Metagenome Family F073624

Basic Information
Family ID	F073624
Family Type	Metagenome
Number of Sequences	120
Average Sequence Length	42 residues
Representative Sequence	SIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGRLERLRG
Number of Associated Samples	97
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	92.50 %
Associated GOLD sequencing projects	88
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.59

Most Common Taxonomy
Group	Bacteria (95.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (11.667 % of family members)
Environment Ontology (ENVO)	Unclassified (44.167 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (59.167 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF02585	PIG-L	73.33
PF00903	Glyoxalase	4.17
PF01734	Patatin	0.83
PF01527	HTH_Tnp_1	0.83
PF00528	BPD_transp_1	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG2120	N-acetylglucosaminyl deacetylase, LmbE family	Carbohydrate transport and metabolism [G]	73.33
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.83
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.83
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.83

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	95.00 %
Unclassified	root	N/A	5.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	95.00 %
Unclassified	root	N/A	5.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	95.00 %
Unclassified	root	N/A	5.00 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	65.00 %
Unclassified	root	N/A	5.00 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.83 %

Name	Rank	Taxonomy	Distribution
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	8.33 %
Unclassified	root	N/A	5.00 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	3.33 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.83 %

Name	Rank	Taxonomy	Distribution
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	8.33 %
Unclassified	root	N/A	5.00 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.50 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.83 %
Acidobacteria bacterium 13_1_20CM_3_53_8	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8	0.83 %

Name	Rank	Taxonomy	Distribution
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	8.33 %
Unclassified	root	N/A	5.00 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.50 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.83 %
Acidobacteria bacterium 13_1_20CM_3_53_8	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8	0.83 %

Name	Rank	Taxonomy	Distribution
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	8.33 %
Unclassified	root	N/A	5.00 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.50 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.83 %
Acidobacteria bacterium 13_1_20CM_3_53_8	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8	0.83 %

Name	Rank	Taxonomy	Distribution
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	8.33 %
Unclassified	root	N/A	5.00 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.50 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.83 %
Acidobacteria bacterium 13_1_20CM_3_53_8	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886012\|MBSR1b_contig_3336638	All Organisms → cellular organisms → Bacteria → Acidobacteria	1127	Open in IMG/M
3300003998\|Ga0055472_10162300	All Organisms → cellular organisms → Bacteria	670	Open in IMG/M
3300004156\|Ga0062589_102498150	All Organisms → cellular organisms → Bacteria	534	Open in IMG/M
3300004480\|Ga0062592_101130946	All Organisms → cellular organisms → Bacteria	727	Open in IMG/M
3300004643\|Ga0062591_102004574	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300004778\|Ga0062383_10412920	All Organisms → cellular organisms → Bacteria	666	Open in IMG/M
3300004780\|Ga0062378_10236918	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300005093\|Ga0062594_101267185	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
