NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073519

Metagenome / Metatranscriptome Family F073519

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073519
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 47 residues
Representative Sequence VAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Number of Associated Samples 105
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.17 %
% of genes near scaffold ends (potentially truncated) 67.50 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(8.333 % of family members)
Environment Ontology (ENVO) Unclassified
(45.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(69.167 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF01726LexA_DNA_bind 20.00
PF00717Peptidase_S24 13.33
PF00817IMS 13.33
PF11799IMS_C 6.67
PF11798IMS_HHH 5.00
PF00583Acetyltransf_1 3.33
PF00156Pribosyltran 3.33
PF00837T4_deiodinase 2.50
PF03840SecG 2.50
PF00230MIP 0.83
PF04185Phosphoesterase 0.83
PF16859TetR_C_11 0.83
PF01565FAD_binding_4 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0389Nucleotidyltransferase/DNA polymerase DinP involved in DNA repairReplication, recombination and repair [L] 13.33
COG1314Protein translocase subunit SecGIntracellular trafficking, secretion, and vesicular transport [U] 2.50
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.83
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.67 %
UnclassifiedrootN/A18.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001978|JGI24747J21853_1029354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300001991|JGI24743J22301_10041664Not Available923Open in IMG/M
3300002077|JGI24744J21845_10030464All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300004145|Ga0055489_10086287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
3300005162|Ga0066814_10025554All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300005164|Ga0066815_10008930All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300005328|Ga0070676_10439900All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300005329|Ga0070683_100442367All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300005329|Ga0070683_101644118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300005329|Ga0070683_101854412All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005333|Ga0070677_10369571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae748Open in IMG/M
3300005333|Ga0070677_10562000All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter santoriniensis627Open in IMG/M
3300005334|Ga0068869_100251937All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300005335|Ga0070666_10653062All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300005337|Ga0070682_100526546All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300005338|Ga0068868_100070674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2783Open in IMG/M
3300005338|Ga0068868_100585997All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300005339|Ga0070660_100072632All Organisms → cellular organisms → Bacteria2689Open in IMG/M
3300005341|Ga0070691_10194564All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300005343|Ga0070687_100418052All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300005353|Ga0070669_100086718All Organisms → cellular organisms → Bacteria2339Open in IMG/M
3300005367|Ga0070667_100383634All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300005406|Ga0070703_10299741All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300005438|Ga0070701_10096544All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300005441|Ga0070700_100226694All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300005456|Ga0070678_100514001All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300005466|Ga0070685_10327405All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300005529|Ga0070741_10441021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1188Open in IMG/M
3300005535|Ga0070684_100086146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2787Open in IMG/M
3300005543|Ga0070672_101042920All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300005578|Ga0068854_101612501All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005937|Ga0081455_10354588All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300006058|Ga0075432_10576742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300006574|Ga0074056_11820633All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300006844|Ga0075428_100741172All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300006845|Ga0075421_100961810All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300006871|Ga0075434_100479783All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300006914|Ga0075436_101247801All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300009081|Ga0105098_10117039All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_241166Open in IMG/M
3300009098|Ga0105245_11667725All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300009098|Ga0105245_11929021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300009147|Ga0114129_10986674All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1062Open in IMG/M
