| Basic Information | |
|---|---|
| Family ID | F073451 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LDFLAEYQSFRTAFQGVSNEDQTARIVDLGVVEERVTEMGEEAFDE |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.83 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 89.17 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (49.167 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (24.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.57% β-sheet: 2.70% Coil/Unstructured: 79.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF06056 | Terminase_5 | 25.00 |
| PF14090 | HTH_39 | 5.00 |
| PF01541 | GIY-YIG | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.83 % |
| Unclassified | root | N/A | 49.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000439|TBL_comb48_EPIDRAFT_1037074 | All Organisms → Viruses → Predicted Viral | 1937 | Open in IMG/M |
| 3300001849|RCM26_1308388 | Not Available | 605 | Open in IMG/M |
| 3300001850|RCM37_1380511 | Not Available | 625 | Open in IMG/M |
| 3300003497|JGI25925J51416_10162458 | Not Available | 504 | Open in IMG/M |
| 3300003813|Ga0007879_1001834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3622 | Open in IMG/M |
| 3300004112|Ga0065166_10275627 | Not Available | 681 | Open in IMG/M |
| 3300004684|Ga0065168_1026383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
| 3300004692|Ga0065171_1028093 | Not Available | 905 | Open in IMG/M |
| 3300004694|Ga0065170_1031335 | Not Available | 712 | Open in IMG/M |
| 3300004770|Ga0007804_1059015 | Not Available | 1000 | Open in IMG/M |
| 3300004772|Ga0007791_10146936 | Not Available | 691 | Open in IMG/M |
| 3300004777|Ga0007827_10029211 | Not Available | 1326 | Open in IMG/M |
| 3300004807|Ga0007809_10048051 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
| 3300004807|Ga0007809_10065469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
| 3300005528|Ga0068872_10611610 | Not Available | 577 | Open in IMG/M |
| 3300005662|Ga0078894_10120670 | All Organisms → Viruses → Predicted Viral | 2332 | Open in IMG/M |
| 3300005662|Ga0078894_10443699 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
| 3300005662|Ga0078894_10609374 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005914|Ga0075117_1052751 | Not Available | 1296 | Open in IMG/M |
| 3300006100|Ga0007806_1021831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1339 | Open in IMG/M |
| 3300006110|Ga0007871_1072693 | Not Available | 647 | Open in IMG/M |
| 3300006112|Ga0007857_1012841 | Not Available | 1874 | Open in IMG/M |
| 3300006113|Ga0007858_1103674 | Not Available | 583 | Open in IMG/M |
| 3300006121|Ga0007824_1014869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1607 | Open in IMG/M |
| 3300006129|Ga0007834_1021805 | All Organisms → Viruses → Predicted Viral | 1724 | Open in IMG/M |
| 3300006641|Ga0075471_10464816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300008107|Ga0114340_1256345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300008108|Ga0114341_10035907 | All Organisms → Viruses → Predicted Viral | 3342 | Open in IMG/M |
