| Basic Information | |
|---|---|
| Family ID | F073427 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 39 residues |
| Representative Sequence | PAMKVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKRKG |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 30.83 % |
| % of genes near scaffold ends (potentially truncated) | 52.50 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 47 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.167 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean (53.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (97.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 14.93% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF03592 | Terminase_2 | 6.67 |
| PF10518 | TAT_signal | 5.00 |
| PF02195 | ParBc | 1.67 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 6.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.17 % |
| All Organisms | root | All Organisms | 30.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 53.33% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 31.67% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.17% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.67% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 1.67% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.67% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.83% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine | 0.83% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.83% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.83% |
| Subsea Pool | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876008 | Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-3LG-Deep1200 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009595 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009611 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3747_4435 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010932 | Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1 | Environmental | Open in IMG/M |
| 3300017702 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG | Environmental | Open in IMG/M |
| 3300017715 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaG | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020458 | Marine microbial communities from Tara Oceans - TARA_B100000749 (ERX556123-ERR599000) | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021977 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS925 _150kmer | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025293 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300028039 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 2300m | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_3335093 | 2236876008 | Marine Estuarine | MPAMKVKGGWKWGKTGTVRKTRTAAIQDGIAMRMNQKKNRKA |
| JGI25131J35506_10424952 | 3300002511 | Marine | MPAMKVKGGWKWGKTGKVFKTRQEAIDQGIAIRMNQKKNRKV* |