3300005175\|Ga0066673_10291170	All Organisms → cellular organisms → Bacteria	951	Open in IMG/M
3300005293\|Ga0065715_10024411	All Organisms → cellular organisms → Bacteria	1543	Open in IMG/M
3300005295\|Ga0065707_10529641	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300005331\|Ga0070670_100434478	All Organisms → cellular organisms → Bacteria	1162	Open in IMG/M
3300005338\|Ga0068868_100105741	All Organisms → cellular organisms → Bacteria → Acidobacteria	2282	Open in IMG/M
3300005338\|Ga0068868_100686134	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300005340\|Ga0070689_101427547	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300005364\|Ga0070673_101463310	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300005440\|Ga0070705_101556388	Not Available	555	Open in IMG/M
3300005440\|Ga0070705_101625896	All Organisms → cellular organisms → Bacteria → Acidobacteria	544	Open in IMG/M
3300005444\|Ga0070694_100935110	All Organisms → cellular organisms → Bacteria	717	Open in IMG/M
3300005444\|Ga0070694_101629235	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300005546\|Ga0070696_101245216	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300005617\|Ga0068859_101096391	All Organisms → cellular organisms → Bacteria	876	Open in IMG/M
3300005618\|Ga0068864_102623233	Not Available	510	Open in IMG/M
3300005719\|Ga0068861_100158900	All Organisms → cellular organisms → Bacteria → Acidobacteria	1862	Open in IMG/M
3300005840\|Ga0068870_11293437	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	531	Open in IMG/M
3300005841\|Ga0068863_100946935	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300005841\|Ga0068863_101038913	All Organisms → cellular organisms → Bacteria → Acidobacteria	823	Open in IMG/M
3300005842\|Ga0068858_101034306	All Organisms → cellular organisms → Bacteria	805	Open in IMG/M
3300005844\|Ga0068862_100359424	All Organisms → cellular organisms → Bacteria	1353	Open in IMG/M
3300005844\|Ga0068862_101625404	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300006358\|Ga0068871_100278152	All Organisms → cellular organisms → Bacteria	1463	Open in IMG/M
3300006844\|Ga0075428_101504329	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300006846\|Ga0075430_101352389	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300006847\|Ga0075431_100908163	All Organisms → cellular organisms → Bacteria	850	Open in IMG/M
3300006918\|Ga0079216_11109143	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300007258\|Ga0099793_10480442	Not Available	616	Open in IMG/M
3300009100\|Ga0075418_11027556	All Organisms → cellular organisms → Bacteria → Acidobacteria	892	Open in IMG/M
3300009137\|Ga0066709_103953826	Not Available	538	Open in IMG/M
3300009147\|Ga0114129_12596924	All Organisms → cellular organisms → Bacteria → Acidobacteria	604	Open in IMG/M
3300009147\|Ga0114129_12644633	All Organisms → cellular organisms → Bacteria → Acidobacteria	598	Open in IMG/M
3300009148\|Ga0105243_10402017	All Organisms → cellular organisms → Bacteria → Acidobacteria	1273	Open in IMG/M
3300009148\|Ga0105243_10707802	All Organisms → cellular organisms → Bacteria → Acidobacteria	982	Open in IMG/M
3300009148\|Ga0105243_11798063	Not Available	644	Open in IMG/M
3300009148\|Ga0105243_12453667	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300009148\|Ga0105243_12719044	All Organisms → cellular organisms → Bacteria → Acidobacteria	535	Open in IMG/M
3300009162\|Ga0075423_11752877	All Organisms → cellular organisms → Bacteria → Acidobacteria	669	Open in IMG/M
3300009174\|Ga0105241_12490970	All Organisms → cellular organisms → Bacteria → Acidobacteria	518	Open in IMG/M
3300009177\|Ga0105248_10189395	All Organisms → cellular organisms → Bacteria → Acidobacteria	2318	Open in IMG/M
3300010036\|Ga0126305_10960285	All Organisms → cellular organisms → Bacteria → Acidobacteria	585	Open in IMG/M