| 3300008116|Ga0114350_1197174 | Not Available | 500 | Open in IMG/M |
| 3300008261|Ga0114336_1093029 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| 3300009151|Ga0114962_10112813 | All Organisms → Viruses → Predicted Viral | 1676 | Open in IMG/M |
| 3300009151|Ga0114962_10112832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1676 | Open in IMG/M |
| 3300009151|Ga0114962_10739561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300009164|Ga0114975_10566152 | Not Available | 608 | Open in IMG/M |
| 3300009182|Ga0114959_10013969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5365 | Open in IMG/M |
| 3300009183|Ga0114974_10364955 | Not Available | 834 | Open in IMG/M |
| 3300009183|Ga0114974_10800421 | Not Available | 506 | Open in IMG/M |
| 3300009184|Ga0114976_10077628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1919 | Open in IMG/M |
| 3300009184|Ga0114976_10220383 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300010157|Ga0114964_10284905 | Not Available | 784 | Open in IMG/M |
| 3300010158|Ga0114960_10000221 | Not Available | 46688 | Open in IMG/M |
| 3300010158|Ga0114960_10147658 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
| 3300010158|Ga0114960_10346627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300010388|Ga0136551_1009388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2061 | Open in IMG/M |
| 3300010885|Ga0133913_10378661 | All Organisms → Viruses → Predicted Viral | 3742 | Open in IMG/M |
| 3300010885|Ga0133913_11359248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1810 | Open in IMG/M |
| 3300012663|Ga0157203_1016246 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300012663|Ga0157203_1057140 | Not Available | 525 | Open in IMG/M |
| 3300012665|Ga0157210_1008805 | All Organisms → Viruses → Predicted Viral | 1842 | Open in IMG/M |
| 3300012697|Ga0157578_1063154 | Not Available | 552 | Open in IMG/M |
| 3300012699|Ga0157593_1092931 | Not Available | 534 | Open in IMG/M |
| 3300013285|Ga0136642_1063767 | Not Available | 988 | Open in IMG/M |
| 3300013285|Ga0136642_1077565 | Not Available | 876 | Open in IMG/M |
| 3300013285|Ga0136642_1175002 | Not Available | 527 | Open in IMG/M |
| 3300013295|Ga0170791_12660026 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
| 3300017761|Ga0181356_1103517 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 924 | Open in IMG/M |
| 3300020160|Ga0211733_11092363 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300020717|Ga0214248_1012633 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300020718|Ga0214178_1013963 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300020732|Ga0214201_1006380 | All Organisms → Viruses → Predicted Viral | 2789 | Open in IMG/M |
| 3300020735|Ga0214219_1024793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300021131|Ga0214206_1022275 | Not Available | 770 | Open in IMG/M |
| 3300021138|Ga0214164_1057460 | Not Available | 825 | Open in IMG/M |
| 3300021142|Ga0214192_1069536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
| 3300021519|Ga0194048_10159047 | Not Available | 847 | Open in IMG/M |
