| Basic Information | |
|---|---|
| Family ID | F073510 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 44 residues |
| Representative Sequence | QAEMINRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNT |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.83 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 95.83 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.833 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.167 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF03795 | YCII | 84.17 |
| PF00378 | ECH_1 | 2.50 |
| PF08281 | Sigma70_r4_2 | 1.67 |
| PF01336 | tRNA_anti-codon | 0.83 |
| PF02669 | KdpC | 0.83 |
| PF00069 | Pkinase | 0.83 |
| PF02518 | HATPase_c | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 84.17 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.33 |
| COG2156 | K+-transporting ATPase, KdpC subunit | Inorganic ion transport and metabolism [P] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.83 % |
| Unclassified | root | N/A | 4.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ01BJCYX | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 2189573001|GZR05M101DNB9X | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101050840 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300002568|C688J35102_119325714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10415944 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300004092|Ga0062389_103604144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300005179|Ga0066684_10434233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 883 | Open in IMG/M |
| 3300005334|Ga0068869_101863319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 538 | Open in IMG/M |
| 3300005339|Ga0070660_100043861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3418 | Open in IMG/M |
| 3300005345|Ga0070692_10246741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1067 | Open in IMG/M |
| 3300005467|Ga0070706_101287892 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005554|Ga0066661_10742780 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005569|Ga0066705_10685970 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005591|Ga0070761_10045643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2462 | Open in IMG/M |
| 3300005591|Ga0070761_11127453 | Not Available | 500 | Open in IMG/M |
| 3300005610|Ga0070763_10460651 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005834|Ga0068851_10128261 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300005952|Ga0080026_10222370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300006031|Ga0066651_10263991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
| 3300006032|Ga0066696_10935171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300006580|Ga0074049_13138027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300006852|Ga0075433_10496259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1075 | Open in IMG/M |
| 3300006954|Ga0079219_10956317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
| 3300009011|Ga0105251_10620466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300009090|Ga0099827_10321164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1313 | Open in IMG/M |
| 3300009148|Ga0105243_12684624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
| 3300009520|Ga0116214_1391394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300009521|Ga0116222_1306164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 687 | Open in IMG/M |
| 3300009522|Ga0116218_1263153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
| 3300009523|Ga0116221_1118440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1163 | Open in IMG/M |
| 3300009698|Ga0116216_10418860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
| 3300009698|Ga0116216_10875912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300009792|Ga0126374_10605393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 809 | Open in IMG/M |
