGDIREEYCVYSIEQRFWQGRPLEGIGGEGKK* |
| Ga0105245_121213831 | 3300009098 | Miscanthus Rhizosphere | LNLRLLNSSQQIQKGLWGKRADGTAYGDMREEYCVYSIERTFWEGRPLGGIGGDDKK* |
| Ga0105092_104611482 | 3300009157 | Freshwater Sediment | DGTAYGDIREEYCVYSIEQSFWQGRPLDGVGGDDKK* |
| Ga0105242_118176791 | 3300009176 | Miscanthus Rhizosphere | RPDGTAYGDIREEYCVYSIERAFWQGRPLDGVGGEGKK* |
| Ga0105242_125246761 | 3300009176 | Miscanthus Rhizosphere | QQIQKGLWGKRADGTAYGDMREEYCVWSIERKFWEGRPLDGVGGDDKK* |
| Ga0105238_123171831 | 3300009551 | Corn Rhizosphere | SSQKIQKGLWGKRADGTAYGNMREEYCVWSIERTFWQGRPLDGVGGDDKK* |
| Ga0126384_111154132 | 3300010046 | Tropical Forest Soil | GQRPDGTAYGDIREEYCVYSIEQKFWQGRPLEGIGGEGKK* |
| Ga0126384_118161441 | 3300010046 | Tropical Forest Soil | SGKKVLKLMNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERTFWQGRPLEGVGGEGKK |
| Ga0126373_119031722 | 3300010048 | Tropical Forest Soil | WGKRPDGTAYGDMREEYCVYSIEQKFWQGRPLDGIGGEVKK* |
| Ga0126373_119813681 | 3300010048 | Tropical Forest Soil | LWGKKPDGTAYGDIREEYCVYSIEHQFWQGRPLDGVGGEDKK* |
| Ga0134111_105559541 | 3300010329 | Grasslands Soil | NLMNSSQQIQKGLWGKRPDGTAYGDIREEYCVYSIERTFWQGRPLGGIGGEGKK* |
| Ga0074044_108809051 | 3300010343 | Bog Forest Soil | QKGLWGKRPDGTAYGDMREEYCVYSIERRFWEGRPLEGIGGDDKK* |
| Ga0126377_114949142 | 3300010362 | Tropical Forest Soil | SGKKVLTLMNSSQQVQKGLWGQRPDGIAYGDMREEYCVYSIERAFWKGRPLEGIGGDKK* |
| Ga0134128_122549572 | 3300010373 | Terrestrial Soil | YGDMREEYCVYSIERSFWQGRPLDGIGGTGGDKK* |
| Ga0105239_120541781 | 3300010375 | Corn Rhizosphere | KLMNSSQQVQKGLWGKRPDGTAYGDIREEYCVYSIERQFWQGRPLEGVGGDDKK* |
| Ga0136449_1022201202 | 3300010379 | Peatlands Soil | GKSADGTAYGDMREEYCVYSIERKFWEGRPLGGIGGDAKK* |
| Ga0126383_135037402 | 3300010398 | Tropical Forest Soil | GKKTLRLLNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIEQKFWQGRPLEGVGASDKK* |
| Ga0126383_136207782 | 3300010398 | Tropical Forest Soil | LKLMNSSQQVQRGLWGQRPDGTAYGDMREEYCVYSIERTFWQGRPLEGIGGEGKK* |
| Ga0134121_108548302 | 3300010401 | Terrestrial Soil | LWGKRPDGTAYGDMREEYCVYSIERTFWQGRPLEGVGGESKK* |
| Ga0134123_110176662 | 3300010403 | Terrestrial Soil | KLINSSQQIQKGLWGKRPDGTAYGDIREEYCVYSIERAFWQGRPLEGIGGEGKK* |