3300010041\|Ga0126312_10741759	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	710	Open in IMG/M
3300010046\|Ga0126384_11044475	All Organisms → cellular organisms → Bacteria → Acidobacteria	746	Open in IMG/M
3300010046\|Ga0126384_12427736	All Organisms → cellular organisms → Bacteria → Acidobacteria	508	Open in IMG/M
3300010359\|Ga0126376_10594573	All Organisms → cellular organisms → Bacteria → Acidobacteria	1045	Open in IMG/M
3300010373\|Ga0134128_10517053	All Organisms → cellular organisms → Bacteria → Acidobacteria	1331	Open in IMG/M
3300010397\|Ga0134124_11712124	All Organisms → cellular organisms → Bacteria → Acidobacteria	661	Open in IMG/M
3300010399\|Ga0134127_10170326	All Organisms → cellular organisms → Bacteria	1998	Open in IMG/M
3300010399\|Ga0134127_10252844	All Organisms → cellular organisms → Bacteria → Acidobacteria	1671	Open in IMG/M
3300010399\|Ga0134127_10671163	All Organisms → cellular organisms → Bacteria → Acidobacteria	1073	Open in IMG/M
3300010399\|Ga0134127_10895357	All Organisms → cellular organisms → Bacteria → Acidobacteria	942	Open in IMG/M
3300010399\|Ga0134127_13005288	All Organisms → cellular organisms → Bacteria → Acidobacteria	550	Open in IMG/M
3300010400\|Ga0134122_10070304	All Organisms → cellular organisms → Bacteria → Acidobacteria	2719	Open in IMG/M
3300010400\|Ga0134122_11743366	All Organisms → cellular organisms → Bacteria → Acidobacteria	652	Open in IMG/M
3300010400\|Ga0134122_12695172	All Organisms → cellular organisms → Bacteria → Acidobacteria	549	Open in IMG/M
3300010400\|Ga0134122_12908658	All Organisms → cellular organisms → Bacteria → Acidobacteria	533	Open in IMG/M
3300010403\|Ga0134123_11538548	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300011119\|Ga0105246_11125153	All Organisms → cellular organisms → Bacteria → Acidobacteria	718	Open in IMG/M
3300012045\|Ga0136623_10376733	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	600	Open in IMG/M
3300012046\|Ga0136634_10378609	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	587	Open in IMG/M
3300012199\|Ga0137383_10743690	All Organisms → cellular organisms → Bacteria → Acidobacteria	716	Open in IMG/M
3300012350\|Ga0137372_10496242	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	909	Open in IMG/M
3300012361\|Ga0137360_11010251	All Organisms → cellular organisms → Bacteria → Acidobacteria	718	Open in IMG/M
3300012582\|Ga0137358_11012623	All Organisms → cellular organisms → Bacteria → Acidobacteria	536	Open in IMG/M
3300012923\|Ga0137359_10934549	All Organisms → cellular organisms → Bacteria → Acidobacteria	746	Open in IMG/M
3300012930\|Ga0137407_11732959	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300012961\|Ga0164302_11397093	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	571	Open in IMG/M
3300013102\|Ga0157371_11452521	All Organisms → cellular organisms → Bacteria → Acidobacteria	534	Open in IMG/M
3300013296\|Ga0157374_12901999	All Organisms → cellular organisms → Bacteria → Acidobacteria	507	Open in IMG/M
3300013297\|Ga0157378_11856722	All Organisms → cellular organisms → Bacteria → Acidobacteria	651	Open in IMG/M
3300013306\|Ga0163162_10443809	All Organisms → cellular organisms → Bacteria → Acidobacteria	1430	Open in IMG/M
3300013307\|Ga0157372_11579350	All Organisms → cellular organisms → Bacteria → Acidobacteria	755	Open in IMG/M
3300014325\|Ga0163163_13313292	All Organisms → cellular organisms → Bacteria → Acidobacteria	502	Open in IMG/M
3300015373\|Ga0132257_104340971	All Organisms → cellular organisms → Bacteria → Acidobacteria	516	Open in IMG/M
3300017792\|Ga0163161_10073108	All Organisms → cellular organisms → Bacteria → Acidobacteria	2512	Open in IMG/M
3300018031\|Ga0184634_10118438	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1169	Open in IMG/M
3300018051\|Ga0184620_10033618	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1362	Open in IMG/M