3300009148|Ga0105243_10345026All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1365Open in IMG/M
3300009148|Ga0105243_12891020All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria521Open in IMG/M
3300009156|Ga0111538_10110588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3490Open in IMG/M
3300009156|Ga0111538_11905805All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300009176|Ga0105242_11115567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia804Open in IMG/M
3300009177|Ga0105248_10253262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1981Open in IMG/M
3300009553|Ga0105249_10561095All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300010362|Ga0126377_13251467Not Available525Open in IMG/M
3300010399|Ga0134127_10679738All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300010399|Ga0134127_12369917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300011119|Ga0105246_10407497Not Available1131Open in IMG/M
3300012501|Ga0157351_1013535Not Available783Open in IMG/M
3300012505|Ga0157339_1069510All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_24505Open in IMG/M
3300012506|Ga0157324_1042737Not Available561Open in IMG/M
3300012508|Ga0157315_1075034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300012896|Ga0157303_10007972All Organisms → cellular organisms → Bacteria1529Open in IMG/M
3300012960|Ga0164301_11503590All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria555Open in IMG/M
3300012961|Ga0164302_10357392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia979Open in IMG/M
3300013102|Ga0157371_10057755All Organisms → cellular organisms → Bacteria2752Open in IMG/M
3300013296|Ga0157374_10333305Not Available1505Open in IMG/M
3300013307|Ga0157372_10611357All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300014270|Ga0075325_1043352All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300014271|Ga0075326_1022365All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300014325|Ga0163163_10142086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2443Open in IMG/M
3300015077|Ga0173483_10127926Not Available1095Open in IMG/M
3300015077|Ga0173483_10836164Not Available535Open in IMG/M
3300015371|Ga0132258_11271795Not Available1860Open in IMG/M
3300015373|Ga0132257_100744264Not Available1221Open in IMG/M
3300015373|Ga0132257_101069870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1017Open in IMG/M
3300015374|Ga0132255_100891161Not Available1330Open in IMG/M
3300017792|Ga0163161_11949089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300018469|Ga0190270_10279823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1472Open in IMG/M
3300019377|Ga0190264_11316607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300021445|Ga0182009_10391626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300022214|Ga0224505_10016563All Organisms → cellular organisms → Bacteria3400Open in IMG/M
3300022309|Ga0224510_10161495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1325Open in IMG/M
3300022892|Ga0247753_1043154All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria565Open in IMG/M
3300022893|Ga0247787_1020783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia877Open in IMG/M
3300022915|Ga0247790_10037559Not Available1088Open in IMG/M
3300023062|Ga0247791_1016784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1087Open in IMG/M
3300023071|Ga0247752_1086003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium530Open in IMG/M
3300023102|Ga0247754_1055752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium921Open in IMG/M
3300025559|Ga0210087_1011880All Organisms → cellular organisms → Bacteria1829Open in IMG/M
3300025899|Ga0207642_10238053All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300025899|Ga0207642_10616668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia677Open in IMG/M
3300025908|Ga0207643_10047878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2421Open in IMG/M
3300025909|Ga0207705_10243190All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300025919|Ga0207657_10044459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3904Open in IMG/M
3300025920|Ga0207649_10868510All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300025922|Ga0207646_11177541All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300025926|Ga0207659_10211910Not Available1553Open in IMG/M
3300025934|Ga0207686_10312228All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300025934|Ga0207686_10989231Not Available682Open in IMG/M
3300025937|Ga0207669_10183213Not Available1503Open in IMG/M
3300025945|Ga0207679_10509666Not Available1075Open in IMG/M
3300025986|Ga0207658_10465837Not Available1121Open in IMG/M
3300026041|Ga0207639_11045738Not Available765Open in IMG/M
3300026075|Ga0207708_10126845All Organisms → cellular organisms → Bacteria1992Open in IMG/M
3300026089|Ga0207648_10986085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300026090|Ga0208912_1035503All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_24728Open in IMG/M