| 3300010159|Ga0099796_10415978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300010321|Ga0134067_10282116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300010325|Ga0134064_10102977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 942 | Open in IMG/M |
| 3300010396|Ga0134126_13041895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300010876|Ga0126361_10678406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1034 | Open in IMG/M |
| 3300011066|Ga0138524_1023876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
| 3300011120|Ga0150983_15034072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300012198|Ga0137364_11383082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300012207|Ga0137381_10385335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1222 | Open in IMG/M |
| 3300012349|Ga0137387_11289886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300012351|Ga0137386_11236748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300012903|Ga0157289_10198293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300014489|Ga0182018_10672219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300014495|Ga0182015_10771806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
| 3300015372|Ga0132256_100188172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2103 | Open in IMG/M |
| 3300015372|Ga0132256_102586421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300015374|Ga0132255_103894098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
| 3300016270|Ga0182036_10408472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1059 | Open in IMG/M |
| 3300016270|Ga0182036_11882486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300016294|Ga0182041_10758901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 864 | Open in IMG/M |
| 3300016341|Ga0182035_12163872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300016371|Ga0182034_10491683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1022 | Open in IMG/M |
| 3300017822|Ga0187802_10192871 | Not Available | 783 | Open in IMG/M |
| 3300017823|Ga0187818_10170864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300017823|Ga0187818_10387801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300017924|Ga0187820_1138905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 724 | Open in IMG/M |
| 3300017928|Ga0187806_1043227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1358 | Open in IMG/M |
| 3300017932|Ga0187814_10295368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300017942|Ga0187808_10085936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1359 | Open in IMG/M |
| 3300018006|Ga0187804_10411062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300018043|Ga0187887_10183982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1246 | Open in IMG/M |
| 3300018047|Ga0187859_10126153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 1351 | Open in IMG/M |
| 3300018062|Ga0187784_10882251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300018431|Ga0066655_10138759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1426 | Open in IMG/M |
| 3300021181|Ga0210388_10322517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1358 | Open in IMG/M |
| 3300021404|Ga0210389_10419116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
| 3300021420|Ga0210394_10552769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1012 | Open in IMG/M |
| 3300021433|Ga0210391_10502930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
| 3300021860|Ga0213851_1535680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300024123|Ga0228600_1010694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300024186|Ga0247688_1051468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300024347|Ga0179591_1229622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2216 | Open in IMG/M |
| 3300025893|Ga0207682_10507309 | Not Available | 571 | Open in IMG/M |
| 3300025898|Ga0207692_10553500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300025905|Ga0207685_10303741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 791 | Open in IMG/M |