3300018052\|Ga0184638_1127790	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	926	Open in IMG/M
3300018061\|Ga0184619_10385429	Not Available	636	Open in IMG/M
3300018075\|Ga0184632_10280590	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	724	Open in IMG/M
3300018076\|Ga0184609_10329665	All Organisms → cellular organisms → Bacteria → Acidobacteria	713	Open in IMG/M
3300018429\|Ga0190272_10056851	All Organisms → cellular organisms → Bacteria → Acidobacteria	2298	Open in IMG/M
3300018429\|Ga0190272_10768502	All Organisms → cellular organisms → Bacteria	881	Open in IMG/M
3300018429\|Ga0190272_11944200	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	620	Open in IMG/M
3300018429\|Ga0190272_12904490	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	530	Open in IMG/M
3300021418\|Ga0193695_1105261	All Organisms → cellular organisms → Bacteria → Acidobacteria	601	Open in IMG/M
3300022534\|Ga0224452_1202779	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	610	Open in IMG/M
3300025792\|Ga0210143_1061103	All Organisms → cellular organisms → Bacteria → Acidobacteria	674	Open in IMG/M
3300025899\|Ga0207642_10197332	All Organisms → cellular organisms → Bacteria → Acidobacteria	1109	Open in IMG/M
3300025904\|Ga0207647_10142597	All Organisms → cellular organisms → Bacteria → Acidobacteria	1404	Open in IMG/M
3300025925\|Ga0207650_10711293	All Organisms → cellular organisms → Bacteria → Acidobacteria	849	Open in IMG/M
3300025931\|Ga0207644_11197866	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	638	Open in IMG/M
3300025935\|Ga0207709_11406173	All Organisms → cellular organisms → Bacteria	578	Open in IMG/M
3300025942\|Ga0207689_10743185	All Organisms → cellular organisms → Bacteria → Acidobacteria	828	Open in IMG/M
3300025960\|Ga0207651_10191191	All Organisms → cellular organisms → Bacteria → Acidobacteria	1633	Open in IMG/M
3300026035\|Ga0207703_10099094	All Organisms → cellular organisms → Bacteria → Acidobacteria	2466	Open in IMG/M
3300026095\|Ga0207676_10363158	All Organisms → cellular organisms → Bacteria → Acidobacteria	1342	Open in IMG/M
3300026095\|Ga0207676_10406909	All Organisms → cellular organisms → Bacteria → Acidobacteria	1273	Open in IMG/M
3300026095\|Ga0207676_11538136	All Organisms → cellular organisms → Bacteria → Acidobacteria	663	Open in IMG/M
3300026116\|Ga0207674_10493553	All Organisms → cellular organisms → Bacteria → Acidobacteria	1183	Open in IMG/M
3300027691\|Ga0209485_1254044	All Organisms → cellular organisms → Bacteria → Acidobacteria	567	Open in IMG/M
3300027775\|Ga0209177_10046354	All Organisms → cellular organisms → Bacteria → Acidobacteria	1214	Open in IMG/M
3300027886\|Ga0209486_10920806	All Organisms → cellular organisms → Bacteria → Acidobacteria	581	Open in IMG/M
3300028380\|Ga0268265_10070417	All Organisms → cellular organisms → Bacteria → Acidobacteria	2720	Open in IMG/M
3300028381\|Ga0268264_11045031	All Organisms → cellular organisms → Bacteria → Acidobacteria	824	Open in IMG/M
3300031731\|Ga0307405_11996550	All Organisms → cellular organisms → Bacteria → Acidobacteria	519	Open in IMG/M
3300031740\|Ga0307468_100003898	All Organisms → cellular organisms → Bacteria	4904	Open in IMG/M
3300031854\|Ga0310904_10928780	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8	616	Open in IMG/M
3300031944\|Ga0310884_10375791	All Organisms → cellular organisms → Bacteria → Acidobacteria	811	Open in IMG/M
3300031995\|Ga0307409_101041991	All Organisms → cellular organisms → Bacteria → Acidobacteria	838	Open in IMG/M
3300032002\|Ga0307416_101597167	All Organisms → cellular organisms → Bacteria → Acidobacteria	757	Open in IMG/M
3300034165\|Ga0364942_0011597	All Organisms → cellular organisms → Bacteria	2741	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	53.33%
Host-Associated	Host-Associated	46.67%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	46.67%
Terrestrial	Environmental → Terrestrial	42.50%