| JGI25131J35506_10453452 | 3300002511 | Marine | MPAMKVKGGWKWGRTGKVFKTRQEAIQQGIAIRMNQKKNRKV* |
| JGI25136J39404_10275554 | 3300002760 | Marine | MPAMKVKGGWRWGRTGKVFKTRQEAIDQGIAIRMNQKKNRKV* |
| JGI25136J39404_10922092 | 3300002760 | Marine | MPAMKVKGGWRWGKTGKVFKTRQEAIQQGIAIRMSKRKKQ* |
| JGI25136J39404_10922601 | 3300002760 | Marine | DALRPLLMPAMKVKGGWRWGKTGKVFKTRQEAIQQGIAIRMSKRKKQ* |
| Ga0098033_10838562 | 3300006736 | Marine | GGWRWGTKGKVYKTRQEAIQQGIAIRMNKKNRKV* |
| Ga0098033_10955561 | 3300006736 | Marine | MPAMKVKGGWKWGKTGKVYKTRQEAIQQGTRMNKKRKG* |
| Ga0098035_12855341 | 3300006738 | Marine | MPAMKVKGGWRWGKTGKVFKTRREAIQQGVAIRMNKKR |
| Ga0098058_10264113 | 3300006750 | Marine | MPAMKVKGGWKWGKTGKVYKTRQEAIQQGIRMNKKRKG* |
| Ga0098039_10606351 | 3300006753 | Marine | KGGWRWGKTGKVYKTRQEAIQQGIAIRMNKKKNRKA* |
| Ga0098039_11529391 | 3300006753 | Marine | MKVKGGWRWGKTGKVYKTRQEAIQQGTRMNKKRKG* |
| Ga0098039_12740311 | 3300006753 | Marine | MKVKGGWRWGKTGKVYKTRQEAIQQGIAIRMNKKRKG* |
| Ga0098054_13300662 | 3300006789 | Marine | MPAMKVKGGWKWGKTGKVFKTRQEAIQQGIAIRMNKKRKG* |
| Ga0098057_10767752 | 3300006926 | Marine | MPAMKVKGGWKWGKTGKVFKTRQEAIQQGTRMNKKRKG* |
| Ga0098057_11881922 | 3300006926 | Marine | MPAMKVKGGWRWGKTGKVFKTRQEAIQQGIAIRMNKKRKG* |
| Ga0098034_10851453 | 3300006927 | Marine | MPAMKVKGGWRWGKTGKVYKTRQEAIQQGIRMNKKR |
| Ga0098034_11426531 | 3300006927 | Marine | VKGGWRWGKTGKVYKTRQEAIQQGIAIRMNKKRKG* |
| Ga0098052_14002761 | 3300008050 | Marine | KGGWRWGKTGKVFKTRQEAIQQGIAIRMNQKKRKA* |
| Ga0114898_10179382 | 3300008216 | Deep Ocean | MPAMKVKGGWRWGKTGKVYKTRQEAIQQGTRMNKKRKG* |
| Ga0114898_10423381 | 3300008216 | Deep Ocean | PAVKVKGGWRWGRTGKVYKTRQEAIQQGIAIRMNKKRKG* |
| Ga0114898_10658761 | 3300008216 | Deep Ocean | PAMKVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKRKG* |
| Ga0114898_10680641 | 3300008216 | Deep Ocean | GLRPLLMPAMKVKGGWKWGRTGKVFKTRQEAIQQGIAIRMNQKKNRKA* |
| Ga0114898_11429041 | 3300008216 | Deep Ocean | MKVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKKRKA* |
| Ga0114898_11730992 | 3300008216 | Deep Ocean | MKVKGGWKWGRTGKVYKTRQEAIQQGIAIRMNKKRKG* |
| Ga0114898_11744481 | 3300008216 | Deep Ocean | MKVKGGWKWGRTGKVYKTRQEAIQQGVAIRMNKKRKG* |
| Ga0114899_10229353 | 3300008217 | Deep Ocean | MPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMKRKKG* |
| Ga0114899_10332882 | 3300008217 | Deep Ocean | MKVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKRKT* |
| Ga0114899_10400241 | 3300008217 | Deep Ocean | RMPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMNKRKG* |
| Ga0114899_11266912 | 3300008217 | Deep Ocean | MPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMNKRKG |
| Ga0114899_12444861 | 3300008217 | Deep Ocean | AMKVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKKRKA* |
| Ga0114904_10554752 | 3300008218 | Deep Ocean | MPAMKVKGGWKWGKTGKVYKTRTAAIQDGLAIRMDKKRKG* |