| 3300024289|Ga0255147_1089344 | Not Available | 572 | Open in IMG/M |
| 3300024562|Ga0256336_1119591 | Not Available | 562 | Open in IMG/M |
| 3300024565|Ga0255273_1036805 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300025328|Ga0208384_108489 | Not Available | 539 | Open in IMG/M |
| 3300025336|Ga0208619_115578 | Not Available | 561 | Open in IMG/M |
| 3300025369|Ga0208382_1027808 | Not Available | 720 | Open in IMG/M |
| 3300025391|Ga0208740_1034473 | Not Available | 727 | Open in IMG/M |
| 3300025396|Ga0208874_1003562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3546 | Open in IMG/M |
| 3300025396|Ga0208874_1020849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
| 3300025396|Ga0208874_1035740 | Not Available | 735 | Open in IMG/M |
| 3300025410|Ga0208875_1061646 | Not Available | 579 | Open in IMG/M |
| 3300025413|Ga0208614_1045459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300025421|Ga0207958_1027243 | Not Available | 905 | Open in IMG/M |
| 3300025423|Ga0208746_1038505 | Not Available | 787 | Open in IMG/M |
| 3300025430|Ga0208622_1038925 | Not Available | 891 | Open in IMG/M |
| 3300025437|Ga0208742_1025044 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
| 3300025449|Ga0208106_1079798 | Not Available | 546 | Open in IMG/M |
| 3300025603|Ga0208414_1006029 | Not Available | 5927 | Open in IMG/M |
| 3300027125|Ga0255106_1026431 | Not Available | 826 | Open in IMG/M |
| 3300027581|Ga0209651_1057334 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300027586|Ga0208966_1046409 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300027621|Ga0208951_1125631 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 683 | Open in IMG/M |
| 3300027656|Ga0209357_1084518 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 924 | Open in IMG/M |
| 3300027659|Ga0208975_1006255 | All Organisms → Viruses → Predicted Viral | 4327 | Open in IMG/M |
| 3300027747|Ga0209189_1061694 | All Organisms → Viruses → Predicted Viral | 1777 | Open in IMG/M |
| 3300027749|Ga0209084_1136171 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300027759|Ga0209296_1208891 | Not Available | 830 | Open in IMG/M |
| 3300027764|Ga0209134_10043599 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
| 3300027772|Ga0209768_10437763 | Not Available | 510 | Open in IMG/M |
| 3300027782|Ga0209500_10273359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300027798|Ga0209353_10332786 | Not Available | 637 | Open in IMG/M |
| 3300027816|Ga0209990_10172906 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300027892|Ga0209550_10539478 | Not Available | 694 | Open in IMG/M |
| 3300027963|Ga0209400_1200921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300027969|Ga0209191_1165988 | Not Available | 891 | Open in IMG/M |
| 3300027973|Ga0209298_10174784 | Not Available | 890 | Open in IMG/M |
| 3300028091|Ga0255184_1090110 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 574 | Open in IMG/M |
| 3300028275|Ga0255174_1085100 | Not Available | 511 | Open in IMG/M |