Aquatic	Environmental → Aquatic	10.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	41.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere	23.33%
Rhizoplane	Host-Associated → Plants → Rhizoplane	21.67%
Sediment	Environmental → Aquatic → Sediment	5.83%
Freshwater	Environmental → Aquatic → Freshwater	3.33%
Marine	Environmental → Aquatic → Marine	1.67%
Roots	Host-Associated → Plants → Roots	1.67%
Floodplain	Environmental → Terrestrial → Floodplain	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.83%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	19.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	19.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.83%
Loam	Environmental → Terrestrial → Soil → Loam	5.83%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.50%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.67%
Ice	Environmental → Aquatic → Freshwater → Ice	1.67%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.67%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.67%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	19.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	19.17%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.50%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.67%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.67%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.67%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.67%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.67%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.83%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.83%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.83%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	11.67%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	10.00%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.83%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	5.83%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	5.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.00%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.17%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.17%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.33%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.50%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	1.67%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	1.67%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.67%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	1.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.67%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.83%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.83%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.83%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.83%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300003998	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300004778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh	Environmental	Open in IMG/M
3300004780	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012045	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)	Environmental	Open in IMG/M
3300012046	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018031	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1	Environmental	Open in IMG/M
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300021418	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300025792	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300034165	Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MBSR1b_0254.00002600	2162886012	Miscanthus Rhizosphere	VPANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG
Ga0055472_101623001	3300003998	Natural And Restored Wetlands	ISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGRLEKLRG*
Ga0062589_1024981501	3300004156	Soil	PISIAIASELRDFNLGAAAAYGVVLVVIISVSMVIAGRLEKLR*
Ga0062592_1011309461	3300004480	Soil	PANRPISIAIDSELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG*