| 3300026343|Ga0209159_1197556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300027050|Ga0209325_1007035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1214 | Open in IMG/M |
| 3300027334|Ga0209529_1018135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1188 | Open in IMG/M |
| 3300027590|Ga0209116_1058213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
| 3300027842|Ga0209580_10099677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1404 | Open in IMG/M |
| 3300027879|Ga0209169_10201637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1040 | Open in IMG/M |
| 3300028799|Ga0307284_10279954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
| 3300028906|Ga0308309_11689184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300030520|Ga0311372_12284795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300030763|Ga0265763_1054017 | Not Available | 512 | Open in IMG/M |
| 3300031094|Ga0308199_1103482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300031668|Ga0318542_10463772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300031668|Ga0318542_10586285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300031681|Ga0318572_10197935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
| 3300031708|Ga0310686_110369652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2551 | Open in IMG/M |
| 3300031713|Ga0318496_10841407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300031718|Ga0307474_11267152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300031764|Ga0318535_10506880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300031765|Ga0318554_10657078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300031765|Ga0318554_10659211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300031778|Ga0318498_10089880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1388 | Open in IMG/M |
| 3300031782|Ga0318552_10305102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 810 | Open in IMG/M |
| 3300031793|Ga0318548_10054230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1840 | Open in IMG/M |
| 3300031835|Ga0318517_10474641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300031910|Ga0306923_11029281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 892 | Open in IMG/M |
| 3300031912|Ga0306921_12082319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300031942|Ga0310916_11483198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300031946|Ga0310910_10822956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 731 | Open in IMG/M |
| 3300031947|Ga0310909_10222002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1575 | Open in IMG/M |
| 3300032054|Ga0318570_10410807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300032059|Ga0318533_10452358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 940 | Open in IMG/M |
| 3300032066|Ga0318514_10143818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
| 3300032067|Ga0318524_10756845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300032068|Ga0318553_10077843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1668 | Open in IMG/M |
| 3300032074|Ga0308173_10615837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
| 3300032089|Ga0318525_10578198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300032090|Ga0318518_10484683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300032261|Ga0306920_103552997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300032770|Ga0335085_12125051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300032783|Ga0335079_11632882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300033134|Ga0335073_11472091 | Not Available | 659 | Open in IMG/M |
| 3300033158|Ga0335077_11993315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.67% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.67% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.67% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011066 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Host-Associated | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_01031250 | 2170459024 | Grass Soil | MINRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNT |
| FD2_02204110 | 2189573001 | Grass Soil | RRVLLERGGDDPNRACERSVPEAGDRADIQRRYEVVLTVESRLTATGRNA |
| JGIcombinedJ26739_1010508401 | 3300002245 | Forest Soil | SAQRRVLLEQADMIQRASERTVPEAADRADVRRAYEEVLAAADRRTTVTPVRPA* |
| C688J35102_1193257142 | 3300002568 | Soil | LFEQAAMINRACERSVPEAADRADIQRRYEAVLTVEARLASGEEGG* |
| JGIcombinedJ51221_104159441 | 3300003505 | Forest Soil | QAAMIDRASERSVPEAADRADIRRRYEAILTMESRLTASEQNV* |
| Ga0062389_1036041441 | 3300004092 | Bog Forest Soil | RRVLLEQAAMINRACERSVPEASDRADIQRRYEAILTLESRMTESVRDG* |
| Ga0066684_104342333 | 3300005179 | Soil | SEGQRRVLLEQAEMINRACERSVPEAGDRADIQRRYEVVLTVESRLTATGRNT* |
| Ga0068869_1018633192 | 3300005334 | Miscanthus Rhizosphere | QRRVLLEQAEMINRACERSVPEAGDRADIQRRYEAVLTVESRLTATGRNV* |
| Ga0070660_1000438616 | 3300005339 | Corn Rhizosphere | EGQRRVLLEQAEMINRACERSVPEAADRADIQRRYEGVLTVESRMTASGRNT* |
| Ga0070692_102467414 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | QRRVLLEQAEMINRACERSVPEAADRADIQRRYEGVLTVESRMTASGRNT* |
| Ga0070706_1012878922 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LLEQAEMINRACERSVPEAGDRADIQRRYEAVLTLESRLTASGRNA* |
| Ga0066661_107427801 | 3300005554 | Soil | NRAGERSVPEADDRADIQRRYEAILTVESRMTATGRNA* |
| Ga0066705_106859701 | 3300005569 | Soil | RVLLEQAEMINRACERSVPEAGDRADIQRRYEAILTVESRLTATGRNA* |
| Ga0070761_100456431 | 3300005591 | Soil | LEQAAMIDRASERSVPEAADRADIRRRYEAILTMETRLTASGRSG* |
| Ga0070761_111274532 | 3300005591 | Soil | CERSVPEAADRADVRRRYEAILTLESRLTSNEQNA* |
| Ga0070763_104606511 | 3300005610 | Soil | VLLEQAEMINRACERSVPEAGDRADIQRRYEAILTVESRLTATGRNA* |
| Ga0068851_101282611 | 3300005834 | Corn Rhizosphere | EMINRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNT* |
| Ga0080026_102223701 | 3300005952 | Permafrost Soil | ACERSVPEAADRADVRRRYETILTLESQLTASGPGA* |
| Ga0066651_102639911 | 3300006031 | Soil | MINRACERSVPEASDRADIQRRYEAVLTVEARLTAGGGASGT* |
| Ga0066696_109351711 | 3300006032 | Soil | QRRVLLEQAEMINRACERSVPEAADRADIQRRYEVVLTVESRLTASGRNT* |
| Ga0074049_131380271 | 3300006580 | Soil | EMINRACERSVPEAADRADIQRRYEAVLTVESRLTATGRNA* |
| Ga0075433_104962593 | 3300006852 | Populus Rhizosphere | CERSVPEAADRADIQRRYEAVLTVESRLTASGRNT* |
| Ga0079219_109563171 | 3300006954 | Agricultural Soil | GQRRVLLEQAAMINRACERSVPEASDRADIQRRYEVVLTVESRLTASGRNP* |
| Ga0105251_106204662 | 3300009011 | Switchgrass Rhizosphere | RVLLEQAAMISRACERSVPEAADRADIQRRYEAVLTVEARLAASGGEQGT* |
| Ga0099827_103211643 | 3300009090 | Vadose Zone Soil | TAAMIDRASERSVPEAADRADIRRRYEAILTMETRLTASGRNV* |
| Ga0105243_126846241 | 3300009148 | Miscanthus Rhizosphere | RVLLEQAQMINRACERSVPEASDRADIQRRYEAVLTVESRLTATGRNA* |
| Ga0116214_13913941 | 3300009520 | Peatlands Soil | RVLLEQAAMINRACERSVPEASDRADIERRYEAILTMESRMTESARDA* |
| Ga0116222_13061642 | 3300009521 | Peatlands Soil | INRACERSVPEASDRADIQRRYEAILTMESRMTESLRDG* |
| Ga0116218_12631531 | 3300009522 | Peatlands Soil | AAMINRACERSVPEASDRADIQRRYEAILTMESRMTESLRDG* |
| Ga0116221_11184401 | 3300009523 | Peatlands Soil | LLEQAAMINRACERSVPEASDRADIQRRYEAILTMESRMTESVREA* |
| Ga0116216_104188601 | 3300009698 | Peatlands Soil | QAAMINRACERSVPEASDRADIQRRYEAILTLESRMTESVRDV* |
| Ga0116216_108759122 | 3300009698 | Peatlands Soil | AMIDRASERSVPEAADRADIRRRYEAILTMESKLTASGERT* |
| Ga0126374_106053933 | 3300009792 | Tropical Forest Soil | RACERSVPEAADRADIQRRYETVLTVESRLTASGRNA* |
| Ga0099796_104159781 | 3300010159 | Vadose Zone Soil | MINRACERSVPEAADRADIQRRYEAVLTVEARLTSGEGSG* |
| Ga0134067_102821162 | 3300010321 | Grasslands Soil | CERSVPEAGDRADIQRRYEVVLTVESRLTATGRNA* |
| Ga0134064_101029771 | 3300010325 | Grasslands Soil | ERSVPEAGDRADIQRRYEVVLTVESRLTATGRNT* |
| Ga0134126_130418951 | 3300010396 | Terrestrial Soil | EMINRACERSVPEAADRADIQRRYEAILTVESRLTAAGRNS* |
| Ga0126361_106784061 | 3300010876 | Boreal Forest Soil | IERACERSVPEAADRADIQRRYEAVLTVESQLAGTKQNT* |