| Ga0114905_10327402 | 3300008219 | Deep Ocean | MKVKGGWKWGKTGKVYKTRQEAIQQGVAIRMNKKRKG* |
| Ga0114905_10551612 | 3300008219 | Deep Ocean | MKVKGGWRWGRTGKVYKTRQEAIQQGIAIRMNKKRKG* |
| Ga0114905_10959451 | 3300008219 | Deep Ocean | MPVMKVKGGWKWGKTGKVFKTRQEAIQQGIAIRMNKKRKG* |
| Ga0114905_11454442 | 3300008219 | Deep Ocean | VKGGWKWGKTGKVYKTRQEAIQQGIAIRMDKKRKG* |
| Ga0114910_10843152 | 3300008220 | Deep Ocean | KVKGGWKWGKTGKVYKTRQEAIQQGTRMNKKRKG* |
| Ga0114903_10193421 | 3300009412 | Deep Ocean | MKVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNRKRKG* |
| Ga0114903_10919472 | 3300009412 | Deep Ocean | AIPSQRTRMPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMKRKKG* |
| Ga0114902_11600012 | 3300009413 | Deep Ocean | LLMPAMKVKGGWRWGKTGKVYKTRQEAIQQGTRMNKKRKG* |
| Ga0114909_10716741 | 3300009414 | Deep Ocean | KVKGGWKWGKTGKVYKTRTAAIQDGLAIRMDKKRKG* |
| Ga0114909_10850012 | 3300009414 | Deep Ocean | VKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKRKG* |
| Ga0114909_11134652 | 3300009414 | Deep Ocean | VKGGWKWGKTGKVYKTRQKAIQQGIAIRMNKKRKG* |
| Ga0114909_11994002 | 3300009414 | Deep Ocean | VIKVKGGWKWGRTGKVYKTRQEAIQQGVAIRMNKKRKG* |
| Ga0114908_11532662 | 3300009418 | Deep Ocean | PVIKVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNRKRKG* |
| Ga0105214_1236231 | 3300009595 | Marine Oceanic | AIPSQRTRMPAMKVKGGWKWGKTGKVRKTRQEAIQDGLDIRMKRKKG* |
| Ga0114900_10449574 | 3300009602 | Deep Ocean | KGGWKWGKTGKVYKTRQEAIQQGIAIRMNRKRKG* |
| Ga0114911_10177852 | 3300009603 | Deep Ocean | MPAMKVKGGWKWGKTGKVRKTRQEAIQDGLDIRMKRKKG* |
| Ga0114911_10956961 | 3300009603 | Deep Ocean | KVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKRKG* |
| Ga0114901_11420582 | 3300009604 | Deep Ocean | MKVKGGWKWGRTGKVFKTRQEAIQQGIAIRMNQKKNRKA* |
| Ga0114901_12105801 | 3300009604 | Deep Ocean | MPAMKVKGGWKWGRTGKVYKTRQEAIQQGVAIRMNKKRKG* |
| Ga0114906_10465663 | 3300009605 | Deep Ocean | AIPSQRTRMPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMNKRKG* |
| Ga0114906_10975791 | 3300009605 | Deep Ocean | MPAMKVKGGWKWGRTGKVYKTRQEAIQQGIAIRMNKKRKG* |
| Ga0114906_12466492 | 3300009605 | Deep Ocean | GWKWGRTGKVYKTRQEAIQQGLAIRMNQKKNRKV* |
| Ga0105229_1157501 | 3300009611 | Marine Oceanic | MPAMKVKGGWRWGTKGKIHKTRRAAIQEGIAIRMKGNRKA* |
| Ga0114912_10150881 | 3300009620 | Deep Ocean | KVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKGKG* |
| Ga0114912_10608421 | 3300009620 | Deep Ocean | MPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMNKRK |
| Ga0098049_12077672 | 3300010149 | Marine | MPAMKVKGGWKWGKTGKVYKTRQKAIQQGVAIRMNKKRKG* |
| Ga0098059_12335991 | 3300010153 | Marine | MPVTKVKGGWRWGKAGKVFKTRQEAIQQGIAIRMNKKRKG* |
| Ga0098059_13346591 | 3300010153 | Marine | MPAMKVKGGWKWGKTGEVYKTRQEAIQQGIRMNKKRKG* |
| Ga0098047_101000952 | 3300010155 | Marine | MPAMKVKGGWRWGRTGKVYKTRQEAIQQGIRMNKKRKG* |
| Ga0098047_101151311 | 3300010155 | Marine | AMKVKGGWRWGKTGKVYKTRQEAIQQGTRMNKKRKG* |