Ga0062591_1020045741	3300004643	Soil	PISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG*
Ga0062383_104129201	3300004778	Wetland Sediment	RPISIAIAAAMRDFNLGTAAAYGVTLVAAIAVSMTAATYLERRR*
Ga0062378_102369182	3300004780	Wetland Sediment	VFVPGNRPISIAIAAAMRDFNLGTAAAYGVTLIATIAVSMTAATYLERRR*
Ga0062594_1012671852	3300005093	Soil	NRPISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGKLERLRS*
Ga0066673_102911701	3300005175	Soil	ISIAIASELRDFNLGAAAAYGVVLIVIISVSMVIAGKLERLR*
Ga0065715_100244112	3300005293	Miscanthus Rhizosphere	AIASAMRDFNLGTAAAYGVILIAMIVIVMVVAAKLERRA*
Ga0065707_105296411	3300005295	Switchgrass Rhizosphere	FVPANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG*
Ga0070670_1004344782	3300005331	Switchgrass Rhizosphere	FVPTNRPVSIAIASELRDFNLGTAAAYGVVLMAMIGIIMTVATRLERRRG*
Ga0068868_1001057411	3300005338	Miscanthus Rhizosphere	IAIASELRDFNLGAAAAYGVVLIGIIAISMVVAGKLERWRS*
Ga0068868_1006861341	3300005338	Miscanthus Rhizosphere	IASELRDFNLGTAAAYGVVLIVIISISMMVAGRLERLRG*
Ga0070689_1014275472	3300005340	Switchgrass Rhizosphere	SIAIASELRDFNLGTAAAYGVVLIVIISMSMAVAGRLERLRG*
Ga0070673_1014633101	3300005364	Switchgrass Rhizosphere	ANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMMVAGRLERRG*
Ga0070705_1015563882	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	TNRPVSIAIASELRDFNLGTAAAYGVVLMVMIGIIMTIATRLERRSA*
Ga0070705_1016258962	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	PVSIAIASELRDFNLGSAAAYGVILIVIIATAMLVANRFERAKG*
Ga0070694_1009351101	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	IAIASAMRDFNLGTAAAYGVILIAMIVIVMVVAAKLERRA*
Ga0070694_1016292352	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	AIASEMRDFNLGAAAAYGVVLIVIISISMMVAGRLERLRS*
Ga0070696_1012452161	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	ANRPISIAIASELRDFNLGAAAAYGVVLIVIISVSMVVAGKLERLRS*
Ga0068859_1010963911	3300005617	Switchgrass Rhizosphere	SELRDFNLGAAAAYGVVLIGIIAISMIVAGKLERWRS*
Ga0068864_1026232332	3300005618	Switchgrass Rhizosphere	RDFNLGSAAAYGMILIVIIAVSMFFAARLERLRA*
Ga0068861_1001589002	3300005719	Switchgrass Rhizosphere	SELRDFNLGAAAAYGVVLIGIIAISMVVAGKLERWRS*
Ga0068870_112934372	3300005840	Miscanthus Rhizosphere	FVPANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRS*
Ga0068863_1009469352	3300005841	Switchgrass Rhizosphere	NRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG*
Ga0068863_1010389131	3300005841	Switchgrass Rhizosphere	RDFNLGAAAAYGVVLILIISISMVIAGKLEKIRG*
Ga0068858_1010343061	3300005842	Switchgrass Rhizosphere	IAIASELRDFNLGAAGAYGVVLIGIIAISMIVAGKLERWRS*
Ga0068862_1003594241	3300005844	Switchgrass Rhizosphere	AIASELRDFNLGTAAAYGVVLIVIISISMVVAGRLERLRG*
Ga0068862_1016254042	3300005844	Switchgrass Rhizosphere	IAIASELRDFNLGAAGAYGVVLIGIIALSMIAAGKLERWRS*
Ga0068871_1002781522	3300006358	Miscanthus Rhizosphere	VFVPANRPISIAIASELRDFNLGTAAAYGVVLIVIISISMVVAGRLERLRG*
Ga0075428_1015043292	3300006844	Populus Rhizosphere	ANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERMRS*
Ga0075430_1013523892	3300006846	Populus Rhizosphere	IAIASELRDFNLGAAAAYGVVLIVIISISMVVAGKLE*
Ga0075431_1009081632	3300006847	Populus Rhizosphere	IAIASEMRDFNLGTAAAYGVVLIGIIAVVMVGAGKLERLRG*
Ga0079216_111091432	3300006918	Agricultural Soil	PISIAIASELRDFNLGAAAAYGVILIVIISISMVAAGKLEKLRG*
Ga0099793_104804421	3300007258	Vadose Zone Soil	IASELRDFNLGAAAAYGVVLMAIIAISMMVAGKLERLRS*
Ga0075418_110275562	3300009100	Populus Rhizosphere	ELRDFNLGAAAAYGVVLIVIISISMVAAGKLERIRG*
Ga0066709_1039538261	3300009137	Grasslands Soil	DFNLGTAAAYGVILIGIITVSMIIAAKLERRASV*
Ga0114129_125969242	3300009147	Populus Rhizosphere	LRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG*
Ga0114129_126446332	3300009147	Populus Rhizosphere	ANRPISIAIASELRDFNLGAAAAYGVILIVIISISMVAAGKLERIRG*
Ga0105243_104020172	3300009148	Miscanthus Rhizosphere	FVPANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGKLERLRS*
