Basic Information | |
---|---|
Family ID | F073519 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 47 residues |
Representative Sequence | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 54.17 % |
% of genes near scaffold ends (potentially truncated) | 67.50 % |
% of genes from short scaffolds (< 2000 bps) | 90.00 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.667 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (8.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.167 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF01726 | LexA_DNA_bind | 20.00 |
PF00717 | Peptidase_S24 | 13.33 |
PF00817 | IMS | 13.33 |
PF11799 | IMS_C | 6.67 |
PF11798 | IMS_HHH | 5.00 |
PF00583 | Acetyltransf_1 | 3.33 |
PF00156 | Pribosyltran | 3.33 |
PF00837 | T4_deiodinase | 2.50 |
PF03840 | SecG | 2.50 |
PF00230 | MIP | 0.83 |
PF04185 | Phosphoesterase | 0.83 |
PF16859 | TetR_C_11 | 0.83 |
PF01565 | FAD_binding_4 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 13.33 |
COG1314 | Protein translocase subunit SecG | Intracellular trafficking, secretion, and vesicular transport [U] | 2.50 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.83 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.67 % |
Unclassified | root | N/A | 18.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001978|JGI24747J21853_1029354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
3300001991|JGI24743J22301_10041664 | Not Available | 923 | Open in IMG/M |
3300002077|JGI24744J21845_10030464 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300004145|Ga0055489_10086287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
3300005162|Ga0066814_10025554 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300005164|Ga0066815_10008930 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300005328|Ga0070676_10439900 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300005329|Ga0070683_100442367 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300005329|Ga0070683_101644118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
3300005329|Ga0070683_101854412 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300005333|Ga0070677_10369571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 748 | Open in IMG/M |
3300005333|Ga0070677_10562000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter santoriniensis | 627 | Open in IMG/M |
3300005334|Ga0068869_100251937 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
3300005335|Ga0070666_10653062 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300005337|Ga0070682_100526546 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300005338|Ga0068868_100070674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2783 | Open in IMG/M |
3300005338|Ga0068868_100585997 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300005339|Ga0070660_100072632 | All Organisms → cellular organisms → Bacteria | 2689 | Open in IMG/M |
3300005341|Ga0070691_10194564 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300005343|Ga0070687_100418052 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300005353|Ga0070669_100086718 | All Organisms → cellular organisms → Bacteria | 2339 | Open in IMG/M |
3300005367|Ga0070667_100383634 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300005406|Ga0070703_10299741 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300005438|Ga0070701_10096544 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
3300005441|Ga0070700_100226694 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300005456|Ga0070678_100514001 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300005466|Ga0070685_10327405 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300005529|Ga0070741_10441021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1188 | Open in IMG/M |
3300005535|Ga0070684_100086146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2787 | Open in IMG/M |
3300005543|Ga0070672_101042920 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300005578|Ga0068854_101612501 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005937|Ga0081455_10354588 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300006058|Ga0075432_10576742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300006574|Ga0074056_11820633 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300006844|Ga0075428_100741172 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300006845|Ga0075421_100961810 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300006871|Ga0075434_100479783 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300006914|Ga0075436_101247801 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300009081|Ga0105098_10117039 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_24 | 1166 | Open in IMG/M |
3300009098|Ga0105245_11667725 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300009098|Ga0105245_11929021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300009147|Ga0114129_10986674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1062 | Open in IMG/M |
3300009148|Ga0105243_10345026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1365 | Open in IMG/M |
