| Basic Information | |
|---|---|
| Family ID | F073523 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSASHSQAPRRKGR |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 65.83 % |
| % of genes near scaffold ends (potentially truncated) | 28.33 % |
| % of genes from short scaffolds (< 2000 bps) | 92.50 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.167 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.68% β-sheet: 0.00% Coil/Unstructured: 51.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF03733 | YccF | 64.17 |
| PF07510 | DUF1524 | 12.50 |
| PF11716 | MDMPI_N | 8.33 |
| PF01807 | zf-CHC2 | 1.67 |
| PF13662 | Toprim_4 | 1.67 |
| PF00723 | Glyco_hydro_15 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3304 | Uncharacterized membrane protein YccF, DUF307 family | Function unknown [S] | 64.17 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 1.67 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.67 % |
| Unclassified | root | N/A | 48.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10390110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 902 | Open in IMG/M |
| 3300002568|C688J35102_118194154 | Not Available | 537 | Open in IMG/M |
| 3300004081|Ga0063454_100333610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 972 | Open in IMG/M |
| 3300004153|Ga0063455_101257602 | Not Available | 560 | Open in IMG/M |
| 3300005327|Ga0070658_10515198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1034 | Open in IMG/M |
| 3300005329|Ga0070683_100610948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1044 | Open in IMG/M |
| 3300005337|Ga0070682_100042758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2799 | Open in IMG/M |
| 3300005338|Ga0068868_100082418 | All Organisms → cellular organisms → Bacteria | 2580 | Open in IMG/M |
| 3300005338|Ga0068868_100799669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 851 | Open in IMG/M |
| 3300005339|Ga0070660_100351042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1215 | Open in IMG/M |
| 3300005341|Ga0070691_10970612 | Not Available | 528 | Open in IMG/M |
| 3300005354|Ga0070675_101179740 | Not Available | 705 | Open in IMG/M |
| 3300005455|Ga0070663_101267061 | Not Available | 650 | Open in IMG/M |
| 3300005455|Ga0070663_101451568 | Not Available | 609 | Open in IMG/M |
| 3300005457|Ga0070662_101623841 | Not Available | 558 | Open in IMG/M |
| 3300005459|Ga0068867_100802028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
| 3300005564|Ga0070664_100373548 | Not Available | 1300 | Open in IMG/M |
| 3300005616|Ga0068852_101102953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 814 | Open in IMG/M |
| 3300005618|Ga0068864_100808138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 922 | Open in IMG/M |
| 3300005718|Ga0068866_11342151 | Not Available | 521 | Open in IMG/M |
| 3300005834|Ga0068851_10353418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 856 | Open in IMG/M |
| 3300006573|Ga0074055_11488463 | Not Available | 709 | Open in IMG/M |
| 3300006575|Ga0074053_11956274 | Not Available | 716 | Open in IMG/M |
| 3300006755|Ga0079222_10327560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1019 | Open in IMG/M |
| 3300006846|Ga0075430_100136773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2041 | Open in IMG/M |
| 3300006853|Ga0075420_101932590 | Not Available | 504 | Open in IMG/M |
| 3300006854|Ga0075425_100113862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3085 | Open in IMG/M |
| 3300006904|Ga0075424_100919472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 933 | Open in IMG/M |
| 3300009094|Ga0111539_10482247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1444 | Open in IMG/M |
| 3300009098|Ga0105245_10593719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
| 3300009098|Ga0105245_11486507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300009098|Ga0105245_12089092 | Not Available | 620 | Open in IMG/M |
| 3300009148|Ga0105243_10578912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium ramosum | 1077 | Open in IMG/M |
| 3300009156|Ga0111538_11403037 | Not Available | 881 | Open in IMG/M |
| 3300009545|Ga0105237_10840214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
| 3300009545|Ga0105237_12494845 | Not Available | 527 | Open in IMG/M |
| 3300009551|Ga0105238_13002162 | Not Available | 507 | Open in IMG/M |