| Ga0138524_10238761 | 3300011066 | Peatlands Soil | NRACERSVPEASDRADIQRRYEAILTIESRMTESLRDG* |
| Ga0150983_150340722 | 3300011120 | Forest Soil | LLEQAAMIDRASERSVPEAADRADIRRRYEAILTMESNMTVSMRDA* |
| Ga0137364_113830821 | 3300012198 | Vadose Zone Soil | RRVLLEQAEMINRACERSVPEAGDRADIQRRYEAILTVESRMTATGRNA* |
| Ga0137381_103853353 | 3300012207 | Vadose Zone Soil | AMINRACERSVPEAGDRADIQRRYEVVLTMESRLTASGRNA* |
| Ga0137387_112898861 | 3300012349 | Vadose Zone Soil | VLLEQAEMINRACERSVPEAGDRADIQRRYEAVLTLESRLTANGRNA* |
| Ga0137386_112367482 | 3300012351 | Vadose Zone Soil | RVLLEQAAMISRACERSVPEAGDRADVQRRYEAILTVESRLTASGRNA* |
| Ga0157289_101982932 | 3300012903 | Soil | ACERSVPEAADRADIQRRYEAVLTVESGLTASGRNT* |
| Ga0182018_106722192 | 3300014489 | Palsa | AAMIQRAGERSVPEGADREDIRRRYEAVLTADARLAHLADA* |
| Ga0182015_107718063 | 3300014495 | Palsa | ERASERSVPEAADRTDIRRRYEAVLTIEAGLASHERTGSAS* |
| Ga0132256_1001881721 | 3300015372 | Arabidopsis Rhizosphere | NRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNT* |
| Ga0132256_1025864212 | 3300015372 | Arabidopsis Rhizosphere | VVLEQAAMISRACDRSVPEGADRADIQRHYEAVLTVEARLTASPGEQGT* |
| Ga0132255_1038940982 | 3300015374 | Arabidopsis Rhizosphere | AAMINRACERSVPEASDRADIQRRYEVVLTVESRLTASGRNP* |
| Ga0182036_104084721 | 3300016270 | Soil | EQAQMINRACERSVPEAGDRADIQRRYEGVLTVEARLTASGRNA |
| Ga0182036_118824861 | 3300016270 | Soil | QAQMINRACERSVPEASDRADIQRRYEAVLTVESRLTASGRSS |
| Ga0182041_107589012 | 3300016294 | Soil | NRACERSVPEASDRADIQRRYEAILTVESKLTASGQNV |
| Ga0182035_121638722 | 3300016341 | Soil | GQRRVLLEQAQMILRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNS |
| Ga0182034_104916831 | 3300016371 | Soil | EQAAMINRACERSVPEASDRADVQRRYEAVLTVESRLTASGRNS |
| Ga0187802_101928713 | 3300017822 | Freshwater Sediment | LLEQAAMIDRASERSVPETNDRADVRRRYEAVLTAEARLAGAQ |
| Ga0187818_101708641 | 3300017823 | Freshwater Sediment | QRRVLLEQAAMINRACERSVPEASDRADIQRRYEAILTIESRMTESLRDG |
| Ga0187818_103878011 | 3300017823 | Freshwater Sediment | AMIDRASERSVPEAADRADIRRRYEAILTMESKLTASGERA |
| Ga0187820_11389053 | 3300017924 | Freshwater Sediment | EQAAMIDRASERSVPEAADRADIRRRYEAILTMESKLTASGQNA |
| Ga0187806_10432274 | 3300017928 | Freshwater Sediment | LLEQAAMIDRASERSVPEAADRADIRRRYEAMLTMESRLTASGQNA |
| Ga0187814_102953681 | 3300017932 | Freshwater Sediment | RASERSVPEAADRTDIRRRYEAILTMESGLTARGQNA |
| Ga0187808_100859361 | 3300017942 | Freshwater Sediment | ASERSVPEAADRADIRRRYEAILTMESRLTASGQNA |
| Ga0187804_104110622 | 3300018006 | Freshwater Sediment | EQAAMIDRASERSVPEAADRADIRRRYEAILTMESRLTASGRNA |
| Ga0187887_101839821 | 3300018043 | Peatland | ACERSVPEAADRADVRRRYEAILTLESKLTASGQNA |
| Ga0187859_101261531 | 3300018047 | Peatland | AEMIDRACERSVPEAADRADVRRRYEAILTLESKLTASGQNA |
| Ga0187784_108822512 | 3300018062 | Tropical Peatland | LVEQEARIDRAGERSVPEADDRADIRRRYEAILTMESRLTASGRNA |
| Ga0066655_101387591 | 3300018431 | Grasslands Soil | RRVLLEQAQMINRACERSVPEAGDRADIQRRYEAVLTVESRLTASGRNA |
| Ga0210388_103225173 | 3300021181 | Soil | ASERSVPEAADRADIQRRYEAILTVESRLTASGQNA |
| Ga0210389_104191161 | 3300021404 | Soil | AAMINRACERSVPEASDRADIQRRYEAILTMESRMTESMRDA |
| Ga0210394_105527693 | 3300021420 | Soil | GQRRVLLEQAEMINRACERSVPEAGDRADIQRSYEAILTVESRLTATGRNA |
| Ga0210391_105029303 | 3300021433 | Soil | MINRACERSVPEASDRADIQRRYEAILTMESRMTESMRDA |
| Ga0213851_15356802 | 3300021860 | Watersheds | ACERSVPEAADRADIRRRYEAILTMESRLTASGRSG |
| Ga0228600_10106942 | 3300024123 | Roots | GQRRVLLEQAAMIDRACERSVPEADDRADVRRSYEAFLAMEPRLPA |
| Ga0247688_10514682 | 3300024186 | Soil | AEMINRACERSVPEAADRADIQRRYEGVLTVESRMTASGRNT |
| Ga0179591_12296224 | 3300024347 | Vadose Zone Soil | EQAEMINRACERSVPEAGDRADIQRRYEAVLTLESRLTATGRNA |
| Ga0207682_105073092 | 3300025893 | Miscanthus Rhizosphere | RVLLEQAEMINRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNT |
| Ga0207692_105535001 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RRVLLEQAAMINRACERSVPEAADRADIQRRYEAVLTVEARLTADGGASGT |
| Ga0207685_103037413 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLEQAEMINRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNT |
| Ga0209159_11975561 | 3300026343 | Soil | RRVLLEQAEMINRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNT |
| Ga0209325_10070353 | 3300027050 | Forest Soil | QAEMINRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNT |
| Ga0209529_10181352 | 3300027334 | Forest Soil | ISERPAEAADRADIRRRYEAILTMESRLTASEQNV |
| Ga0209116_10582133 | 3300027590 | Forest Soil | AAMIDRASERSVPEAADRADIRRRYEAVLTVESQLAAAPERATKN |
| Ga0209580_100996771 | 3300027842 | Surface Soil | AAMIDRASERSIPEAADRADIRRRYEAILTMESRLTARGRSG |
| Ga0209169_102016373 | 3300027879 | Soil | QAAMIDRASERSVPEAVDRADIRRAYEAILTMESRLAASEQKA |
| Ga0307284_102799541 | 3300028799 | Soil | SQRRVLLEQAEMINRACERSVPEAADRADIQRRYETVLTVESRLTASGRNA |
| Ga0308309_116891841 | 3300028906 | Soil | DRASERSVPEAADRADIRRRYEAILTMESRMSESVTDR |
| Ga0311372_122847951 | 3300030520 | Palsa | AAMIDRASERSVPEAADRADIRRRYEAILTMESRLTASEQNV |
| Ga0265763_10540172 | 3300030763 | Soil | INRACERSVPEASDRADIQRRYEAILTMESRMPQSVRDA |
| Ga0308199_11034822 | 3300031094 | Soil | VLLEQAEMINRACERSVPEAADRADIQRRYETVLTVESRLTASGRNA |
| Ga0318542_104637721 | 3300031668 | Soil | RACERSVPEAADRADIQRRYEAVLTVESRLTASGRNS |
| Ga0318542_105862851 | 3300031668 | Soil | CERSVPEAADRADIQRRYEAVLTVESRLTASGLNP |
| Ga0318572_101979353 | 3300031681 | Soil | MIDRASERSVPEAADRADIRRRYEAILTMESRLTATGKNA |
| Ga0310686_1103696521 | 3300031708 | Soil | LLEQAAMINRACERSVPEASDRADIQRRYEAILTMESRMTESVRDA |
| Ga0318496_108414071 | 3300031713 | Soil | MILRACERSVPEAADRADIQRRYEAVLTVESRLTASGLNP |
| Ga0307474_112671522 | 3300031718 | Hardwood Forest Soil | CERSVPEAADRADIQRRYEVVLTVESRLTASGRNT |
| Ga0318535_105068802 | 3300031764 | Soil | SERSVPEAADRTDIRRRYEAILTMESRLTASGKNA |
| Ga0318554_106570782 | 3300031765 | Soil | RASERSVPEAADRADIRRRYEAILTMESRLTASGQNA |
| Ga0318554_106592112 | 3300031765 | Soil | TQGQRRVLLEQAAMINRACERSIPEASDRADIQRRYEAVLTVESQLTASGQNA |
| Ga0318498_100898803 | 3300031778 | Soil | LEQAAMIDRASERSVPEAADRADIRRRYEAILTMESRLTATGKNA |
| Ga0318552_103051021 | 3300031782 | Soil | NRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNS |
| Ga0318548_100542301 | 3300031793 | Soil | LLEQAQMINRACERSVPEASDRADIQRRYEAVLTVESRLTASGRSS |
| Ga0318517_104746412 | 3300031835 | Soil | QAAMIDRASERSVPEAADRADIRRRYEAILTMESGLTARGQNA |
| Ga0306923_110292811 | 3300031910 | Soil | ETTSEGQRRALLEQAQMINRACERSVPEASDRADIQRRYEAVLTVESRLTASGRSS |
| Ga0306921_120823191 | 3300031912 | Soil | LEQAAMIDRASERSVPEAADRADIRRRYEAILTMESRLTASGQNA |
| Ga0310916_114831981 | 3300031942 | Soil | PEQAQMINRACERSVPEAGDRADIQRRYEGVLTVEARLTASGRNA |
| Ga0310910_108229561 | 3300031946 | Soil | EQAQMINRACERSVPEAADRADIQRRYEAVLTVESRLTASGLNP |
| Ga0310909_102220023 | 3300031947 | Soil | IDRASERSVPEAADRADIRRRYEAILTMESRLTASGQNA |
| Ga0318570_104108071 | 3300032054 | Soil | RVLLEQAQMILRACERSVPEAADRADIQRRYEAVLTVESRLTASGLNP |
| Ga0318533_104523581 | 3300032059 | Soil | SEGQRRALLEQAQMINRACERSVPEASDRADIQRRYEAVLTVESRLTASGRSS |
| Ga0318514_101438183 | 3300032066 | Soil | QRRVLLEQAQMINRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNS |
| Ga0318524_107568452 | 3300032067 | Soil | EQAAMIDRASERSVPEAADRADIRRRYEAILTMESRLAASGQNA |
| Ga0318553_100778431 | 3300032068 | Soil | RVLLEQAAMINRACERSVPEASDRADIQRRYEAVLTVESKLTASGRNA |
| Ga0308173_106158373 | 3300032074 | Soil | LEQAAMINRACERSVPEAADRADIQRRYEAVLTVEARLTADGGTSST |
| Ga0318525_105781981 | 3300032089 | Soil | MINRACERSVPEAADRADIQRRYEAVLTVESRLTASGRNS |
| Ga0318518_104846831 | 3300032090 | Soil | LRACERSVPEAADRADVQRRYEAVLTVESRLTASGRNP |
| Ga0306920_1035529971 | 3300032261 | Soil | RVLLEQAAMINRACERSVPEASDRADIQRRYEAILTVESKLTASGRNA |
| Ga0335085_121250512 | 3300032770 | Soil | SQGQRRVLLEQAAMINRACERTVPEAGDRADIQRRYEAVLTEEAKLTAAGQNP |
| Ga0335079_116328821 | 3300032783 | Soil | RVLLEQAAMINRACERSVPEASDRADIQRRYEAILTVESKLTASGQNA |
| Ga0335073_114720912 | 3300033134 | Soil | LEQAAMIDRASERSVPEADDRADVRRSYEAVLTVEARRAAAEQAT |
| Ga0335077_119933152 | 3300033158 | Soil | ACERSVPEAADRADIQRRYEAVLTVESRLTASGRNP |
| ⦗Top⦘ |