| 3300031758|Ga0315907_10134855 | All Organisms → Viruses → Predicted Viral | 2099 | Open in IMG/M |
| 3300031759|Ga0316219_1146128 | Not Available | 877 | Open in IMG/M |
| 3300031759|Ga0316219_1332938 | Not Available | 514 | Open in IMG/M |
| 3300031884|Ga0316220_1179551 | Not Available | 745 | Open in IMG/M |
| 3300031951|Ga0315904_10194795 | All Organisms → Viruses → Predicted Viral | 1997 | Open in IMG/M |
| 3300031963|Ga0315901_10375207 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300032093|Ga0315902_10349486 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
| 3300032116|Ga0315903_10016272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8450 | Open in IMG/M |
| 3300032116|Ga0315903_10458205 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300032116|Ga0315903_10631802 | Not Available | 815 | Open in IMG/M |
| 3300032561|Ga0316222_1212661 | Not Available | 676 | Open in IMG/M |
| 3300032561|Ga0316222_1238600 | Not Available | 623 | Open in IMG/M |
| 3300032562|Ga0316226_1179627 | Not Available | 899 | Open in IMG/M |
| 3300032722|Ga0316231_1311955 | Not Available | 617 | Open in IMG/M |
| 3300034110|Ga0335055_0077786 | All Organisms → Viruses → Predicted Viral | 1523 | Open in IMG/M |
| 3300034119|Ga0335054_0735592 | Not Available | 526 | Open in IMG/M |
| 3300034279|Ga0335052_0104617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1705 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 24.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 18.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 7.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.00% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.17% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.33% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.50% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.67% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.83% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.83% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.83% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.83% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006110 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006113 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 | Environmental | Open in IMG/M |
| 3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
| 3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012697 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES082 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012699 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES110 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020717 | Freshwater microbial communities from Trout Bog Lake, WI - 15JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
| 3300020732 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025328 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025336 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025437 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025449 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025603 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE (SPAdes) | Environmental | Open in IMG/M |