Ga0105243_107078021	3300009148	Miscanthus Rhizosphere	NRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLEKLRG*
Ga0105243_117980631	3300009148	Miscanthus Rhizosphere	RPVSIAIASELRDFNLGTAAAYGVVLMAMIGIIMTVATRLERRRG*
Ga0105243_124536672	3300009148	Miscanthus Rhizosphere	ASELRDFNLGTAAAYGVVLMLMIGVIMTIAARLERARA*
Ga0105243_127190441	3300009148	Miscanthus Rhizosphere	ISIAIASELRDFNLGTAAAYGVVLIVIISISMMVAGRLERLRG*
Ga0075423_117528771	3300009162	Populus Rhizosphere	IAIASELRDFRLGTAAAYGVVLIGIIAVTMTIAARLEPVNS*
Ga0105241_124909702	3300009174	Corn Rhizosphere	SIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG*
Ga0105248_101893952	3300009177	Switchgrass Rhizosphere	IAIASEMRDFNLGTAAAYGVVLIGIIAVVMVAAGKLERLRS*
Ga0126305_109602851	3300010036	Serpentine Soil	SELRDFNLGAAAAYGVVLIVIISISMIVAGRLEKLRG*
Ga0126312_107417591	3300010041	Serpentine Soil	NQPISIRIASEMRDFNLGTAATYGVVLILMVTLAMLAASRLERKRT*
Ga0126384_110444751	3300010046	Tropical Forest Soil	SIAIASELRDFNLGAAAAYGVILIVIISISMMVAGKLERWRS*
Ga0126384_124277362	3300010046	Tropical Forest Soil	SIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGRLERLRG*
Ga0126376_105945732	3300010359	Tropical Forest Soil	ASELRDFNLGAAAAYGVVLIVIISISMVVAGRLERLRG*
Ga0134128_105170532	3300010373	Terrestrial Soil	ISIAIASELRDFNLGAAAAYGVILILIISVSMIVAGKLERWRS*
Ga0134124_117121242	3300010397	Terrestrial Soil	ASELRDFNLGAAAAYGVVLIAIISISMMIAARLEKLR*
Ga0134127_101703262	3300010399	Terrestrial Soil	PGNRPVSIAIASAMRDFNLGTAAAYGVILMAMIALAMIAAGRFERPKGQ*
Ga0134127_102528441	3300010399	Terrestrial Soil	TPGNRPVSIAIASAMRDFNLGTAAAYGVILMAMIALAMIVAGRFEKRTGQ*
Ga0134127_106711631	3300010399	Terrestrial Soil	ISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGKLDKMRG*
Ga0134127_108953572	3300010399	Terrestrial Soil	RDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG*
Ga0134127_130052881	3300010399	Terrestrial Soil	ASEMRDFNLGTAAAYGVVLIGIIAVVMVGAGKLERLRG*
Ga0134122_100703043	3300010400	Terrestrial Soil	SELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG*
Ga0134122_117433662	3300010400	Terrestrial Soil	VPTNRPVSIAIASELRDFNLGTAAAYGVVLMLMIGIIMTVAARLERVRG*
Ga0134122_126951722	3300010400	Terrestrial Soil	VPANRPISIAIASELRDFNLGTAAAYGVVLIVIISISMVVAGRLERLRG*
Ga0134122_129086581	3300010400	Terrestrial Soil	SELRDFNLGAAAAYGVVLIVIISISMVVAGKLERLRS*
Ga0134123_115385483	3300010403	Terrestrial Soil	SIAIASELRDFNLGTAAAYGVVLMLMIGVIMTIAARLERARA*
Ga0105246_111251531	3300011119	Miscanthus Rhizosphere	LRDFNLGAAAAYGVVLIVIISISMVVAGRLERLRG*
Ga0136623_103767331	3300012045	Polar Desert Sand	SVAIASELRDLNPGAAAAYGVVLMGIIAVSMIIAAKFERWRS*
Ga0136634_103786092	3300012046	Polar Desert Sand	SELRDLNLGAAAAYGVVLMGIIAVSMIIAAKFERWRS*
Ga0137383_107436902	3300012199	Vadose Zone Soil	AIASELRDFNLGTAAAYGVVLIGIIAISMIVTGKLERLRS*
Ga0137372_104962421	3300012350	Vadose Zone Soil	RPVSIAIASAMRDFNLGTAAAFGVILITMIAIAMIVAGKLERRA*
Ga0137360_110102511	3300012361	Vadose Zone Soil	IAIASELRDFNLGTAAAYGVVLIGIIAISMIVAGRLERLRG*
Ga0137358_110126231	3300012582	Vadose Zone Soil	LRDFNLGTAAAYGVVLIGVIAISMVVAGKLEQLRS*
Ga0137359_109345492	3300012923	Vadose Zone Soil	ISIAIASELRDFNLGTAAAYGVVLIGVIAISMVVAGKLEQLRS*
Ga0137407_117329592	3300012930	Vadose Zone Soil	SELRDFNLGTAAAYGVVLMLMIGLIMMVATRLERLRA*
Ga0164302_113970932	3300012961	Soil	SIAIASELRDFNLGAAAAYGVVLMGIIAISMMVAGKLERLRS*
Ga0157371_114525211	3300013102	Corn Rhizosphere	ASELRDFNLGTAAAYGVVLIVIISISMVVAGRLERLRG*
Ga0157374_129019992	3300013296	Miscanthus Rhizosphere	RPISIAIASELRDFNLGAAAAYGVVLIGIIAISMVVAGKLERWRS*
Ga0157378_118567222	3300013297	Miscanthus Rhizosphere	VPANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG*
Ga0163162_104438092	3300013306	Switchgrass Rhizosphere	RPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLEKLRG*
Ga0157372_115793502	3300013307	Corn Rhizosphere	RPISIAIASELRDFNLGAAAAYGVILVVIISVSMIVAGKLERWRS*
Ga0163163_133132922	3300014325	Switchgrass Rhizosphere	VNRPISIAIASEMRDFNLGAAAAYGVVLIVIISISMMVAGRLERLRS*