3300026095|Ga0207676_10244497All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300026116|Ga0207674_10601140Not Available1062Open in IMG/M
3300026118|Ga0207675_102451000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae533Open in IMG/M
3300026142|Ga0207698_10080507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2624Open in IMG/M
3300027675|Ga0209077_1133130All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_24693Open in IMG/M
3300028380|Ga0268265_11100027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia789Open in IMG/M
3300028380|Ga0268265_11929273Not Available597Open in IMG/M
3300028381|Ga0268264_11554758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia672Open in IMG/M
3300028589|Ga0247818_10229061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1225Open in IMG/M
3300028589|Ga0247818_10386981All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300028812|Ga0247825_10040650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3084Open in IMG/M
3300031892|Ga0310893_10452116Not Available570Open in IMG/M
3300031940|Ga0310901_10412407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300031944|Ga0310884_10838099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae564Open in IMG/M
3300032013|Ga0310906_10089510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1656Open in IMG/M
3300032013|Ga0310906_10211726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300032075|Ga0310890_10969080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia682Open in IMG/M
3300032179|Ga0310889_10096117Not Available1253Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere5.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.17%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.33%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.50%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.67%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.67%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.67%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.83%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.83%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002077Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3Host-AssociatedOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012506Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610Host-AssociatedOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022309Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5EnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026090Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24747J21853_102935423300001978Corn, Switchgrass And Miscanthus RhizosphereVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVX*
JGI24743J22301_1004166433300001991Corn, Switchgrass And Miscanthus RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREE
JGI24744J21845_1003046413300002077Corn, Switchgrass And Miscanthus RhizosphereVRAGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE*
Ga0055489_1008628723300004145Natural And Restored WetlandsMAAGGSGRPRKVRTPKGRTLGKTQAAKADGKWNREETAGRTTGKGETVG*
Ga0066814_1002555413300005162SoilMAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRMTGKGERVG*
Ga0066815_1000893013300005164SoilVRAGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRMTGKGERVG*
Ga0070676_1043990013300005328Miscanthus RhizosphereMAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGR
Ga0070683_10044236713300005329Corn RhizosphereVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREET
Ga0070683_10164411813300005329Corn RhizosphereMAAGGSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGETVG*
Ga0070683_10185441213300005329Corn RhizosphereAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0070677_1036957113300005333Miscanthus RhizosphereMAAGAFVRPRKVRTPQGRTLGKSQAAKADGKWNREETAGLRAGKGETVG*
Ga0070677_1056200013300005333Miscanthus RhizosphereVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0068869_10025193743300005334Miscanthus RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKG
Ga0070666_1065306223300005335Switchgrass RhizosphereVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0070682_10052654633300005337Corn RhizosphereVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERV
Ga0068868_10007067443300005338Miscanthus RhizosphereRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0068868_10058599733300005338Miscanthus RhizosphereRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE*
Ga0070660_10007263213300005339Corn RhizosphereGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0070691_1019456433300005341Corn, Switchgrass And Miscanthus RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTT
Ga0070687_10041805223300005343Switchgrass RhizosphereVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE*