| 3300027125 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028091 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300028275 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TBL_comb48_EPIDRAFT_10370741 | 3300000439 | Freshwater | VLDFLAEYQSFRTAFQGVSNEEQTARIVDLGVIDETIKELGEEAYDD* |
| RCM26_13083883 | 3300001849 | Marine Plankton | PEDWGKEDVLDFLAENQSFRTAFQGVSNEYQSARIIDLGVVEERITELGEVAYDD* |
| RCM37_13805111 | 3300001850 | Marine Plankton | FLAENQSFRTAFQGVSNEDQTARIVDVMVVEEEVTELGEEEFDA* |
| JGI25925J51416_101624581 | 3300003497 | Freshwater Lake | DFLGEYQSFRTAFQGVSNEDQTARIVDLGVVIETVEQLGEECFDE* |
| Ga0007879_100183413 | 3300003813 | Freshwater | AEYQSFRTAFQGVSNEEQTARIVDLGVIEERVTEMGEEAFDE* |
| Ga0065166_102756271 | 3300004112 | Freshwater Lake | DDWEREDVLDFLGEYQSFRTAFQGVSNKDNTASIVDLCVVEEKVTEMGEEAYDE* |
| Ga0065168_10263831 | 3300004684 | Freshwater | LDIFGFLGEYQSFRTAFQGVSNEDQTARIVDLGVVEERVTEMGDEAYDE* |
| Ga0065171_10280934 | 3300004692 | Freshwater | REEVYDFLAEFQSFRTAFQGVSNEDQTARIVDLGVLTEEVTEMGEEAYDD* |
| Ga0065170_10313354 | 3300004694 | Freshwater | AEYQSFRTAFQGVSNEDQTARIVDLGVVEERVTEMGEETFDE* |
| Ga0007804_10590153 | 3300004770 | Freshwater | DFLAEYQSFRTAFQGVSNEEQTARIIDLGVVTETVKEMGEEAYDE* |
| Ga0007791_101469361 | 3300004772 | Freshwater | EDVLDFLGEFQSFRTAFQGVSNEDQTARIVDLGVVIETVEQLGEECFDE* |
| Ga0007827_100292113 | 3300004777 | Freshwater | LAEYQSFRRAFQGVSNELQTARIIDLGVVTETVKEMGEEAYDE* |
| Ga0007809_100480516 | 3300004807 | Freshwater | WEREDVLDFLAEYQSFRTAFQGVSNEDQTARIVDLGVIEETIKELGEEAYDD* |
| Ga0007809_100654691 | 3300004807 | Freshwater | DEWAREDVLDFLAEYQSFRTAFQGVSNTDQTARIIDLGVQDETIKEMGEEAYDD* |
| Ga0068872_106116101 | 3300005528 | Freshwater Lake | LDFLAEYQSFRTAFQGVDSLDGKFRILDVVVAEEEVTELGEEAYDD* |
| Ga0078894_101206709 | 3300005662 | Freshwater Lake | DFLAENQSFRTAFQGVSNEDQTARIIDIGVVEETVTEMGEVAYDD* |
| Ga0078894_104436995 | 3300005662 | Freshwater Lake | PESWDRLDVFDFLAENQSFRTAFQGVSNEDQTARIVDLGVVTETVTEMGEEAFDE* |
| Ga0078894_106093743 | 3300005662 | Freshwater Lake | GEYQSFRTAFQGVSNEDQTARIVDLGVVIETVEQLGEECFDE* |
| Ga0075117_10527511 | 3300005914 | Saline Lake | SFRTAFQGVSNEDQTARITDVSVVEENVTELGEVAYDD* |
| Ga0007806_10218311 | 3300006100 | Freshwater | PDTWDRLDVFDFLAEYQSFRTAFQGVSNEDQTARIVDLNVVEERVTEMGEEAYDE* |
| Ga0007871_10726931 | 3300006110 | Freshwater | PDNWAREDVLDFLAEYQSFRTAFQGVSNEEQTARIVDLGVIEERVTEMGEEAFDE* |
| Ga0007857_10128417 | 3300006112 | Freshwater | RRAFQGVSNELQTARIIDLGVVTETVKERGEEASDE* |
| Ga0007858_11036741 | 3300006113 | Freshwater | VPESWEREDVFDFLGEYQSFRGAFQGVSNTDETARILDLVVVEETVTELGEEEFDE* |
| Ga0007824_10148696 | 3300006121 | Freshwater | NWAREDVLDFLAEYQSFRTAFQGVSNEEQTARIVDLGVIEERVTEMGEEAFDE* |
| Ga0007834_10218051 | 3300006129 | Freshwater | LDFLAEYQSFRGAFQGVSNEEQTARIVDLGVVEEKVTEMGEEAFDE* |
| Ga0075471_104648161 | 3300006641 | Aqueous | FLAEFQSFRSAFQGTSNAAKTAQIVDLMVLEEEITELGEESFDA* |
| Ga0114340_12563452 | 3300008107 | Freshwater, Plankton | PEGTTREEIYDFFGEFQSFRTAFQGVSGNGITIVDLMVLEEEVTELGEESFDA* |