| Ga0105246_123614951 | 3300011119 | Miscanthus Rhizosphere | KLMNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERAFWQGRPLEGVGGEDNK* |
| Ga0150983_134888842 | 3300011120 | Forest Soil | KLKLLNSSQQIQKGLWGKRSDGTAYGDMREEYCVWSIERSFWQGRPLDGVGGEDKK* |
| Ga0150983_156024151 | 3300011120 | Forest Soil | KKLKLKLMNSSQQIQKGLWGKRADGTAYGDMREEYCVYSIERKFWDGRPLGGIDGEDKK* |
| Ga0150983_159722922 | 3300011120 | Forest Soil | TAYGDMREEYCVYSIERRFWEGRPLGGVGGEDKK* |
| Ga0137383_103043701 | 3300012199 | Vadose Zone Soil | GTAYGDMREEYCVYSIERAFWQGRPLEGIGGEGKK* |
| Ga0137363_115638071 | 3300012202 | Vadose Zone Soil | RPDGTAYGDMREEYCVYSIERRFWEGRPLGGVGGEDKK* |
| Ga0137362_110076731 | 3300012205 | Vadose Zone Soil | KVLKLMNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERTFWQGRPLGGIGGEGKK* |
| Ga0137380_104866931 | 3300012206 | Vadose Zone Soil | RVVLKLLNSSQQIQKGLWGKRPDGTAYGDIREEYCVYSIERTFWQGRPLGGIGGEGKK* |
| Ga0137384_115505521 | 3300012357 | Vadose Zone Soil | SQQIQKGLWGKRPDGTAYGDIREEYCVYAIERAFWQVRPLEGMGGQGKK* |
| Ga0150984_1019177452 | 3300012469 | Avena Fatua Rhizosphere | KLLNSSQQVQKGLWGKRPDGTAYGDMREEYCFYSIEQKFWQGRPLDGIGGEGKK* |
| Ga0157298_101130932 | 3300012913 | Soil | SSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERAFWQGRPLEGVGGEDNK* |
| Ga0137396_107521381 | 3300012918 | Vadose Zone Soil | KVVLKLLNSSQQIQKGLWGKRPDGTAYGDIREEYCVYSIERTFWQGRPLGGIGGEGKK* |
| Ga0126369_102462252 | 3300012971 | Tropical Forest Soil | SSQQIQKGLWGQRPDGTAYGDIREEYCVYSIERTFWQGRPLDGIGGDKK* |
| Ga0181521_103792771 | 3300014158 | Bog | IQKGLWGKRPDGTAYGDMREEYCVYSIERSFWQGRPLEGVGGDDKK* |
| Ga0134079_102976391 | 3300014166 | Grasslands Soil | KGLWGKRPDGTAYGDMREEYCVYSIEQKFWQGRPLDGVGGEGKK* |
| Ga0157377_117076602 | 3300014745 | Miscanthus Rhizosphere | KLQLLNSSQQIQKGLWGKRADGTAYGDMREEYCVWSIERKFWEGRPLDGVGGDDKK* |
| Ga0157379_124318121 | 3300014968 | Switchgrass Rhizosphere | LKLQLLNSSQQIQKGLWGKRADGTAYGDMREEYCVWSIERKFWEGRPLDGVGGDDKK* |
| Ga0132257_1027527552 | 3300015373 | Arabidopsis Rhizosphere | KWMNSSQQIQKGLWGQRPDGSAYGDMREEYCVYSIERTFWQGRPLEGVGGEDKK* |
| Ga0182036_103157923 | 3300016270 | Soil | KLLNSSQQVQKGLWGKRADGTAYGDIREEYCVYSIERAFWQGRPLEGIGGDDKK |
| Ga0134112_102183872 | 3300017656 | Grasslands Soil | GKRPDGTPYGDIREEYCVYSIERAFWQGRPLDGISGDKK |
| Ga0187782_103729952 | 3300017975 | Tropical Peatland | PDGTAYGDIREEYCVYSIEQKFWQGRPLEGIGGDGKK |
| Ga0187890_107613791 | 3300018044 | Peatland | LMNSSQQVQKGLWGKRPDGTAYGDMREEYCVYSIERRFWEGRPLGGIGGDGGDAKQ |
| Ga0184619_103522171 | 3300018061 | Groundwater Sediment | NSSQQIQRGLWGTRPDGTAYGDMREEYCVYSIERAFWQGRPLEGIGGEGKK |
| Ga0184617_11583501 | 3300018066 | Groundwater Sediment | QIQRGVWGKRPDGTAYEDIREEYCVDSIERTFWQGRPLDGIGGTGGDRK |
| Ga0179596_101743742 | 3300021086 | Vadose Zone Soil | KVVLKLLNSSQQIQKGLWGKRPDGTAYGDIREEYCVYSIERTFWQGRPLGGIGGEGKK |
| Ga0210388_112607542 | 3300021181 | Soil | LWGKRADGTAYGDMREEYCVYSIERKFWEGRPLGGIDGEDKK |
| Ga0210385_113210631 | 3300021402 | Soil | VLRMINSSQQVQKGLWGQRPDGTAYGDIREEYCVYSIERQFWQGRPLDGVGDDNK |
| Ga0210384_104457972 | 3300021432 | Soil | LKLLNSSQQIQKGLWGKRPDGTAYGDIREEYCVYSIERTFWQGRPLGGIGGEGKK |
| Ga0213878_104435952 | 3300021444 | Bulk Soil | QKGLWGKRPDGTAYGDMREEYCVYSIEQKFWQGRPLDGIGGTTENKK |
| Ga0126371_132257731 | 3300021560 | Tropical Forest Soil | NPKRSLGEETDGTAYGDIREEYCVYSIEQKFWQGRPLDGVGAEEKK |
| Ga0224505_101130802 | 3300022214 | Sediment | KGMWGKRPDGTAYGDMREEYCVYSIERSFWEGRPLDGVSGNTK |
| Ga0222728_10853171 | 3300022508 | Soil | PDGTAYGDMREEYCVYSIERRFWEGRPLGGVGGEDKK |
| Ga0242661_10847382 | 3300022717 | Soil | LRLINTSQQIQKGLWGKRPDGTAYGDMREEYCVYSIERRFWEGRPLGGIGGEDKK |
| Ga0242657_11978371 | 3300022722 | Soil | KKVVLKLINSSQQIQKGLWGKRPDGTAYGHIREEYCVYSIERAFWQGRPLEGIGGEGKK |
| Ga0209002_103628512 | 3300025289 | Soil | AVLNLMNSSQQIQKGLWGQRPDGTAYGDIREEYCVYSIEQSFWQGRPLDGVGGDDKK |
| Ga0207685_107368311 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | KRTDGTAYGDIREEYCVYSIEHSFWQGRPLDGISGDDKK |
| Ga0207659_105173861 | 3300025926 | Miscanthus Rhizosphere | KKVLKLMNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERAFWQGRPLEGIGGDKK |
| Ga0207687_113320481 | 3300025927 | Miscanthus Rhizosphere | QKGLWGQRPDGTAYCDMREEYCVYSIERTFWQGRPLEGVGAEDKK |
| Ga0207701_104153782 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | QIQKGLWGQRPDGTAYGDMREEYCVYSIERAFWQGRPLEGVGGEDNK |
| Ga0207701_108111081 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RPDGTAYGDMREEYCVYSIERTFWQGRPLDGIGETIGEKK |
| Ga0207709_108653231 | 3300025935 | Miscanthus Rhizosphere | TLKLMNSSQQIQKGLWGKRADGTAYGDMREEYCVYSIERSFWQGRPLDGVGGEDKK |