| 3300009553|Ga0105249_11178545 | Not Available | 837 | Open in IMG/M |
| 3300009553|Ga0105249_11372996 | Not Available | 778 | Open in IMG/M |
| 3300009553|Ga0105249_11569662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300009553|Ga0105249_12658484 | Not Available | 573 | Open in IMG/M |
| 3300009553|Ga0105249_13205568 | Not Available | 526 | Open in IMG/M |
| 3300010375|Ga0105239_11795437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300010395|Ga0058701_10720321 | Not Available | 547 | Open in IMG/M |
| 3300011107|Ga0151490_1022963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1421 | Open in IMG/M |
| 3300012212|Ga0150985_120793747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
| 3300012469|Ga0150984_103799832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 975 | Open in IMG/M |
| 3300012482|Ga0157318_1002398 | Not Available | 1016 | Open in IMG/M |
| 3300012498|Ga0157345_1008573 | Not Available | 857 | Open in IMG/M |
| 3300012501|Ga0157351_1037002 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012898|Ga0157293_10228911 | Not Available | 577 | Open in IMG/M |
| 3300012906|Ga0157295_10113294 | Not Available | 763 | Open in IMG/M |
| 3300012951|Ga0164300_10549302 | Not Available | 671 | Open in IMG/M |
| 3300012961|Ga0164302_10887967 | Not Available | 683 | Open in IMG/M |
| 3300013102|Ga0157371_11443012 | Not Available | 535 | Open in IMG/M |
| 3300013105|Ga0157369_11896819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 605 | Open in IMG/M |
| 3300013105|Ga0157369_12331627 | Not Available | 542 | Open in IMG/M |
| 3300013306|Ga0163162_12626715 | Not Available | 579 | Open in IMG/M |
| 3300014745|Ga0157377_10234368 | Not Available | 1182 | Open in IMG/M |
| 3300015200|Ga0173480_11131995 | Not Available | 524 | Open in IMG/M |
| 3300015371|Ga0132258_13577800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1063 | Open in IMG/M |
| 3300018073|Ga0184624_10314215 | Not Available | 702 | Open in IMG/M |
| 3300018422|Ga0190265_10945953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
| 3300018422|Ga0190265_11287123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 848 | Open in IMG/M |
| 3300018432|Ga0190275_10021169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 5051 | Open in IMG/M |
| 3300018432|Ga0190275_10550293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1195 | Open in IMG/M |
| 3300018432|Ga0190275_10591524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium ramosum | 1156 | Open in IMG/M |
| 3300018466|Ga0190268_10028425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1944 | Open in IMG/M |
| 3300018469|Ga0190270_11957886 | Not Available | 644 | Open in IMG/M |
| 3300018476|Ga0190274_10743667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1031 | Open in IMG/M |
| 3300018920|Ga0190273_10347168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium ramosum | 1017 | Open in IMG/M |
| 3300020081|Ga0206354_10417334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium ramosum | 978 | Open in IMG/M |
| 3300020082|Ga0206353_10439033 | Not Available | 764 | Open in IMG/M |
| 3300025321|Ga0207656_10334088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 754 | Open in IMG/M |
| 3300025899|Ga0207642_10072030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1648 | Open in IMG/M |
| 3300025901|Ga0207688_10060476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2134 | Open in IMG/M |
| 3300025901|Ga0207688_10188433 | Not Available | 1233 | Open in IMG/M |
| 3300025908|Ga0207643_10023243 | All Organisms → cellular organisms → Bacteria | 3418 | Open in IMG/M |
| 3300025909|Ga0207705_10833340 | Not Available | 715 | Open in IMG/M |
| 3300025919|Ga0207657_10281645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium ramosum | 1320 | Open in IMG/M |
| 3300025920|Ga0207649_10590515 | Not Available | 853 | Open in IMG/M |
| 3300025927|Ga0207687_10469262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 1046 | Open in IMG/M |
| 3300025927|Ga0207687_11468336 | Not Available | 586 | Open in IMG/M |
| 3300025940|Ga0207691_10528721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
| 3300025961|Ga0207712_11471998 | Not Available | 610 | Open in IMG/M |
| 3300025981|Ga0207640_10090686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2116 | Open in IMG/M |