| Ga0114341_1003590713 | 3300008108 | Freshwater, Plankton | DFFGEFQSFRTAFQGVSGNGITIVDLMVLEEEVTELGEESFDV* |
| Ga0114350_11971741 | 3300008116 | Freshwater, Plankton | DVFDFLAENQSFRTAFQGVSNQDQTARIVDLGVVTETVTEMGEEAYDD* |
| Ga0114336_10930291 | 3300008261 | Freshwater, Plankton | LDFLGEFQSFRTAFQGVSNEDQTARIVDLCVVEEEITELGDVAYDN* |
| Ga0114962_101128131 | 3300009151 | Freshwater Lake | QSFRDAFEGVSNEDQTARIVDVRVFEETVTEMGEEAYDE* |
| Ga0114962_101128326 | 3300009151 | Freshwater Lake | DAFEGVSNEDQTARIVDVRVFEETVTEMGEEAYDE* |
| Ga0114962_107395612 | 3300009151 | Freshwater Lake | EREDVLDFLSEVQSFRTAFQGVSNEDQTARIVDLGVVEEEITELGEESFDA* |
| Ga0114975_105661523 | 3300009164 | Freshwater Lake | VPDSWEREDVLDFLGEFQSFRTAFQGVSNEDQSARIVDLGVVIETVEQLGEECFDE* |
| Ga0114959_1001396917 | 3300009182 | Freshwater Lake | VLDFLSEVQSFRTAFQGVSNEDQTARIIDLGVVEEEITELGEESFDA* |
| Ga0114974_103649553 | 3300009183 | Freshwater Lake | LAENQSFRTAFQGVSNEDQTARIIDLGVTEETVTEMGEEAFDD* |
| Ga0114974_108004213 | 3300009183 | Freshwater Lake | EDVLDFLGEYQSFRTAFQGVSNEDQSARIVDLGVVIETVEQLGEEGVDE* |
| Ga0114976_100776281 | 3300009184 | Freshwater Lake | DFLGEFQSFRTAFQGVSNEDQTARIVDLGVVIETVEQLGEECFDE* |
| Ga0114976_102203834 | 3300009184 | Freshwater Lake | FLAENQSFRDAFQGVSNTDQTARIVDLGITDETVTEMGEEAFDE* |
| Ga0114964_102849051 | 3300010157 | Freshwater Lake | CQSFRDAFEGVSNEDQTARIVDVRVFEETVTEMGEEAYDE* |
| Ga0114960_1000022171 | 3300010158 | Freshwater Lake | DFLSEVQSFRTAFQGVSNEDQTARIIDLGVVEEEITELGEESFDA* |
| Ga0114960_101476581 | 3300010158 | Freshwater Lake | VPEGWEREDVLDFLSEVQSFRTAFQGVSNEDQTARIIDLGVVEEEITELGEESFDAQLDQ |
| Ga0114960_103466272 | 3300010158 | Freshwater Lake | AFQGVSNEDQTARIIDLGVVEEEITELGEESYDA* |
| Ga0136551_10093885 | 3300010388 | Pond Fresh Water | VPEDWDRYDVFDFLAENQSFRTAFQGVSNTDQTARIIDLGVVTETVREMGEEAYDD* |
| Ga0133913_1037866111 | 3300010885 | Freshwater Lake | VQSFRTAFQGVSNEDQTARIIDLGVVEEEITELGEESFDA* |
| Ga0133913_113592485 | 3300010885 | Freshwater Lake | TAFQGVSNEDQTARIIDLGVVEEEITELGEESYDA* |
| Ga0157203_10162464 | 3300012663 | Freshwater | VLDFLGEFQSFRTAFQGVSNEDQTARIVDLGVVIETVEQLGEECFDE* |
| Ga0157203_10571403 | 3300012663 | Freshwater | VLDFLGEYQSFRTAFQGVSNEDQTARIVDLGVVIETVEQLGEECFDE* |
| Ga0157210_10088051 | 3300012665 | Freshwater | FRTAFQGVSNEDQTARIIDLHVVEDTVTEMDEVAYDD* |
| Ga0157578_10631543 | 3300012697 | Freshwater | WEREDVLDFLAEYQSFRTAFQGVSNEEQTARIVDLGVIEERVTEMGEEAFDE* |
| Ga0157593_10929311 | 3300012699 | Freshwater | AFQGVSNEEQTARIVDLGVIDETIKELGEEAYDD* |
| Ga0136642_10637671 | 3300013285 | Freshwater | DTWEREDVLDFLGEYQSFRTAFQGVSNEDQTARIFDLGVVVETVEQLGEETFDE* |
| Ga0136642_10775653 | 3300013285 | Freshwater | VPDTWEREDVLDFLGEYQSFRTAFQGVSNEDQTARIFDLGVVVETVEQLGEETFDE* |
| Ga0136642_11750023 | 3300013285 | Freshwater | VLDFLGEYQSFRTAFQGVSNEDQTARILDLGVVIETVEQLGEETFDE* |
| Ga0170791_126600261 | 3300013295 | Freshwater | QSFRTAFQGACNDEAHIFDLGVVNETVTEMGEEAFDE* |
| Ga0181356_11035174 | 3300017761 | Freshwater Lake | YDFLAEHQSFRGAFQGVSNEDQTARIIDLGITTETVTEMGEEAFDE |
| Ga0211733_110923634 | 3300020160 | Freshwater | VLDFLGEFQSFRTAFQGVSNEDQSARIVDLGVVIETVEQLGEETFDE |