3300009148|Ga0105243_12891020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 521 | Open in IMG/M |
3300009156|Ga0111538_10110588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3490 | Open in IMG/M |
3300009156|Ga0111538_11905805 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300009176|Ga0105242_11115567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 804 | Open in IMG/M |
3300009177|Ga0105248_10253262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1981 | Open in IMG/M |
3300009553|Ga0105249_10561095 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300010362|Ga0126377_13251467 | Not Available | 525 | Open in IMG/M |
3300010399|Ga0134127_10679738 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300010399|Ga0134127_12369917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
3300011119|Ga0105246_10407497 | Not Available | 1131 | Open in IMG/M |
3300012501|Ga0157351_1013535 | Not Available | 783 | Open in IMG/M |
3300012505|Ga0157339_1069510 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_24 | 505 | Open in IMG/M |
3300012506|Ga0157324_1042737 | Not Available | 561 | Open in IMG/M |
3300012508|Ga0157315_1075034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300012896|Ga0157303_10007972 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300012960|Ga0164301_11503590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 555 | Open in IMG/M |
3300012961|Ga0164302_10357392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 979 | Open in IMG/M |
3300013102|Ga0157371_10057755 | All Organisms → cellular organisms → Bacteria | 2752 | Open in IMG/M |
3300013296|Ga0157374_10333305 | Not Available | 1505 | Open in IMG/M |
3300013307|Ga0157372_10611357 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300014270|Ga0075325_1043352 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300014271|Ga0075326_1022365 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
3300014325|Ga0163163_10142086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2443 | Open in IMG/M |
3300015077|Ga0173483_10127926 | Not Available | 1095 | Open in IMG/M |
3300015077|Ga0173483_10836164 | Not Available | 535 | Open in IMG/M |
3300015371|Ga0132258_11271795 | Not Available | 1860 | Open in IMG/M |
3300015373|Ga0132257_100744264 | Not Available | 1221 | Open in IMG/M |
3300015373|Ga0132257_101069870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1017 | Open in IMG/M |
3300015374|Ga0132255_100891161 | Not Available | 1330 | Open in IMG/M |
3300017792|Ga0163161_11949089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
3300018469|Ga0190270_10279823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1472 | Open in IMG/M |
3300019377|Ga0190264_11316607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
3300021445|Ga0182009_10391626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 716 | Open in IMG/M |
3300022214|Ga0224505_10016563 | All Organisms → cellular organisms → Bacteria | 3400 | Open in IMG/M |
3300022309|Ga0224510_10161495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1325 | Open in IMG/M |
3300022892|Ga0247753_1043154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 565 | Open in IMG/M |
3300022893|Ga0247787_1020783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 877 | Open in IMG/M |
3300022915|Ga0247790_10037559 | Not Available | 1088 | Open in IMG/M |
3300023062|Ga0247791_1016784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1087 | Open in IMG/M |
3300023071|Ga0247752_1086003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium | 530 | Open in IMG/M |
3300023102|Ga0247754_1055752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 921 | Open in IMG/M |
3300025559|Ga0210087_1011880 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
3300025899|Ga0207642_10238053 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300025899|Ga0207642_10616668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
3300025908|Ga0207643_10047878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2421 | Open in IMG/M |
3300025909|Ga0207705_10243190 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300025919|Ga0207657_10044459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3904 | Open in IMG/M |
3300025920|Ga0207649_10868510 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300025922|Ga0207646_11177541 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300025926|Ga0207659_10211910 | Not Available | 1553 | Open in IMG/M |
3300025934|Ga0207686_10312228 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300025934|Ga0207686_10989231 | Not Available | 682 | Open in IMG/M |
3300025937|Ga0207669_10183213 | Not Available | 1503 | Open in IMG/M |
3300025945|Ga0207679_10509666 | Not Available | 1075 | Open in IMG/M |
3300025986|Ga0207658_10465837 | Not Available | 1121 | Open in IMG/M |
3300026041|Ga0207639_11045738 | Not Available | 765 | Open in IMG/M |
3300026075|Ga0207708_10126845 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
3300026089|Ga0207648_10986085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300026090|Ga0208912_1035503 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_24 | 728 | Open in IMG/M |