| 3300025981|Ga0207640_11969859 | Not Available | 529 | Open in IMG/M |
| 3300025986|Ga0207658_11297969 | Not Available | 666 | Open in IMG/M |
| 3300026023|Ga0207677_10076364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2385 | Open in IMG/M |
| 3300026023|Ga0207677_10260480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1413 | Open in IMG/M |
| 3300026067|Ga0207678_11419462 | Not Available | 613 | Open in IMG/M |
| 3300026089|Ga0207648_11041566 | Not Available | 767 | Open in IMG/M |
| 3300026142|Ga0207698_10533331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1147 | Open in IMG/M |
| 3300026142|Ga0207698_10649263 | Not Available | 1045 | Open in IMG/M |
| 3300027809|Ga0209574_10234054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300028379|Ga0268266_11379411 | Not Available | 680 | Open in IMG/M |
| 3300028589|Ga0247818_10692036 | Not Available | 706 | Open in IMG/M |
| 3300028589|Ga0247818_11048506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300028592|Ga0247822_10131471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1828 | Open in IMG/M |
| 3300028597|Ga0247820_11284194 | Not Available | 530 | Open in IMG/M |
| 3300028754|Ga0307297_10030763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1576 | Open in IMG/M |
| 3300028812|Ga0247825_10386149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
| 3300028812|Ga0247825_10435080 | Not Available | 929 | Open in IMG/M |
| 3300028812|Ga0247825_10522532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300028812|Ga0247825_11445474 | Not Available | 504 | Open in IMG/M |
| 3300028889|Ga0247827_11300345 | Not Available | 509 | Open in IMG/M |
| 3300030336|Ga0247826_10868181 | Not Available | 710 | Open in IMG/M |
| 3300030336|Ga0247826_11033581 | Not Available | 654 | Open in IMG/M |
| 3300031547|Ga0310887_10507050 | Not Available | 727 | Open in IMG/M |
| 3300031854|Ga0310904_10447440 | Not Available | 856 | Open in IMG/M |
| 3300031996|Ga0308176_10559277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 1170 | Open in IMG/M |
| 3300032013|Ga0310906_11117132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300032075|Ga0310890_10149636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 1542 | Open in IMG/M |
| 3300032075|Ga0310890_11663816 | Not Available | 529 | Open in IMG/M |
| 3300032080|Ga0326721_10124355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300032211|Ga0310896_10949778 | Not Available | 500 | Open in IMG/M |
| 3300033551|Ga0247830_10799526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300034007|Ga0334936_018573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp. | 1486 | Open in IMG/M |
| 3300034024|Ga0334927_058814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1044 | Open in IMG/M |
| 3300034666|Ga0314788_143052 | Not Available | 577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 16.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 8.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 7.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.83% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010395 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e | Host-Associated | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Host-Associated | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034007 | Biocrust microbial communities from Mojave Desert, California, United States - 32SMC | Environmental | Open in IMG/M |
| 3300034024 | Biocrust microbial communities from Mojave Desert, California, United States - 23HNC | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_103901101 | 3300001686 | Soil | TQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGR* |
| C688J35102_1181941541 | 3300002568 | Soil | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQVPRRALHGKGR* |
| Ga0063454_1003336102 | 3300004081 | Soil | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGR* |
| Ga0063455_1012576022 | 3300004153 | Soil | HSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGR* |
| Ga0070658_105151982 | 3300005327 | Corn Rhizosphere | MHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR* |
| Ga0070683_1006109481 | 3300005329 | Corn Rhizosphere | MSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR* |
| Ga0070682_1000427581 | 3300005337 | Corn Rhizosphere | MSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR* |