| Ga0214248_10126335 | 3300020717 | Freshwater | REDVLDFLAEYQSFRGAFQGVSNEEQTARIVDLGVIEETIKELGEEAYDD |
| Ga0214178_10139634 | 3300020718 | Freshwater | DTWEREDVLDFLAEYQSFRTAFQGVSNEEQTARIVDLGVVEERVTEMGEEAFDE |
| Ga0214201_100638011 | 3300020732 | Freshwater | TAFQGVSNEEQTARIVDLGVIEERVTEMGEEAYDE |
| Ga0214219_10247934 | 3300020735 | Freshwater | QLDVSDFLAECQSFRTAFQGVSNEDQTARIVDLSVVEERVTEMGDEAYDE |
| Ga0214206_10222753 | 3300021131 | Freshwater | SFRTAFQGVSNTEQTARIVDLGVVEEVVEQMGEEAYDE |
| Ga0214164_10574601 | 3300021138 | Freshwater | WEREDVLDFLAEYQSFRTAFQGVSNEEQTARIVDLGVIEERVIEMGEEAYDE |
| Ga0214192_10695365 | 3300021142 | Freshwater | EYQSFRGAFQGVSNEEQTARIVDLGVIEETIKELGEEAYDD |
| Ga0194048_101590471 | 3300021519 | Anoxic Zone Freshwater | TAFQGVSNEDQTARIVDLGVVAETVTEMGEEAFDE |
| Ga0255147_10893443 | 3300024289 | Freshwater | YDVFDFLAEVQSFRTAFQGVSNEDQSARIIDLGVVEETVEQLGEEVYDE |
| Ga0256336_11195911 | 3300024562 | Freshwater | HVFDFLGEFQSFRTAFQGVSNEDQTARIVDLMVLEEKVTEMGEEAYDE |
| Ga0255273_10368051 | 3300024565 | Freshwater | PEGWDRMDVYDFLGEYQSFRTAFQGVSNEDQTARIIDVMVLEEEVTELGEEAYDD |
| Ga0208384_1084891 | 3300025328 | Freshwater | WEREDVYDFLAEYQSFRTAFQGVSNTEQTARIVDLGVVTEEVTEMGDEAYDD |
| Ga0208619_1155782 | 3300025336 | Freshwater | SFRTAFQGVSNEDQTARIVDLGVVNETVTEMGEEAYDE |
| Ga0208382_10278081 | 3300025369 | Freshwater | RGAFQGVSNELQSARIVDVGVVIERVTEMGEEASDE |
| Ga0208740_10344733 | 3300025391 | Freshwater | PDTWEREDVLDFLAEYQSFRTAFQGVSNEEQTARIIDLGVIEETIKELGEEAYDD |
| Ga0208874_10035621 | 3300025396 | Freshwater | LDFLAEYQSFRTAFQGVSNEEQTARIVDLGVIEERVTEMGEEAFDE |
| Ga0208874_10208495 | 3300025396 | Freshwater | QSFRTAFQGVSNEDQTARIVDLSVVEERVTEMGDEAYDE |
| Ga0208874_10357403 | 3300025396 | Freshwater | RRAFQGVSNELQTARIIDLGVVTETVKERGKEASDE |
| Ga0208875_10616462 | 3300025410 | Freshwater | LDVFDFLAECQSFRTAFQGVSNEDQTARIVDLHVVTEEVLELGEEAFDD |
| Ga0208614_10454591 | 3300025413 | Freshwater | TAFQGVSNEDQTARIVDLGVVEERVTEMGDEAYDE |
| Ga0207958_10272431 | 3300025421 | Freshwater | DNWAREDVLDFLAEYQSFRTAFQGVSNEEQTARIVDLGVIEERVTEMGEEAFDE |
| Ga0208746_10385051 | 3300025423 | Freshwater | RGAFQGVSNEEQTARIIDLGVIEETIKELGEEAYDD |
| Ga0208622_10389253 | 3300025430 | Freshwater | EVPDSWEREDVLDFLAEFQSFRTAFQGVSNEDQTARIVDLGVVDETIKEMGEEAYDD |
| Ga0208742_10250444 | 3300025437 | Freshwater | FLAEYQSFRTAFQGVSNEDQTARIVDLGVIEETIKELGEEAYDD |
| Ga0208106_10797981 | 3300025449 | Freshwater | TAFQGVSNEEQTARIIDLGVVTETVKEMGEEAYDE |
| Ga0208414_100602916 | 3300025603 | Saline Lake | QSFRTAFQGVSNEDQTARITDVSVVEENVTELGEVAYDD |
| Ga0255106_10264311 | 3300027125 | Freshwater | FDFLAENQSFRTAFQGVSNQDQTARIVDLGVVTETVTEMGEEAYDD |
| Ga0209651_10573345 | 3300027581 | Freshwater Lake | TAFQGVSNEDQSARIIDLGVVIETVEQLGEETFDE |
| Ga0208966_10464091 | 3300027586 | Freshwater Lentic | EFQSFRTAFQGVSNEDQSARIIDLGVVIETVEQLGEETFDE |
| Ga0208951_11256314 | 3300027621 | Freshwater Lentic | QSFRTAFQGVSNEDQTARIVDLGVVIETVEQLGEECFDE |
| Ga0209357_10845181 | 3300027656 | Freshwater Lake | DFLGEFQSFRTAFQGVSNEDQTARIVDLGVVIETVEQLGEETFDE |
| Ga0208975_100625513 | 3300027659 | Freshwater Lentic | VLDFLGEFQSFRTAFQGVSNEDQSARIIDLGVVIETVEQLGEETFDE |