Ga0070669_10008671823300005353Switchgrass RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0070667_10038363433300005367Switchgrass RhizosphereMAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0070703_1029974123300005406Corn, Switchgrass And Miscanthus RhizosphereVAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0070701_1009654413300005438Corn, Switchgrass And Miscanthus RhizosphereRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0070700_10022669413300005441Corn, Switchgrass And Miscanthus RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0070678_10051400113300005456Miscanthus RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRT
Ga0070685_1032740533300005466Switchgrass RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRMTGKGERVG*
Ga0070741_1044102143300005529Surface SoilVTAGGASRPRKVRTPQGRTLGKPQAAKADGKWHRKETASGDKLSGD
Ga0070684_10008614693300005535Corn RhizosphereMAAGGSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGE
Ga0070672_10104292033300005543Miscanthus RhizosphereMAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAG
Ga0068854_10161250133300005578Corn RhizosphereVRAKPRDSRVYTVHAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKG
Ga0081455_1035458823300005937Tabebuia Heterophylla RhizosphereAGRVTAGPLPAGSRKVRTPQGKDAGAIQAAKADGKWNRKETAGRFTREVGR*
Ga0075432_1057674213300006058Populus RhizosphereVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0074056_1182063323300006574SoilQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0075428_10074117213300006844Populus RhizosphereVAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAG
Ga0075421_10096181013300006845Populus RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAG
Ga0075434_10047978333300006871Populus RhizosphereVRAGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0075436_10124780123300006914Populus RhizosphereQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0105098_1011703923300009081Freshwater SedimentMTAAGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGQWLRLLAGKGETVG*
Ga0105245_1166772513300009098Miscanthus RhizospherePRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0105245_1192902133300009098Miscanthus RhizosphereVAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREE
Ga0114129_1098667433300009147Populus RhizosphereMAAGGFGRPRKVRTPQGRTLGKSQAAKADGKWNREETAGLRAGKGETVG*
Ga0105243_1034502623300009148Miscanthus RhizospherePRKVRTPQGRTLGKSQAAKADGKWNREETAGLRAGKGETVG*
Ga0105243_1289102023300009148Miscanthus RhizospherePRKVRTPQGRTLGKSQAAKADGKWNREETAGSRTGKGETVG*
Ga0111538_1011058893300009156Populus RhizosphereVTAVGVSRPRKVRTPKGRTLGKPQAAKADGKWNRKETATGERLSP
Ga0111538_1190580513300009156Populus RhizosphereAYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0105242_1111556713300009176Miscanthus RhizosphereMAAGGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0105248_1025326213300009177Switchgrass RhizosphereGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE*
Ga0105249_1056109513300009553Switchgrass RhizospherePRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0126377_1325146723300010362Tropical Forest SoilMAAGGFGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGA
Ga0134127_1067973813300010399Terrestrial SoilPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0134127_1236991733300010399Terrestrial SoilVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGTQVSV
Ga0105246_1040749733300011119Miscanthus RhizosphereMAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAGAH
Ga0157351_101353523300012501Unplanted SoilTVGLAGRMAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0157339_106951013300012505Arabidopsis RhizosphereGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG*
Ga0157324_104273723300012506Arabidopsis RhizosphereAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNRKETAD*
Ga0157315_107503413300012508Arabidopsis RhizosphereMAANGLGRSRKVRTPQGRTLGKSQAAKADGKWNREETAGRTTGKGETVG*
Ga0157303_1000797233300012896SoilVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE*
Ga0164301_1150359023300012960SoilQGRTLGKPQAAKADGKWNREETAGRMTGKGERVG*
Ga0164302_1035739223300012961SoilMAADGLGRSRKVRTPQSRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0157371_1005775513300013102Corn RhizosphereVAAGGFGRPRKVRTPQGGTLGKPQAAKADGKWNREETA
Ga0157374_1033330513300013296Miscanthus RhizosphereMAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETA
Ga0157372_1061135733300013307Corn RhizospherePRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE*
Ga0075325_104335223300014270Natural And Restored WetlandsMAAGGSGRPRKVRTPKGRTLGKTQAAKADGKWNREETAGRMTGKGETVG*
Ga0075326_102236543300014271Natural And Restored WetlandsMAAGGSGRPRKVRTPKGRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0163163_1014208613300014325Switchgrass RhizosphereKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG*
Ga0173483_1012792633300015077SoilVAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAGAQASVRVK
Ga0173483_1083616413300015077SoilVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGAQASVRVK
Ga0132258_1127179513300015371Arabidopsis RhizosphereMAAGGFGRPRKVRTPKGRTLGKSQAAKADGKWNREETAGRSTGKGETVG*
Ga0132257_10074426413300015373Arabidopsis RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRMTGKG
Ga0132257_10106987043300015373Arabidopsis RhizosphereMAAGGFGRPRKVRTPKGRTLGKSQAAKADGQWHRK
Ga0132255_10089116113300015374Arabidopsis RhizosphereMAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTT
Ga0163161_1194908933300017792Switchgrass RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGE
Ga0190270_1027982323300018469SoilGRGRFVRPRKVRTPQGRTLGKSQAAKADGKWHREETAGLRAGKGETVG
Ga0190264_1131660713300019377SoilAGRMAAGGFGRPRKVRTPQGRTLGKSQAAKADGKWHREETAGLRAGKGETVG
Ga0182009_1039162633300021445SoilVIASRGVFGRGGPRKVRTPQGRTLGKSQAAKADGKWHRKETASGE
Ga0224505_1001656313300022214SedimentTVRRAGRVTAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGG
Ga0224510_1016149513300022309SedimentVLDASRALRPRKVRTPQGRTLGKPQAAKADGKWNREETAGREAGKGERVG
Ga0247753_104315413300022892SoilSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGERVE
Ga0247787_102078323300022893SoilCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGETVG
Ga0247790_1003755913300022915SoilVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGER
Ga0247791_101678423300023062SoilRYLGVAGRMAAGGSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGETVG
Ga0247752_108600313300023071SoilVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0247754_105575233300023102SoilMAAGGSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGET
Ga0210087_101188013300025559Natural And Restored WetlandsMAAGGSGRPRKVRTPKGRTLGKTQAAKADGKWNREETAGRMTGKGETVG
Ga0207642_1023805313300025899Miscanthus RhizosphereMAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG
Ga0207642_1061666823300025899Miscanthus RhizosphereMAAGAFVRPRKVRTPQGRTLGKSQAAKADGKWNREETAGLRAGKGETVG
Ga0207643_1004787833300025908Miscanthus RhizosphereAYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0207705_1024319033300025909Corn RhizosphereVAAVGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE
Ga0207657_1004445973300025919Corn RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERV
Ga0207649_1086851023300025920Corn RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE
Ga0207646_1117754113300025922Corn, Switchgrass And Miscanthus RhizosphereMAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0207659_1021191013300025926Miscanthus RhizosphereGAYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0207686_1031222813300025934Miscanthus RhizosphereGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVE
Ga0207686_1098923113300025934Miscanthus RhizosphereGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0207669_1018321323300025937Miscanthus RhizosphereRKPRSFGAYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0207679_1050966633300025945Corn RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGR
Ga0207658_1046583713300025986Switchgrass RhizosphereVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0207639_1104573833300026041Corn RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETA
Ga0207708_1012684513300026075Corn, Switchgrass And Miscanthus RhizosphereRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG
Ga0207648_1098608533300026089Miscanthus RhizosphereVAAGGLDRPRKVRTPQGRTLGKPQAAKADGKWNREETAGAQAS
Ga0208912_103550323300026090Natural And Restored WetlandsMLGAGRMAAGGSGRPRKVRTPKGRTLGKTQAAKADGKWNREETAGRMTGKGETVG
Ga0207676_1024449713300026095Switchgrass RhizosphereAGRATVGLAGRMAADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG
Ga0207674_1060114013300026116Corn RhizosphereVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGAQASVRVKR
Ga0207675_10245100013300026118Switchgrass RhizosphereIETYARSRYLGVAGRMAAGGSCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGETVG
Ga0207698_1008050713300026142Corn RhizosphereRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0209077_113313013300027675Freshwater SedimentMTAAGRVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGQWLRLLAGKGETVG
Ga0268265_1110002723300028380Switchgrass RhizosphereRAALCRPRKVRTPQGRALGKSQAAKADGKWNREETAGRTTGKGETVG
Ga0268265_1192927313300028380Switchgrass RhizospherePRGSRAYTVWAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0268264_1155475823300028381Switchgrass RhizosphereADGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG
Ga0247818_1022906113300028589SoilMAAGGLGRSRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGETVG
Ga0247818_1038698113300028589SoilVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGTQVSVR
Ga0247825_1004065053300028812SoilMAAGASVRPRKVRTPQGRMLGKSQAAKADGKWHREKTAGLRAGKGETVG
Ga0310893_1045211613300031892SoilSRDCAAYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0310901_1041240733300031940SoilVAAGGFGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGTQ
Ga0310884_1083809923300031944SoilPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG
Ga0310906_1008951033300032013SoilAEYNRAAGRMAAGASVRPRKVRTPQGRMLGKSQAAKADGKWHREKTAGLRAGKGETVG
Ga0310906_1021172633300032013SoilMAAGASGRPRKVRTPQGRTLGKSQAAKADGKWNREETAGLRAGKGETVG
Ga0310890_1096908023300032075SoilGAFVRPRKVRTPQGRMLEKSQAAKADGKWHREKTAGLRAGKGETVG
Ga0310889_1009611713300032179SoilEETTLANSRDFAAYTVRAGRVAAGGSGRPRKVRTPQGRTLGKPQAAKADGKWNREETAGRTTGKGERVG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.