| Ga0068868_1000824182 | 3300005338 | Miscanthus Rhizosphere | MTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPASDSRGPKHVL* |
| Ga0068868_1007996693 | 3300005338 | Miscanthus Rhizosphere | MHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR* |
| Ga0070660_1003510421 | 3300005339 | Corn Rhizosphere | LLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR* |
| Ga0070691_109706121 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR* |
| Ga0070675_1011797401 | 3300005354 | Miscanthus Rhizosphere | MTVVSQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL* |
| Ga0070663_1012670612 | 3300005455 | Corn Rhizosphere | HSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR* |
| Ga0070663_1014515682 | 3300005455 | Corn Rhizosphere | MHSGHMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR* |
| Ga0070662_1016238411 | 3300005457 | Corn Rhizosphere | MHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR* |
| Ga0068867_1008020282 | 3300005459 | Miscanthus Rhizosphere | MHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLNLPLRSTSPSEKRR* |
| Ga0070664_1003735483 | 3300005564 | Corn Rhizosphere | MTVVSQLLAAVGTCTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR* |
| Ga0068852_1011029532 | 3300005616 | Corn Rhizosphere | MAVIAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR* |
| Ga0068864_1008081382 | 3300005618 | Switchgrass Rhizosphere | MTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR* |
| Ga0068866_113421512 | 3300005718 | Miscanthus Rhizosphere | MHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR* |
| Ga0068851_103534183 | 3300005834 | Corn Rhizosphere | HMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR* |
| Ga0074055_114884632 | 3300006573 | Soil | MTVVTQLLAAAGTLTAVVLIVLMALVPLLLDLPLRRAPHSQAVRGKGR* |
| Ga0074053_119562742 | 3300006575 | Soil | MTVVTQLLAAVGTLTEVVLIVLMAVVPLLLDLPLRRAPHSQAVRGKGR* |
| Ga0079222_103275602 | 3300006755 | Agricultural Soil | MHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR* |
| Ga0075430_1001367733 | 3300006846 | Populus Rhizosphere | VTLHSGRMAVVTQLLAAVGTLTAVVLILLMAAVPFLLDLPQRRAPHSQAPRGKGS* |
| Ga0075420_1019325902 | 3300006853 | Populus Rhizosphere | MAVVAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPDSRGPHRKGR* |
| Ga0075425_1001138623 | 3300006854 | Populus Rhizosphere | MHSGRMTLVAHLLAAAGTLAAVVLLLLMAVVPFLLDLPLRPTSKGR* |
| Ga0075424_1009194721 | 3300006904 | Populus Rhizosphere | LQMHSGRMTLVAHLLAAAGTLAAVVLLLLMAVVPFLLDLPLRPTSKGR* |
| Ga0111539_104822472 | 3300009094 | Populus Rhizosphere | MTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRTPHSQAVRGKGR* |
| Ga0105245_105937192 | 3300009098 | Miscanthus Rhizosphere | MTVVTQLLAAVGTCTAVVLILLMAAVPLLLDLPLRRAPHSQAVRGKGR* |
| Ga0105245_114865072 | 3300009098 | Miscanthus Rhizosphere | MTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR* |
| Ga0105245_120890922 | 3300009098 | Miscanthus Rhizosphere | MAVIAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPDSRALQKKGR* |
| Ga0105243_105789121 | 3300009148 | Miscanthus Rhizosphere | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR* |
| Ga0111538_114030372 | 3300009156 | Populus Rhizosphere | MTVVAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPHSRGPHRKGR* |
| Ga0105237_108402142 | 3300009545 | Corn Rhizosphere | MTAVTHLLAAAGTLTAVVLIVLMALVPLLLDLPLRRAPHSQAVRGKGR* |
| Ga0105237_124948452 | 3300009545 | Corn Rhizosphere | MTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL* |
| Ga0105238_130021621 | 3300009551 | Corn Rhizosphere | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL* |
| Ga0105249_111785452 | 3300009553 | Switchgrass Rhizosphere | MTVVTQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL* |
| Ga0105249_113729962 | 3300009553 | Switchgrass Rhizosphere | MAVIAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPHSRTPRPTLGRKGR* |
| Ga0105249_115696621 | 3300009553 | Switchgrass Rhizosphere | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR* |
| Ga0105249_126584842 | 3300009553 | Switchgrass Rhizosphere | MTVVTQLLAAVGTLTAVVLILLMAVVPLLLDLPLRRAPHSQVPRRALHRKGR* |
| Ga0105249_132055681 | 3300009553 | Switchgrass Rhizosphere | LAAVGALTAVVLILLMSAVPLLLDLPLRPASPSEKRR* |
| Ga0105239_117954372 | 3300010375 | Corn Rhizosphere | MTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPAPDSQGSHRKGR* |
| Ga0058701_107203211 | 3300010395 | Agave | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSASHSQAPRRKGR |
| Ga0151490_10229633 | 3300011107 | Soil | MTAVTQLLAAAGTLTAVVLIVLMALVPLLLDLPLRRAPHSQAVRGKGR* |
| Ga0150985_1207937473 | 3300012212 | Avena Fatua Rhizosphere | QLLAAVGTLTAVVLILLMAAVPLLLDLPLRSARHSQAPRGKGR* |
| Ga0150984_1037998323 | 3300012469 | Avena Fatua Rhizosphere | MTVVTQLLAAVGTLTAGVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGR* |
| Ga0157318_10023982 | 3300012482 | Arabidopsis Rhizosphere | MTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQTVRGKGR* |
| Ga0157345_10085732 | 3300012498 | Arabidopsis Rhizosphere | MTVVTQLLAAVGTLTAVVLIVLMAAVPLLLDLPLRRAPHSQAVRGKGR* |
| Ga0157351_10370021 | 3300012501 | Unplanted Soil | MTVVTQLLAAVGTVTAVVLIVLMAAVPLLLDLPLRSAPDSRGSHRKGL* |
| Ga0157293_102289111 | 3300012898 | Soil | MTVVTQLLAAVGTVTAVVLIVLMAAVPLLLDLPLRRAPHSQAVRGKGR* |
| Ga0157295_101132942 | 3300012906 | Soil | MTVVTQLLAAVGTFTAVALILLMAAVPLLLDLPLRSAPDSRGVQKKGR* |
| Ga0164300_105493021 | 3300012951 | Soil | MTVVTQLLAAVGTFTAVVMILLMAAVPLLLELPQRPAPDLREPHGKG |
| Ga0164302_108879672 | 3300012961 | Soil | MTVVRQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPEPRGAHRKGR* |
| Ga0157371_114430121 | 3300013102 | Corn Rhizosphere | MTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRSTSPSEKRR* |
| Ga0157369_118968192 | 3300013105 | Corn Rhizosphere | MTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRSTSPSEKRR* |
| Ga0157369_123316271 | 3300013105 | Corn Rhizosphere | MTVVTQLFAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL* |
| Ga0163162_126267152 | 3300013306 | Switchgrass Rhizosphere | AVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL* |
| Ga0157377_102343681 | 3300014745 | Miscanthus Rhizosphere | MTVVTQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL* |
| Ga0173480_111319951 | 3300015200 | Soil | MTVVTQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPAPDSQAPRRKGR* |
| Ga0132258_135778002 | 3300015371 | Arabidopsis Rhizosphere | MTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQAVRGKGR* |
| Ga0184624_103142153 | 3300018073 | Groundwater Sediment | MTAVTQLLAAAGTLTAVVLIVLMALVPLLLDLPLRRAPHSQAVRGKGR |
| Ga0190265_109459532 | 3300018422 | Soil | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGC |
| Ga0190265_112871232 | 3300018422 | Soil | MTVVTQLLAAVGTLTAAVLILLMAAVPLLLDLPLRSAPHSQAPRRKGC |
| Ga0190275_100211695 | 3300018432 | Soil | MAVVAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPHSQAPRRKGC |
| Ga0190275_105502933 | 3300018432 | Soil | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGR |
| Ga0190275_105915241 | 3300018432 | Soil | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALH |
| Ga0190268_100284253 | 3300018466 | Soil | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQVPRRTLHGKGR |
| Ga0190270_119578861 | 3300018469 | Soil | MAVVAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPDSRGVQKKGR |
| Ga0190274_107436671 | 3300018476 | Soil | MAVVAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPHSQARPALRRKGR |
| Ga0190273_103471681 | 3300018920 | Soil | MTVVTQLLFAVGTLTAVALILLMAAVPLLLDLPLRRAPHSQAPRR |
| Ga0206354_104173342 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MHSGHMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0206353_104390332 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR |
| Ga0207656_103340881 | 3300025321 | Corn Rhizosphere | PLHGRGMHSGHMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0207642_100720303 | 3300025899 | Miscanthus Rhizosphere | MHSGRMALVTHLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR |
| Ga0207688_100604762 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVIAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0207688_101884331 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVVSQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL |
| Ga0207643_100232437 | 3300025908 | Miscanthus Rhizosphere | AAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR |
| Ga0207705_108333401 | 3300025909 | Corn Rhizosphere | MSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0207657_102816452 | 3300025919 | Corn Rhizosphere | MHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0207649_105905152 | 3300025920 | Corn Rhizosphere | MAVIAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR |
| Ga0207687_104692622 | 3300025927 | Miscanthus Rhizosphere | MTVVTQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL |
| Ga0207687_114683362 | 3300025927 | Miscanthus Rhizosphere | MTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0207691_105287211 | 3300025940 | Miscanthus Rhizosphere | MTVVSQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0207712_114719981 | 3300025961 | Switchgrass Rhizosphere | AVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL |
| Ga0207640_100906863 | 3300025981 | Corn Rhizosphere | MHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR |
| Ga0207640_119698591 | 3300025981 | Corn Rhizosphere | MTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL |
| Ga0207658_112979692 | 3300025986 | Switchgrass Rhizosphere | RSQPPHGRSMHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0207677_100763643 | 3300026023 | Miscanthus Rhizosphere | MTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPASDSRGPKHVL |
| Ga0207677_102604802 | 3300026023 | Miscanthus Rhizosphere | MSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR |
| Ga0207678_114194621 | 3300026067 | Corn Rhizosphere | GLRAHSGRMTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPASDSRGPKHVL |
| Ga0207648_110415662 | 3300026089 | Miscanthus Rhizosphere | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLNLPLRSTSPSEKRR |
| Ga0207698_105333312 | 3300026142 | Corn Rhizosphere | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR |
| Ga0207698_106492631 | 3300026142 | Corn Rhizosphere | AAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL |
| Ga0209574_102340542 | 3300027809 | Agave | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRAGSHSRVPRGKGR |
| Ga0268266_113794112 | 3300028379 | Switchgrass Rhizosphere | MTVVTQLLAAVGTLTAVVLILLMAVVPLLLDLPLRRAPHSQVPRRALHGKGR |
| Ga0247818_106920362 | 3300028589 | Soil | MAVIAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPDSRALQKKGR |
| Ga0247818_110485061 | 3300028589 | Soil | GRMTVVTQLFAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQAVRGKGR |
| Ga0247822_101314712 | 3300028592 | Soil | MAVIAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR |
| Ga0247820_112841942 | 3300028597 | Soil | LHSGRMAVVTQLLAAVGALTAVVLILLMAAVPLLLDLPQRRAPHSQAPRGKGS |
| Ga0307297_100307633 | 3300028754 | Soil | MTVVTQVLAAVGALTAVVLILLMAAVPLLLDLPLRRAPHSQAVRGKGR |
| Ga0247825_103861493 | 3300028812 | Soil | RAHSGRMAVVAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPDSRGVQKKGR |
| Ga0247825_104350801 | 3300028812 | Soil | RMTVVSQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL |
| Ga0247825_105225321 | 3300028812 | Soil | HGRGMHSGHMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0247825_114454742 | 3300028812 | Soil | GRMAVVTQLLAAVGALTAGVLILLMAAVPLLLDLPQRRAPHSQAPRGKGS |
| Ga0247827_113003451 | 3300028889 | Soil | MTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSE |
| Ga0247826_108681811 | 3300030336 | Soil | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0247826_110335812 | 3300030336 | Soil | MTAVTHLLAAAGTLTAVVLIVLMALVPLLLDLPLRRAPHSQAVRGKGR |
| Ga0310887_105070501 | 3300031547 | Soil | GHGLRAHSGRMAVIAQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQTVRGKGR |
| Ga0310904_104474402 | 3300031854 | Soil | MTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQTVRGKGR |
| Ga0308176_105592772 | 3300031996 | Soil | MTVVTQLLAAVGTFTAVVLILLMAAVPVLLDLPLRPAPHSRRPHGKGR |
| Ga0310906_111171321 | 3300032013 | Soil | ERAHSGPMTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRTPHSQAVRGKGR |
| Ga0310890_101496363 | 3300032075 | Soil | MTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRTPHSQAVRGKGR |
| Ga0310890_116638162 | 3300032075 | Soil | MTVVTQLLAAVGTFTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR |
| Ga0326721_101243551 | 3300032080 | Soil | VAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPHSRGPHRKGR |
| Ga0310896_109497782 | 3300032211 | Soil | MTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQAVRGKGR |
| Ga0247830_107995261 | 3300033551 | Soil | GHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR |
| Ga0334936_018573_1340_1480 | 3300034007 | Biocrust | VSELLAAVGTLTAVALILLMAVVPILLDLPLDHAARSRPGIRRWTD |
| Ga0334927_058814_152_310 | 3300034024 | Hypolithic Biocrust | MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQVPRRALHGKGR |
| Ga0314788_143052_441_575 | 3300034666 | Soil | TQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQTVRGKGR |
| ⦗Top⦘ |