Ga0132257_1043409712	3300015373	Arabidopsis Rhizosphere	SELRDFNLGTAAAYGVVLIVIISMSMAVAGRLERLRG*
Ga0163161_100731081	3300017792	Switchgrass Rhizosphere	ISIAIASEMRDFNLGTAAAYGVVLIGIIAVVMVAAGKLERLRS
Ga0184634_101184382	3300018031	Groundwater Sediment	VSIAIASELRDFNLGTAAAYGVILIGIIAVSMIVAARLERSAKV
Ga0184620_100336181	3300018051	Groundwater Sediment	ELRDFHLGTAAAYGVVLIGIIGISMTVAAKLERLRSG
Ga0184638_11277902	3300018052	Groundwater Sediment	IAIASGLRDLNLGAAAAYGVVLIAIIGLSMMMAAKLERMRS
Ga0184619_103854291	3300018061	Groundwater Sediment	ELRDFNLGTAAAYGVVLMLMIGVIMTIAARLERARA
Ga0184632_102805902	3300018075	Groundwater Sediment	SELRDFNLGAAAAYGVVLMVIIGVSMVVATRLDRTRS
Ga0184609_103296652	3300018076	Groundwater Sediment	AIASELRDFNLGTAAAYGVVLMLMIGIIMTVAARLERARG
Ga0190272_100568512	3300018429	Soil	ISIAIASELRDFNLGAAAAYGVVLMVMIGVIMIVATRLEKSRA
Ga0190272_107685021	3300018429	Soil	FVPTNRPVSIAIASELRDFNLGTAAAYGVVLIVVIAAAMMVASRLERFNLAKEK
Ga0190272_119442001	3300018429	Soil	IAIASELRDFNLGTAAAYGVVLIGIIATIMIVAARLEKVRGSR
Ga0190272_129044902	3300018429	Soil	FVPNNRPVSIAIASELRDFNLGTAAAYGVVLIGIIATVMVLASRLERLNSNKTNRS
Ga0193695_11052612	3300021418	Soil	TPGNRPVSIAIASAMRDFNLGTAAAYGVVLICIIGAAMILAGRFEHR
Ga0224452_12027791	3300022534	Groundwater Sediment	RPVSIAIASAMRDFNLGTAAAYGVVLIAMIAIAMVVAGRVEQSPG
Ga0210143_10611031	3300025792	Natural And Restored Wetlands	PISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGRLEKLRG
Ga0207642_101973321	3300025899	Miscanthus Rhizosphere	ISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG
Ga0207647_101425972	3300025904	Corn Rhizosphere	ELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRT
Ga0207650_107112932	3300025925	Switchgrass Rhizosphere	ELRDFNLGAAAAYGVVLIVIISISMVVAGKLERMRE
Ga0207644_111978661	3300025931	Switchgrass Rhizosphere	ASELRDFNLGTAAAYGVVLMVMIGIIMTVATRLERSRS
Ga0207709_114061731	3300025935	Miscanthus Rhizosphere	ASELRDFNLGTAAAYGVVLMLMIGVIMTIAARLERARA
Ga0207689_107431852	3300025942	Miscanthus Rhizosphere	AIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRT
Ga0207651_101911912	3300025960	Switchgrass Rhizosphere	NRPISIAIASELRDFNLGAAAAYGVVLIVIISISMMVAGRLERRG
Ga0207703_100990941	3300026035	Switchgrass Rhizosphere	SIAIASELRDFNLGTAAAYGVVLIVIISISMIVAGRLERLRG
Ga0207676_103631582	3300026095	Switchgrass Rhizosphere	LRDFNLGTAAAYGVVLIVIISISMAVAGRLERLRG
Ga0207676_104069091	3300026095	Switchgrass Rhizosphere	SIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG
Ga0207676_115381362	3300026095	Switchgrass Rhizosphere	SELRDFNLGAAAAYGVVLIVIISISMMVAGRLERLRG
Ga0207674_104935531	3300026116	Corn Rhizosphere	PISIAIASELRDFNLGTAAAYGVVLIVIISISMMVAGRLERFRG
Ga0209485_12540441	3300027691	Agricultural Soil	AIASELRDFNLGAAAAYGVVLIVIISVSMVAAGKLERIRG
Ga0209177_100463542	3300027775	Agricultural Soil	AIASELRDFNLGSAAAYGVVLIVIISISMMVAGRLERLRG
Ga0209486_109208061	3300027886	Agricultural Soil	VFVPVNRPISIAIASELRDFNVGAAAAYGVVLIVIISVSMVIAGRLEKLR
Ga0268265_100704172	3300028380	Switchgrass Rhizosphere	SEPSISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGKLEKMRG
Ga0268264_110450311	3300028381	Switchgrass Rhizosphere	ELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG
Ga0307405_119965502	3300031731	Rhizosphere	ISIAIASELRDFNLGAAAAYGVVLIVIISISMVVAGRLERLRG
Ga0307468_1000038983	3300031740	Hardwood Forest Soil	RPVSIAIASAMRDFNLGTAAAYGVILIGMIGVAMVVAGRLEKRA
Ga0310904_109287801	3300031854	Soil	ASEMRDFNLGTAAAYGVVLIGIIAVVMVGAGKLERLRG
Ga0310884_103757912	3300031944	Soil	IAIASEMRDFNLGTAAAYGVVLIGIIAVVMVAAGKLERLRG
Ga0307409_1010419911	3300031995	Rhizosphere	PANRPISIAIASELRDFNLGAAAAYGVVLIVIISISMIVAGRLERLRG
Ga0307416_1015971671	3300032002	Rhizosphere	LRDFNLGAAAAYGVVLIVIISISMVVAGKLERLRG
Ga0364942_0011597_2630_2740	3300034165	Sediment	SELRDFNLGTAAAYGVVLMLMIGSLMMVATRLERLR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.59
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.59
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F073624

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign