| Basic Information | |
|---|---|
| Family ID | F073624 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 42 residues |
| Representative Sequence | SIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGRLERLRG |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.50 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (11.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.167 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02585 | PIG-L | 73.33 |
| PF00903 | Glyoxalase | 4.17 |
| PF01734 | Patatin | 0.83 |
| PF01527 | HTH_Tnp_1 | 0.83 |
| PF00528 | BPD_transp_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 73.33 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.83 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.83 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.00 % |
| Unclassified | root | N/A | 5.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_3336638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1127 | Open in IMG/M |
| 3300003998|Ga0055472_10162300 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300004156|Ga0062589_102498150 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300004480|Ga0062592_101130946 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300004643|Ga0062591_102004574 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300004778|Ga0062383_10412920 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300004780|Ga0062378_10236918 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005093|Ga0062594_101267185 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005175|Ga0066673_10291170 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300005293|Ga0065715_10024411 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300005295|Ga0065707_10529641 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005331|Ga0070670_100434478 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300005338|Ga0068868_100105741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2282 | Open in IMG/M |
| 3300005338|Ga0068868_100686134 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005340|Ga0070689_101427547 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005364|Ga0070673_101463310 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005440|Ga0070705_101556388 | Not Available | 555 | Open in IMG/M |
| 3300005440|Ga0070705_101625896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300005444|Ga0070694_100935110 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005444|Ga0070694_101629235 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005546|Ga0070696_101245216 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005617|Ga0068859_101096391 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300005618|Ga0068864_102623233 | Not Available | 510 | Open in IMG/M |
| 3300005719|Ga0068861_100158900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1862 | Open in IMG/M |
| 3300005840|Ga0068870_11293437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae | 531 | Open in IMG/M |
| 3300005841|Ga0068863_100946935 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005841|Ga0068863_101038913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300005842|Ga0068858_101034306 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005844|Ga0068862_100359424 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300005844|Ga0068862_101625404 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300006358|Ga0068871_100278152 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300006844|Ga0075428_101504329 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300006846|Ga0075430_101352389 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006847|Ga0075431_100908163 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300006918|Ga0079216_11109143 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300007258|Ga0099793_10480442 | Not Available | 616 | Open in IMG/M |
| 3300009100|Ga0075418_11027556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300009137|Ga0066709_103953826 | Not Available | 538 | Open in IMG/M |
| 3300009147|Ga0114129_12596924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300009147|Ga0114129_12644633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300009148|Ga0105243_10402017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300009148|Ga0105243_10707802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300009148|Ga0105243_11798063 | Not Available | 644 | Open in IMG/M |
| 3300009148|Ga0105243_12453667 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300009148|Ga0105243_12719044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300009162|Ga0075423_11752877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300009174|Ga0105241_12490970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300009177|Ga0105248_10189395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2318 | Open in IMG/M |
| 3300010036|Ga0126305_10960285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300010041|Ga0126312_10741759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300010046|Ga0126384_11044475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300010046|Ga0126384_12427736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300010359|Ga0126376_10594573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300010373|Ga0134128_10517053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300010397|Ga0134124_11712124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300010399|Ga0134127_10170326 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300010399|Ga0134127_10252844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1671 | Open in IMG/M |
| 3300010399|Ga0134127_10671163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300010399|Ga0134127_10895357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300010399|Ga0134127_13005288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300010400|Ga0134122_10070304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2719 | Open in IMG/M |
| 3300010400|Ga0134122_11743366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300010400|Ga0134122_12695172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300010400|Ga0134122_12908658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300010403|Ga0134123_11538548 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300011119|Ga0105246_11125153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300012045|Ga0136623_10376733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 600 | Open in IMG/M |
| 3300012046|Ga0136634_10378609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 587 | Open in IMG/M |
| 3300012199|Ga0137383_10743690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300012350|Ga0137372_10496242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300012361|Ga0137360_11010251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300012582|Ga0137358_11012623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012923|Ga0137359_10934549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300012930|Ga0137407_11732959 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012961|Ga0164302_11397093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 571 | Open in IMG/M |
| 3300013102|Ga0157371_11452521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300013296|Ga0157374_12901999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300013297|Ga0157378_11856722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300013306|Ga0163162_10443809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300013307|Ga0157372_11579350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300014325|Ga0163163_13313292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300015373|Ga0132257_104340971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300017792|Ga0163161_10073108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2512 | Open in IMG/M |
| 3300018031|Ga0184634_10118438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1169 | Open in IMG/M |
| 3300018051|Ga0184620_10033618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1362 | Open in IMG/M |
| 3300018052|Ga0184638_1127790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 926 | Open in IMG/M |
| 3300018061|Ga0184619_10385429 | Not Available | 636 | Open in IMG/M |
| 3300018075|Ga0184632_10280590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 724 | Open in IMG/M |
| 3300018076|Ga0184609_10329665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300018429|Ga0190272_10056851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2298 | Open in IMG/M |
| 3300018429|Ga0190272_10768502 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300018429|Ga0190272_11944200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 620 | Open in IMG/M |
| 3300018429|Ga0190272_12904490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 530 | Open in IMG/M |
| 3300021418|Ga0193695_1105261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300022534|Ga0224452_1202779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300025792|Ga0210143_1061103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300025899|Ga0207642_10197332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300025904|Ga0207647_10142597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300025925|Ga0207650_10711293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300025931|Ga0207644_11197866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 638 | Open in IMG/M |
| 3300025935|Ga0207709_11406173 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300025942|Ga0207689_10743185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300025960|Ga0207651_10191191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
| 3300026035|Ga0207703_10099094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2466 | Open in IMG/M |
| 3300026095|Ga0207676_10363158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300026095|Ga0207676_10406909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300026095|Ga0207676_11538136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300026116|Ga0207674_10493553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
| 3300027691|Ga0209485_1254044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300027775|Ga0209177_10046354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300027886|Ga0209486_10920806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300028380|Ga0268265_10070417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2720 | Open in IMG/M |
| 3300028381|Ga0268264_11045031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300031731|Ga0307405_11996550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300031740|Ga0307468_100003898 | All Organisms → cellular organisms → Bacteria | 4904 | Open in IMG/M |
| 3300031854|Ga0310904_10928780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8 | 616 | Open in IMG/M |
| 3300031944|Ga0310884_10375791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300031995|Ga0307409_101041991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300032002|Ga0307416_101597167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300034165|Ga0364942_0011597 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 11.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 10.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.50% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.67% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.67% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.67% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0254.00002600 | 2162886012 | Miscanthus Rhizosphere | VPANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG |
| Ga0055472_101623001 | 3300003998 | Natural And Restored Wetlands | ISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGRLEKLRG* |
| Ga0062589_1024981501 | 3300004156 | Soil | PISIAIASELRDFNLGAAAAYGVVLVVIISVSMVIAGRLEKLR* |
| Ga0062592_1011309461 | 3300004480 | Soil | PANRPISIAIDSELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG* |
| Ga0062591_1020045741 | 3300004643 | Soil | PISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG* |
| Ga0062383_104129201 | 3300004778 | Wetland Sediment | RPISIAIAAAMRDFNLGTAAAYGVTLVAAIAVSMTAATYLERRR* |
| Ga0062378_102369182 | 3300004780 | Wetland Sediment | VFVPGNRPISIAIAAAMRDFNLGTAAAYGVTLIATIAVSMTAATYLERRR* |
| Ga0062594_1012671852 | 3300005093 | Soil | NRPISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGKLERLRS* |
| Ga0066673_102911701 | 3300005175 | Soil | ISIAIASELRDFNLGAAAAYGVVLIVIISVSMVIAGKLERLR* |
| Ga0065715_100244112 | 3300005293 | Miscanthus Rhizosphere | AIASAMRDFNLGTAAAYGVILIAMIVIVMVVAAKLERRA* |
| Ga0065707_105296411 | 3300005295 | Switchgrass Rhizosphere | FVPANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG* |
| Ga0070670_1004344782 | 3300005331 | Switchgrass Rhizosphere | FVPTNRPVSIAIASELRDFNLGTAAAYGVVLMAMIGIIMTVATRLERRRG* |
| Ga0068868_1001057411 | 3300005338 | Miscanthus Rhizosphere | IAIASELRDFNLGAAAAYGVVLIGIIAISMVVAGKLERWRS* |
| Ga0068868_1006861341 | 3300005338 | Miscanthus Rhizosphere | IASELRDFNLGTAAAYGVVLIVIISISMMVAGRLERLRG* |
| Ga0070689_1014275472 | 3300005340 | Switchgrass Rhizosphere | SIAIASELRDFNLGTAAAYGVVLIVIISMSMAVAGRLERLRG* |
| Ga0070673_1014633101 | 3300005364 | Switchgrass Rhizosphere | ANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMMVAGRLERRG* |
| Ga0070705_1015563882 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TNRPVSIAIASELRDFNLGTAAAYGVVLMVMIGIIMTIATRLERRSA* |
| Ga0070705_1016258962 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | PVSIAIASELRDFNLGSAAAYGVILIVIIATAMLVANRFERAKG* |
| Ga0070694_1009351101 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | IAIASAMRDFNLGTAAAYGVILIAMIVIVMVVAAKLERRA* |
| Ga0070694_1016292352 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AIASEMRDFNLGAAAAYGVVLIVIISISMMVAGRLERLRS* |
| Ga0070696_1012452161 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ANRPISIAIASELRDFNLGAAAAYGVVLIVIISVSMVVAGKLERLRS* |
| Ga0068859_1010963911 | 3300005617 | Switchgrass Rhizosphere | SELRDFNLGAAAAYGVVLIGIIAISMIVAGKLERWRS* |
| Ga0068864_1026232332 | 3300005618 | Switchgrass Rhizosphere | RDFNLGSAAAYGMILIVIIAVSMFFAARLERLRA* |
| Ga0068861_1001589002 | 3300005719 | Switchgrass Rhizosphere | SELRDFNLGAAAAYGVVLIGIIAISMVVAGKLERWRS* |
| Ga0068870_112934372 | 3300005840 | Miscanthus Rhizosphere | FVPANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRS* |
| Ga0068863_1009469352 | 3300005841 | Switchgrass Rhizosphere | NRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG* |
| Ga0068863_1010389131 | 3300005841 | Switchgrass Rhizosphere | RDFNLGAAAAYGVVLILIISISMVIAGKLEKIRG* |
| Ga0068858_1010343061 | 3300005842 | Switchgrass Rhizosphere | IAIASELRDFNLGAAGAYGVVLIGIIAISMIVAGKLERWRS* |
| Ga0068862_1003594241 | 3300005844 | Switchgrass Rhizosphere | AIASELRDFNLGTAAAYGVVLIVIISISMVVAGRLERLRG* |
| Ga0068862_1016254042 | 3300005844 | Switchgrass Rhizosphere | IAIASELRDFNLGAAGAYGVVLIGIIALSMIAAGKLERWRS* |
| Ga0068871_1002781522 | 3300006358 | Miscanthus Rhizosphere | VFVPANRPISIAIASELRDFNLGTAAAYGVVLIVIISISMVVAGRLERLRG* |
| Ga0075428_1015043292 | 3300006844 | Populus Rhizosphere | ANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERMRS* |
| Ga0075430_1013523892 | 3300006846 | Populus Rhizosphere | IAIASELRDFNLGAAAAYGVVLIVIISISMVVAGKLE* |
| Ga0075431_1009081632 | 3300006847 | Populus Rhizosphere | IAIASEMRDFNLGTAAAYGVVLIGIIAVVMVGAGKLERLRG* |
| Ga0079216_111091432 | 3300006918 | Agricultural Soil | PISIAIASELRDFNLGAAAAYGVILIVIISISMVAAGKLEKLRG* |
| Ga0099793_104804421 | 3300007258 | Vadose Zone Soil | IASELRDFNLGAAAAYGVVLMAIIAISMMVAGKLERLRS* |
| Ga0075418_110275562 | 3300009100 | Populus Rhizosphere | ELRDFNLGAAAAYGVVLIVIISISMVAAGKLERIRG* |
| Ga0066709_1039538261 | 3300009137 | Grasslands Soil | DFNLGTAAAYGVILIGIITVSMIIAAKLERRASV* |
| Ga0114129_125969242 | 3300009147 | Populus Rhizosphere | LRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG* |
| Ga0114129_126446332 | 3300009147 | Populus Rhizosphere | ANRPISIAIASELRDFNLGAAAAYGVILIVIISISMVAAGKLERIRG* |
| Ga0105243_104020172 | 3300009148 | Miscanthus Rhizosphere | FVPANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGKLERLRS* |
| Ga0105243_107078021 | 3300009148 | Miscanthus Rhizosphere | NRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLEKLRG* |
| Ga0105243_117980631 | 3300009148 | Miscanthus Rhizosphere | RPVSIAIASELRDFNLGTAAAYGVVLMAMIGIIMTVATRLERRRG* |