| Ga0209189_10616941 | 3300027747 | Freshwater Lake | SWEREDVLDFLSEVQSFRTAFQGVSNEDQTARIIDLGVVEEEITELGEESFDAQLDQ |
| Ga0209084_11361711 | 3300027749 | Freshwater Lake | AECQSFRDAFEGVSNEDQTARIVDVRVFEETVTEMGEEAYDE |
| Ga0209296_12088911 | 3300027759 | Freshwater Lake | LAENQSFRTAFQGVSNEDQTARIIDLGVTEETVTEMGEEAFDD |
| Ga0209134_100435995 | 3300027764 | Freshwater Lake | LDVFDFLAENQSFRTAFQGVSNQDQTARIVDLGVVTETVTEMGEEAYDD |
| Ga0209768_104377631 | 3300027772 | Freshwater Lake | VLDFLGEFQSFRTAFQGVSNEDQTARIIDLGVVIETVEQLGEETFDE |
| Ga0209500_102733593 | 3300027782 | Freshwater Lake | HVLDFLGEFQSFRTAFQGVSNEDQTARIVDLGVVIETVEQLGEECFDE |
| Ga0209353_103327861 | 3300027798 | Freshwater Lake | EDVLDFLGEFQSFRTAFQGVSNEDQSARIIDLGVVIETVEQLGEETFDE |
| Ga0209990_101729061 | 3300027816 | Freshwater Lake | TREEIYDFFGEFQSFRTAFQGVSGNGITIVDLMVLEEEVTELGEESFDV |
| Ga0209550_105394781 | 3300027892 | Freshwater Lake | WEREDVLDFLGEFQSFRTAFQGVSNEDQSARIIDLGVVIETVEQLGEETFDE |
| Ga0209400_12009213 | 3300027963 | Freshwater Lake | SFREAFQGVSNADQTARIIDLGITTETVTEMGEEAFDE |
| Ga0209191_11659881 | 3300027969 | Freshwater Lake | DRYDVFDFLAENQSFRDAFQGVSNTDQTARIVDLGITDETVTEMGEEAFDE |
| Ga0209298_101747841 | 3300027973 | Freshwater Lake | FRTAFQGVSNEDQTARIIDLGVTEETVTEMGEEAFDD |
| Ga0255184_10901101 | 3300028091 | Freshwater | DFLAEYQSFRTAFQGVSNEDQTARIIDLGVIEEVVEQMGEEAYDE |
| Ga0255174_10851001 | 3300028275 | Freshwater | FRTAFQGVSNEDQTARIVDLGVLEEEITEMGGVAYDDXQPSPNQL |
| Ga0315907_101348551 | 3300031758 | Freshwater | LAENQSFRTAFQGVSNEDQTARILDLGVIEETVEQLGEETFDA |
| Ga0316219_11461285 | 3300031759 | Freshwater | RGAFQGVSNEEQTARIVDLGVIEETIKELGEEAYDD |
| Ga0316219_13329383 | 3300031759 | Freshwater | FRTAFQGVSNEDQTARIVDLGVVEERVTEMGEEAFDE |
| Ga0316220_11795513 | 3300031884 | Freshwater | SFRTAFQGVSNEDQTARIVDLHVVTEEVLELGEEAFDD |
| Ga0315904_101947951 | 3300031951 | Freshwater | TAFQGVSNEDQTARILDLGVIEETVEQLGEETFDA |
| Ga0315901_103752074 | 3300031963 | Freshwater | VFDFLAENQSFRTAFQGVSNQDQTARIVDLGVVTETVTEMGEEAYDD |
| Ga0315902_103494865 | 3300032093 | Freshwater | EDVFDFLAENQSFRTAFQGVSNTDQTARILDLGVVIEKVTQMGEECYDE |
| Ga0315903_100162721 | 3300032116 | Freshwater | EEIYDFFGEFQSFRTAFQGVSGNGITIVDLMVLEEEVTELGEESFDV |
| Ga0315903_104582051 | 3300032116 | Freshwater | HQSFRTAFQGVSNEDQTARIIDLHVVEEEVTEMGEVAYDD |
| Ga0315903_106318021 | 3300032116 | Freshwater | TAFQGVSNEDQTARIVDLGVVIETVEQLGEECFDE |
| Ga0316222_12126611 | 3300032561 | Freshwater | PDNWEREDVLDFLAEYQSFRGAFQGVSNEEQTARIVDLGVIEETIKELGEEAYDD |
| Ga0316222_12386004 | 3300032561 | Freshwater | DVLDFLAEYQSFRGAFQGVSNEEQTARIVDLGVVEEKVTEMGEEAYDD |
| Ga0316226_11796271 | 3300032562 | Freshwater | LDFLAEYQSFRTAFQGVSNEDQTARIVDLGVVEERVTEMGEEAFDE |
| Ga0316231_13119551 | 3300032722 | Freshwater | FRGAFQGVSNEEQTARIIDLGVIEETIKELGEEAYDD |
| Ga0335055_0077786_1409_1522 | 3300034110 | Freshwater | FRTAFQGVSNEDQTARILDLVVVEEEITELGDVAYDN |
| Ga0335054_0735592_412_525 | 3300034119 | Freshwater | FTDAFCGVSDMTQRFRIVDISVVEEEITELGEESYDA |
| Ga0335052_0104617_1_138 | 3300034279 | Freshwater | DFLAEYQSFRSAFQGTHNAAKTASIVDIMVLEEEITELGEESFDA |
| ⦗Top⦘ |