| Ga0207677_120117331 | 3300026023 | Miscanthus Rhizosphere | KLTLKLMNSSQQIQKGLWGKRADGTAYGDMREEYCVYSIERSFWQGRPLDGVGGEDKK |
| Ga0209698_113816912 | 3300027911 | Watersheds | SQQVQKGLWGKRPDGTAYGDMREEYCVYSIESQFWKGRPLEGVGGDDKK |
| Ga0268264_121282742 | 3300028381 | Switchgrass Rhizosphere | KKVTLKLMNSSQQIQKGLWGQRPDGTAYGDMREEYCVYSIERTFWQGRPLEGVGAEDKK |
| Ga0265762_11435362 | 3300030760 | Soil | SQQVQKGLWGKRADGTAYGDMREEYCVYSIERHFWEGRPLGGIGGEDKK |
| Ga0075373_109267071 | 3300030945 | Soil | RPDGTAYGDIREEYCVYSIERTFWQGRPLGGIGGEGKK |
| Ga0265760_101746292 | 3300031090 | Soil | WGKRPDGTAYGDMREEYCVYSIERHFWEGRPLGGIGGEDKK |
| Ga0170823_162349482 | 3300031128 | Forest Soil | LWGKRPDGTAYGDMREEYCVYSIEQKFWQGRPLDGIGGEGKK |
| Ga0170824_1199803491 | 3300031231 | Forest Soil | SQQIQKGLWGKRADGTAYGDMREEYCVYSIERKFWEGRPLGGIGGEDKK |
| Ga0307506_103629261 | 3300031366 | Soil | GKKLTLKLMNSSQQVQKGLWGKRADGTAYGDMREEYCVYSIERKFWEGRPLDGVGGDDKK |
| Ga0170818_1034307551 | 3300031474 | Forest Soil | KKVVLKLLNSSQQIQKGLWGKRPDGTAYGDIREEYCVYSIERTFWQGRPLGGIGGEGKK |
| Ga0170818_1048296042 | 3300031474 | Forest Soil | GKRADGTAYGDMREEYCVYSIERKFWEGRPLGGVGGDDKK |
| Ga0310686_1091026111 | 3300031708 | Soil | QQVQKGLWGKRADGTAYGDMREEYCVYSIERHFWEGRPLGGIGGDDKK |
| Ga0310686_1196686511 | 3300031708 | Soil | KLKLKLMNSSQQIQKGLWGKRADGTAYGDMREEYCVYSIERKFWEGRPLGGVDGEEKK |
| Ga0310813_104944501 | 3300031716 | Soil | LRLLNSSQQVQKGLWGKRPDGTAYGDMREEYCVYSIERKFWEGRPLGGVGGEDKK |
| Ga0307475_108750171 | 3300031754 | Hardwood Forest Soil | KKLRLRLINTSQQIQKGLWGKRPDGTAYGDMREEYCVYSIERRFWEGRPLGGIGGEDKK |
| Ga0307473_108623601 | 3300031820 | Hardwood Forest Soil | QQIQKGLWGKRPDGTAYGDIREEYCVYSIERTFWQGRPLDGIGGEGKK |
| Ga0307478_104588071 | 3300031823 | Hardwood Forest Soil | KLKLLNSSQQIQKGLWGKRPDGTAYGDMREEYCVYSIERRFWEGRPLGGIGGDEKQ |
| Ga0311301_126227881 | 3300032160 | Peatlands Soil | GKSADGTAYGDMREEYCVYSIERKFWEGRPLGGIGGDAKK |
| Ga0306920_1039166342 | 3300032261 | Soil | KGLWGKRPDGTAYGDMREEYCVYSIEQKFWQGRPLDGVGGQGKK |
| Ga0348332_131720051 | 3300032515 | Plant Litter | KRPDGTAYGDMREEYCVYSIERKFWEGRPLGGIGGDEKQ |
| Ga0326723_0411775_1_150 | 3300034090 | Peat Soil | SQQIQKGLWGKRPDGTAYGDIREEYCVYSIERTFWQGRPLGGIGGEDKK |
| ⦗Top⦘ |