3300026095|Ga0207676_10244497 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
3300026116|Ga0207674_10601140 | Not Available | 1062 | Open in IMG/M |
3300026118|Ga0207675_102451000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 533 | Open in IMG/M |
3300026142|Ga0207698_10080507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2624 | Open in IMG/M |
3300027675|Ga0209077_1133130 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_24 | 693 | Open in IMG/M |
3300028380|Ga0268265_11100027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 789 | Open in IMG/M |
3300028380|Ga0268265_11929273 | Not Available | 597 | Open in IMG/M |
3300028381|Ga0268264_11554758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
3300028589|Ga0247818_10229061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1225 | Open in IMG/M |
3300028589|Ga0247818_10386981 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300028812|Ga0247825_10040650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3084 | Open in IMG/M |
3300031892|Ga0310893_10452116 | Not Available | 570 | Open in IMG/M |
3300031940|Ga0310901_10412407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300031944|Ga0310884_10838099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 564 | Open in IMG/M |
3300032013|Ga0310906_10089510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1656 | Open in IMG/M |
3300032013|Ga0310906_10211726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1183 | Open in IMG/M |
3300032075|Ga0310890_10969080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
3300032179|Ga0310889_10096117 | Not Available | 1253 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.33% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.17% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.17% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.33% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.50% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.50% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.67% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.67% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.67% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.83% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026090 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24747J21853_10293542 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVX* |
JGI24743J22301_100416643 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREE |
JGI24744J21845_100304641 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE* |
Ga0055489_100862872 | 3300004145 | Natural And Restored Wetlands | MAAGGSGRPRKVRTPKGRTLGKTQAAKADGKWNREETAGRTTGKGETVG* |
Ga0066814_100255541 | 3300005162 | Soil | MAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRMTGKGERVG* |
Ga0066815_100089301 | 3300005164 | Soil | VRAGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRMTGKGERVG* |
Ga0070676_104399001 | 3300005328 | Miscanthus Rhizosphere | MAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGR |
Ga0070683_1004423671 | 3300005329 | Corn Rhizosphere | VRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREET |
Ga0070683_1016441181 | 3300005329 | Corn Rhizosphere | MAAGGSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGETVG* |
Ga0070683_1018544121 | 3300005329 | Corn Rhizosphere | AGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0070677_103695711 | 3300005333 | Miscanthus Rhizosphere | MAAGAFVRPRKVRTPQGRTLGKSQAAKADGKWNREETAGLRAGKGETVG* |
Ga0070677_105620001 | 3300005333 | Miscanthus Rhizosphere | VRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0068869_1002519374 | 3300005334 | Miscanthus Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKG |
Ga0070666_106530622 | 3300005335 | Switchgrass Rhizosphere | VRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0070682_1005265463 | 3300005337 | Corn Rhizosphere | VRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERV |
Ga0068868_1000706744 | 3300005338 | Miscanthus Rhizosphere | RKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0068868_1005859973 | 3300005338 | Miscanthus Rhizosphere | RKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE* |
Ga0070660_1000726321 | 3300005339 | Corn Rhizosphere | GRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0070691_101945643 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTT |
Ga0070687_1004180522 | 3300005343 | Switchgrass Rhizosphere | VRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE* |
Ga0070669_1000867182 | 3300005353 | Switchgrass Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0070667_1003836343 | 3300005367 | Switchgrass Rhizosphere | MAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0070703_102997412 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0070701_100965441 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0070700_1002266941 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0070678_1005140011 | 3300005456 | Miscanthus Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRT |
Ga0070685_103274053 | 3300005466 | Switchgrass Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRMTGKGERVG* |