| Ga0105243_124536672 | 3300009148 | Miscanthus Rhizosphere | ASELRDFNLGTAAAYGVVLMLMIGVIMTIAARLERARA* |
| Ga0105243_127190441 | 3300009148 | Miscanthus Rhizosphere | ISIAIASELRDFNLGTAAAYGVVLIVIISISMMVAGRLERLRG* |
| Ga0075423_117528771 | 3300009162 | Populus Rhizosphere | IAIASELRDFRLGTAAAYGVVLIGIIAVTMTIAARLEPVNS* |
| Ga0105241_124909702 | 3300009174 | Corn Rhizosphere | SIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG* |
| Ga0105248_101893952 | 3300009177 | Switchgrass Rhizosphere | IAIASEMRDFNLGTAAAYGVVLIGIIAVVMVAAGKLERLRS* |
| Ga0126305_109602851 | 3300010036 | Serpentine Soil | SELRDFNLGAAAAYGVVLIVIISISMIVAGRLEKLRG* |
| Ga0126312_107417591 | 3300010041 | Serpentine Soil | NQPISIRIASEMRDFNLGTAATYGVVLILMVTLAMLAASRLERKRT* |
| Ga0126384_110444751 | 3300010046 | Tropical Forest Soil | SIAIASELRDFNLGAAAAYGVILIVIISISMMVAGKLERWRS* |
| Ga0126384_124277362 | 3300010046 | Tropical Forest Soil | SIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGRLERLRG* |
| Ga0126376_105945732 | 3300010359 | Tropical Forest Soil | ASELRDFNLGAAAAYGVVLIVIISISMVVAGRLERLRG* |
| Ga0134128_105170532 | 3300010373 | Terrestrial Soil | ISIAIASELRDFNLGAAAAYGVILILIISVSMIVAGKLERWRS* |
| Ga0134124_117121242 | 3300010397 | Terrestrial Soil | ASELRDFNLGAAAAYGVVLIAIISISMMIAARLEKLR* |
| Ga0134127_101703262 | 3300010399 | Terrestrial Soil | PGNRPVSIAIASAMRDFNLGTAAAYGVILMAMIALAMIAAGRFERPKGQ* |
| Ga0134127_102528441 | 3300010399 | Terrestrial Soil | TPGNRPVSIAIASAMRDFNLGTAAAYGVILMAMIALAMIVAGRFEKRTGQ* |
| Ga0134127_106711631 | 3300010399 | Terrestrial Soil | ISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGKLDKMRG* |
| Ga0134127_108953572 | 3300010399 | Terrestrial Soil | RDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG* |
| Ga0134127_130052881 | 3300010399 | Terrestrial Soil | ASEMRDFNLGTAAAYGVVLIGIIAVVMVGAGKLERLRG* |
| Ga0134122_100703043 | 3300010400 | Terrestrial Soil | SELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG* |
| Ga0134122_117433662 | 3300010400 | Terrestrial Soil | VPTNRPVSIAIASELRDFNLGTAAAYGVVLMLMIGIIMTVAARLERVRG* |
| Ga0134122_126951722 | 3300010400 | Terrestrial Soil | VPANRPISIAIASELRDFNLGTAAAYGVVLIVIISISMVVAGRLERLRG* |
| Ga0134122_129086581 | 3300010400 | Terrestrial Soil | SELRDFNLGAAAAYGVVLIVIISISMVVAGKLERLRS* |
| Ga0134123_115385483 | 3300010403 | Terrestrial Soil | SIAIASELRDFNLGTAAAYGVVLMLMIGVIMTIAARLERARA* |
| Ga0105246_111251531 | 3300011119 | Miscanthus Rhizosphere | LRDFNLGAAAAYGVVLIVIISISMVVAGRLERLRG* |
| Ga0136623_103767331 | 3300012045 | Polar Desert Sand | SVAIASELRDLNPGAAAAYGVVLMGIIAVSMIIAAKFERWRS* |
| Ga0136634_103786092 | 3300012046 | Polar Desert Sand | SELRDLNLGAAAAYGVVLMGIIAVSMIIAAKFERWRS* |
| Ga0137383_107436902 | 3300012199 | Vadose Zone Soil | AIASELRDFNLGTAAAYGVVLIGIIAISMIVTGKLERLRS* |
| Ga0137372_104962421 | 3300012350 | Vadose Zone Soil | RPVSIAIASAMRDFNLGTAAAFGVILITMIAIAMIVAGKLERRA* |
| Ga0137360_110102511 | 3300012361 | Vadose Zone Soil | IAIASELRDFNLGTAAAYGVVLIGIIAISMIVAGRLERLRG* |
| Ga0137358_110126231 | 3300012582 | Vadose Zone Soil | LRDFNLGTAAAYGVVLIGVIAISMVVAGKLEQLRS* |
| Ga0137359_109345492 | 3300012923 | Vadose Zone Soil | ISIAIASELRDFNLGTAAAYGVVLIGVIAISMVVAGKLEQLRS* |
| Ga0137407_117329592 | 3300012930 | Vadose Zone Soil | SELRDFNLGTAAAYGVVLMLMIGLIMMVATRLERLRA* |
| Ga0164302_113970932 | 3300012961 | Soil | SIAIASELRDFNLGAAAAYGVVLMGIIAISMMVAGKLERLRS* |
| Ga0157371_114525211 | 3300013102 | Corn Rhizosphere | ASELRDFNLGTAAAYGVVLIVIISISMVVAGRLERLRG* |
| Ga0157374_129019992 | 3300013296 | Miscanthus Rhizosphere | RPISIAIASELRDFNLGAAAAYGVVLIGIIAISMVVAGKLERWRS* |
| Ga0157378_118567222 | 3300013297 | Miscanthus Rhizosphere | VPANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG* |
| Ga0163162_104438092 | 3300013306 | Switchgrass Rhizosphere | RPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLEKLRG* |
| Ga0157372_115793502 | 3300013307 | Corn Rhizosphere | RPISIAIASELRDFNLGAAAAYGVILVVIISVSMIVAGKLERWRS* |
| Ga0163163_133132922 | 3300014325 | Switchgrass Rhizosphere | VNRPISIAIASEMRDFNLGAAAAYGVVLIVIISISMMVAGRLERLRS* |
| Ga0132257_1043409712 | 3300015373 | Arabidopsis Rhizosphere | SELRDFNLGTAAAYGVVLIVIISMSMAVAGRLERLRG* |
| Ga0163161_100731081 | 3300017792 | Switchgrass Rhizosphere | ISIAIASEMRDFNLGTAAAYGVVLIGIIAVVMVAAGKLERLRS |
| Ga0184634_101184382 | 3300018031 | Groundwater Sediment | VSIAIASELRDFNLGTAAAYGVILIGIIAVSMIVAARLERSAKV |
| Ga0184620_100336181 | 3300018051 | Groundwater Sediment | ELRDFHLGTAAAYGVVLIGIIGISMTVAAKLERLRSG |
| Ga0184638_11277902 | 3300018052 | Groundwater Sediment | IAIASGLRDLNLGAAAAYGVVLIAIIGLSMMMAAKLERMRS |
| Ga0184619_103854291 | 3300018061 | Groundwater Sediment | ELRDFNLGTAAAYGVVLMLMIGVIMTIAARLERARA |
| Ga0184632_102805902 | 3300018075 | Groundwater Sediment | SELRDFNLGAAAAYGVVLMVIIGVSMVVATRLDRTRS |
| Ga0184609_103296652 | 3300018076 | Groundwater Sediment | AIASELRDFNLGTAAAYGVVLMLMIGIIMTVAARLERARG |
| Ga0190272_100568512 | 3300018429 | Soil | ISIAIASELRDFNLGAAAAYGVVLMVMIGVIMIVATRLEKSRA |
| Ga0190272_107685021 | 3300018429 | Soil | FVPTNRPVSIAIASELRDFNLGTAAAYGVVLIVVIAAAMMVASRLERFNLAKEK |
| Ga0190272_119442001 | 3300018429 | Soil | IAIASELRDFNLGTAAAYGVVLIGIIATIMIVAARLEKVRGSR |
| Ga0190272_129044902 | 3300018429 | Soil | FVPNNRPVSIAIASELRDFNLGTAAAYGVVLIGIIATVMVLASRLERLNSNKTNRS |
| Ga0193695_11052612 | 3300021418 | Soil | TPGNRPVSIAIASAMRDFNLGTAAAYGVVLICIIGAAMILAGRFEHR |
| Ga0224452_12027791 | 3300022534 | Groundwater Sediment | RPVSIAIASAMRDFNLGTAAAYGVVLIAMIAIAMVVAGRVEQSPG |
| Ga0210143_10611031 | 3300025792 | Natural And Restored Wetlands | PISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGRLEKLRG |
| Ga0207642_101973321 | 3300025899 | Miscanthus Rhizosphere | ISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG |
| Ga0207647_101425972 | 3300025904 | Corn Rhizosphere | ELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRT |
| Ga0207650_107112932 | 3300025925 | Switchgrass Rhizosphere | ELRDFNLGAAAAYGVVLIVIISISMVVAGKLERMRE |
| Ga0207644_111978661 | 3300025931 | Switchgrass Rhizosphere | ASELRDFNLGTAAAYGVVLMVMIGIIMTVATRLERSRS |
| Ga0207709_114061731 | 3300025935 | Miscanthus Rhizosphere | ASELRDFNLGTAAAYGVVLMLMIGVIMTIAARLERARA |
| Ga0207689_107431852 | 3300025942 | Miscanthus Rhizosphere | AIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRT |
| Ga0207651_101911912 | 3300025960 | Switchgrass Rhizosphere | NRPISIAIASELRDFNLGAAAAYGVVLIVIISISMMVAGRLERRG |
| Ga0207703_100990941 | 3300026035 | Switchgrass Rhizosphere | SIAIASELRDFNLGTAAAYGVVLIVIISISMIVAGRLERLRG |
| Ga0207676_103631582 | 3300026095 | Switchgrass Rhizosphere | LRDFNLGTAAAYGVVLIVIISISMAVAGRLERLRG |
| Ga0207676_104069091 | 3300026095 | Switchgrass Rhizosphere | SIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG |
| Ga0207676_115381362 | 3300026095 | Switchgrass Rhizosphere | SELRDFNLGAAAAYGVVLIVIISISMMVAGRLERLRG |
| Ga0207674_104935531 | 3300026116 | Corn Rhizosphere | PISIAIASELRDFNLGTAAAYGVVLIVIISISMMVAGRLERFRG |
| Ga0209485_12540441 | 3300027691 | Agricultural Soil | AIASELRDFNLGAAAAYGVVLIVIISVSMVAAGKLERIRG |
| Ga0209177_100463542 | 3300027775 | Agricultural Soil | AIASELRDFNLGSAAAYGVVLIVIISISMMVAGRLERLRG |
| Ga0209486_109208061 | 3300027886 | Agricultural Soil | VFVPVNRPISIAIASELRDFNVGAAAAYGVVLIVIISVSMVIAGRLEKLR |
| Ga0268265_100704172 | 3300028380 | Switchgrass Rhizosphere | SEPSISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGKLEKMRG |
| Ga0268264_110450311 | 3300028381 | Switchgrass Rhizosphere | ELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG |
| Ga0307405_119965502 | 3300031731 | Rhizosphere | ISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGRLERLRG |
| Ga0307468_1000038983 | 3300031740 | Hardwood Forest Soil | RPVSIAIASAMRDFNLGTAAAYGVILIGMIGVAMVVAGRLEKRA |
| Ga0310904_109287801 | 3300031854 | Soil | ASEMRDFNLGTAAAYGVVLIGIIAVVMVGAGKLERLRG |
| Ga0310884_103757912 | 3300031944 | Soil | IAIASEMRDFNLGTAAAYGVVLIGIIAVVMVAAGKLERLRG |
| Ga0307409_1010419911 | 3300031995 | Rhizosphere | PANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG |
| Ga0307416_1015971671 | 3300032002 | Rhizosphere | LRDFNLGAAAAYGVVLIVIISISMVVAGKLERLRG |
| Ga0364942_0011597_2630_2740 | 3300034165 | Sediment | SELRDFNLGTAAAYGVVLMLMIGSLMMVATRLERLR |
| ⦗Top⦘ |