Ga0070741_104410214 | 3300005529 | Surface Soil | VTAGGASRPRKVRTPQGRTLGKPQAAKADGKWHRKETASGDKLSGD |
Ga0070684_1000861469 | 3300005535 | Corn Rhizosphere | MAAGGSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGE |
Ga0070672_1010429203 | 3300005543 | Miscanthus Rhizosphere | MAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAG |
Ga0068854_1016125013 | 3300005578 | Corn Rhizosphere | VRAKPRDSRVYTVHAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKG |
Ga0081455_103545882 | 3300005937 | Tabebuia Heterophylla Rhizosphere | AGRVTAGPLPAGSRKVRTPQGKDAGAIQAAKADGKWNRKETAGRFTREVGR* |
Ga0075432_105767421 | 3300006058 | Populus Rhizosphere | VAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0074056_118206332 | 3300006574 | Soil | QGRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0075428_1007411721 | 3300006844 | Populus Rhizosphere | VAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAG |
Ga0075421_1009618101 | 3300006845 | Populus Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAG |
Ga0075434_1004797833 | 3300006871 | Populus Rhizosphere | VRAGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0075436_1012478012 | 3300006914 | Populus Rhizosphere | QGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0105098_101170392 | 3300009081 | Freshwater Sediment | MTAAGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGQWLRLLAGKGETVG* |
Ga0105245_116677251 | 3300009098 | Miscanthus Rhizosphere | PRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0105245_119290213 | 3300009098 | Miscanthus Rhizosphere | VAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREE |
Ga0114129_109866743 | 3300009147 | Populus Rhizosphere | MAAGGFGRPRKVRTPQGRTLGKSQAAKADGKWNREETAGLRAGKGETVG* |
Ga0105243_103450262 | 3300009148 | Miscanthus Rhizosphere | PRKVRTPQGRTLGKSQAAKADGKWNREETAGLRAGKGETVG* |
Ga0105243_128910202 | 3300009148 | Miscanthus Rhizosphere | PRKVRTPQGRTLGKSQAAKADGKWNREETAGSRTGKGETVG* |
Ga0111538_101105889 | 3300009156 | Populus Rhizosphere | VTAVGVSRPRKVRTPKGRTLGKPQAAKADGKWNRKETATGERLSP |
Ga0111538_119058051 | 3300009156 | Populus Rhizosphere | AYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0105242_111155671 | 3300009176 | Miscanthus Rhizosphere | MAAGGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0105248_102532621 | 3300009177 | Switchgrass Rhizosphere | GRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE* |
Ga0105249_105610951 | 3300009553 | Switchgrass Rhizosphere | PRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0126377_132514672 | 3300010362 | Tropical Forest Soil | MAAGGFGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGA |
Ga0134127_106797381 | 3300010399 | Terrestrial Soil | PQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0134127_123699173 | 3300010399 | Terrestrial Soil | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGTQVSV |
Ga0105246_104074973 | 3300011119 | Miscanthus Rhizosphere | MAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAGAH |
Ga0157351_10135352 | 3300012501 | Unplanted Soil | TVGLAGRMAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0157339_10695101 | 3300012505 | Arabidopsis Rhizosphere | GRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG* |
Ga0157324_10427372 | 3300012506 | Arabidopsis Rhizosphere | AAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNRKETAD* |
Ga0157315_10750341 | 3300012508 | Arabidopsis Rhizosphere | MAANGLGRSRKVRTPQGRTLGKSQAAKADGKWNREETAGRTTGKGETVG* |
Ga0157303_100079723 | 3300012896 | Soil | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE* |
Ga0164301_115035902 | 3300012960 | Soil | QGRTLGKPQAAKADGKWNREETAGRMTGKGERVG* |
Ga0164302_103573922 | 3300012961 | Soil | MAADGLGRSRKVRTPQSRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0157371_100577551 | 3300013102 | Corn Rhizosphere | VAAGGFGRPRKVRTPQGGTLGKPQAAKADGKWNREETA |
Ga0157374_103333051 | 3300013296 | Miscanthus Rhizosphere | MAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETA |
Ga0157372_106113573 | 3300013307 | Corn Rhizosphere | PRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE* |
Ga0075325_10433522 | 3300014270 | Natural And Restored Wetlands | MAAGGSGRPRKVRTPKGRTLGKTQAAKADGKWNREETAGRMTGKGETVG* |
Ga0075326_10223654 | 3300014271 | Natural And Restored Wetlands | MAAGGSGRPRKVRTPKGRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0163163_101420861 | 3300014325 | Switchgrass Rhizosphere | KVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG* |
Ga0173483_101279263 | 3300015077 | Soil | VAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAGAQASVRVK |
Ga0173483_108361641 | 3300015077 | Soil | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGAQASVRVK |
Ga0132258_112717951 | 3300015371 | Arabidopsis Rhizosphere | MAAGGFGRPRKVRTPKGRTLGKSQAAKADGKWNREETAGRSTGKGETVG* |
Ga0132257_1007442641 | 3300015373 | Arabidopsis Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRMTGKG |
Ga0132257_1010698704 | 3300015373 | Arabidopsis Rhizosphere | MAAGGFGRPRKVRTPKGRTLGKSQAAKADGQWHRK |
Ga0132255_1008911611 | 3300015374 | Arabidopsis Rhizosphere | MAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTT |
Ga0163161_119490893 | 3300017792 | Switchgrass Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGE |
Ga0190270_102798232 | 3300018469 | Soil | GRGRFVRPRKVRTPQGRTLGKSQAAKADGKWHREETAGLRAGKGETVG |
Ga0190264_113166071 | 3300019377 | Soil | AGRMAAGGFGRPRKVRTPQGRTLGKSQAAKADGKWHREETAGLRAGKGETVG |
Ga0182009_103916263 | 3300021445 | Soil | VIASRGVFGRGGPRKVRTPQGRTLGKSQAAKADGKWHRKETASGE |
Ga0224505_100165631 | 3300022214 | Sediment | TVRRAGRVTAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGG |
Ga0224510_101614951 | 3300022309 | Sediment | VLDASRALRPRKVRTPQGRTLGKPQAAKADGKWNREETAGREAGKGERVG |
Ga0247753_10431541 | 3300022892 | Soil | SCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGERVE |
Ga0247787_10207832 | 3300022893 | Soil | CRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGETVG |
Ga0247790_100375591 | 3300022915 | Soil | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGER |
Ga0247791_10167842 | 3300023062 | Soil | RYLGVAGRMAAGGSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGETVG |
Ga0247752_10860031 | 3300023071 | Soil | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0247754_10557523 | 3300023102 | Soil | MAAGGSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGET |
Ga0210087_10118801 | 3300025559 | Natural And Restored Wetlands | MAAGGSGRPRKVRTPKGRTLGKTQAAKADGKWNREETAGRMTGKGETVG |
Ga0207642_102380531 | 3300025899 | Miscanthus Rhizosphere | MAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG |
Ga0207642_106166682 | 3300025899 | Miscanthus Rhizosphere | MAAGAFVRPRKVRTPQGRTLGKSQAAKADGKWNREETAGLRAGKGETVG |
Ga0207643_100478783 | 3300025908 | Miscanthus Rhizosphere | AYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0207705_102431903 | 3300025909 | Corn Rhizosphere | VAAVGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE |
Ga0207657_100444597 | 3300025919 | Corn Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERV |
Ga0207649_108685102 | 3300025920 | Corn Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE |
Ga0207646_111775411 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0207659_102119101 | 3300025926 | Miscanthus Rhizosphere | GAYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0207686_103122281 | 3300025934 | Miscanthus Rhizosphere | GRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE |
Ga0207686_109892311 | 3300025934 | Miscanthus Rhizosphere | GRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0207669_101832132 | 3300025937 | Miscanthus Rhizosphere | RKPRSFGAYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0207679_105096663 | 3300025945 | Corn Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGR |
Ga0207658_104658371 | 3300025986 | Switchgrass Rhizosphere | VRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0207639_110457383 | 3300026041 | Corn Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETA |
Ga0207708_101268451 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | RKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG |
Ga0207648_109860853 | 3300026089 | Miscanthus Rhizosphere | VAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAGAQAS |
Ga0208912_10355032 | 3300026090 | Natural And Restored Wetlands | MLGAGRMAAGGSGRPRKVRTPKGRTLGKTQAAKADGKWNREETAGRMTGKGETVG |
Ga0207676_102444971 | 3300026095 | Switchgrass Rhizosphere | AGRATVGLAGRMAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG |
Ga0207674_106011401 | 3300026116 | Corn Rhizosphere | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGAQASVRVKR |
Ga0207675_1024510001 | 3300026118 | Switchgrass Rhizosphere | IETYARSRYLGVAGRMAAGGSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGETVG |
Ga0207698_100805071 | 3300026142 | Corn Rhizosphere | RKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0209077_11331301 | 3300027675 | Freshwater Sediment | MTAAGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGQWLRLLAGKGETVG |
Ga0268265_111000272 | 3300028380 | Switchgrass Rhizosphere | RAALCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGETVG |
Ga0268265_119292731 | 3300028380 | Switchgrass Rhizosphere | PRGSRAYTVWAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0268264_115547582 | 3300028381 | Switchgrass Rhizosphere | ADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG |
Ga0247818_102290611 | 3300028589 | Soil | MAAGGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG |
Ga0247818_103869811 | 3300028589 | Soil | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGTQVSVR |
Ga0247825_100406505 | 3300028812 | Soil | MAAGASVRPRKVRTPQGRMLGKSQAAKADGKWHREKTAGLRAGKGETVG |
Ga0310893_104521161 | 3300031892 | Soil | SRDCAAYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0310901_104124073 | 3300031940 | Soil | VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGTQ |
Ga0310884_108380992 | 3300031944 | Soil | PRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
Ga0310906_100895103 | 3300032013 | Soil | AEYNRAAGRMAAGASVRPRKVRTPQGRMLGKSQAAKADGKWHREKTAGLRAGKGETVG |
Ga0310906_102117263 | 3300032013 | Soil | MAAGASGRPRKVRTPQGRTLGKSQAAKADGKWNREETAGLRAGKGETVG |
Ga0310890_109690802 | 3300032075 | Soil | GAFVRPRKVRTPQGRMLEKSQAAKADGKWHREKTAGLRAGKGETVG |
Ga0310889_100961171 | 3300032179 | Soil | EETTLANSRDFAAYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG |
⦗Top⦘ |