| Ga0137843_11409421 | 3300010932 | Subsea Pool | MPVEKVKGGWRWGKRGXVYKTRQEAIQQGVAIKMNQKKRKA* |
| Ga0181374_10681521 | 3300017702 | Marine | MPAMKVKGGWKWGKTGKVYKTRQEAIQQGIRMNKKRKG |
| Ga0181370_10298812 | 3300017715 | Marine | MPAMKVRGGWKWGKTGKVYKTRQEAIQQGIAIRMN |
| Ga0181375_10727632 | 3300017718 | Marine | KGGWRWGKTGKVYKTRQEAIQQGIAIRMNQKKNRKA |
| Ga0181432_10214742 | 3300017775 | Seawater | MPAMKVKGGWRWGKTGKVFKTRQEAIQQGIAIRMKKRKG |
| Ga0181432_11059512 | 3300017775 | Seawater | MPAMKVKGGWKWGKTGKVFKTRQEAIQQGIAIRMNKKRKA |
| Ga0181432_11391642 | 3300017775 | Seawater | MPAEKVKGGWRWGKTGKVHKTRREAIQQGIAIRMSKRKKG |
| Ga0181432_11598821 | 3300017775 | Seawater | GGWKWGKTGKVFKTRQEAIQQGIAIRMNQKKNRKV |
| Ga0181432_13000402 | 3300017775 | Seawater | MPAEKVKGGWRWGKTGKVFKTRREAIKQGIAIRMNKKRKT |
| Ga0211697_103593581 | 3300020458 | Marine | MPAMKVKGGWKWGKTGKVFKTRKEAIQQGIAIRMNKKRKS |
| Ga0206685_101657661 | 3300021442 | Seawater | MPAMKVKGGWKWGKTGKVFKTRREAIQQGIAIRMNKKRKG |
| Ga0232639_13668081 | 3300021977 | Hydrothermal Vent Fluids | MPATKVKGGWRWGTKGKIHKTRRAAIQEGIAIRMKGN |
| (restricted) Ga0255048_105157812 | 3300024518 | Seawater | VRGGWRWGKTGKVHKTRKAAIDQGIAIRMNQKKNRKV |
| Ga0207902_10491912 | 3300025046 | Marine | MPAMKVKGGWKWGKTGKVRKTRQKAIQDGIAIRMKKRKT |
| Ga0207887_10855231 | 3300025069 | Marine | RMPAMKVKGGWKWGKTGTVRKTRQKAIQDGLAIRMNQKKNRKA |
| Ga0208013_10206552 | 3300025103 | Marine | MPAMKVKGGWKWGKTGKVFKTRQEAIQQGIAIRMNKKRKG |
| Ga0209349_10480572 | 3300025112 | Marine | MPAMKVKGGWKWGKTGKVRKTRQEAIQDGLDIRMKRKKG |
| Ga0209644_10139131 | 3300025125 | Marine | MPAMKVKGGWKWGKTGKVFKTRQEAIDQGIAIRMNQKKNRKV |
| Ga0209644_10669441 | 3300025125 | Marine | MPAMKVKGGWKWGRTGKVFKTRQEAIQQGIAIRMNQKKNRKV |
| Ga0208919_10419522 | 3300025128 | Marine | MKVKGGWRWGKTGKVYKTRQKAIQQGVAIRMNKKRKG |
| Ga0208299_10288003 | 3300025133 | Marine | KGGWKWGKTGKVYKTRQEAIQQGIAIRMNQKKRKG |
| Ga0208299_11908862 | 3300025133 | Marine | MPVMKVKGGWKWGKTGKVYKTRQEAIQQGTRMNKRK |
| Ga0208182_10262292 | 3300025251 | Deep Ocean | MPAMKVKGGWRWGKTGKVYKTRQEAIQQGTRMNKKRKG |
| Ga0208182_10287551 | 3300025251 | Deep Ocean | RTRMPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMNKRKG |
| Ga0208182_10395311 | 3300025251 | Deep Ocean | MPVMKVKGGWKWGKTGKVFKTRQEAIQQGIAIRMNKKRKG |
| Ga0208182_10414981 | 3300025251 | Deep Ocean | IKVKGGWKWGKTGKVYKTRTAAIQDGLAIRMDKKRKG |
| Ga0208182_10758931 | 3300025251 | Deep Ocean | MKVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKRKG |
| Ga0208029_10166941 | 3300025264 | Deep Ocean | MPAMKVKGGWKWGKTGKVYKTRTAAIQDGLAIRMDKKRKG |
| Ga0208029_10304281 | 3300025264 | Deep Ocean | MPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMKRKKG |
| Ga0208029_10430991 | 3300025264 | Deep Ocean | VKGGWKWGRTGKVYKTRQEAIQQGIAIRMNKKRKG |
| Ga0208179_10238191 | 3300025267 | Deep Ocean | LMPAMKVKGGWKWGRTGKVFKTRQEAIQQGIAIRMNQKKNRKA |
| Ga0208179_10267032 | 3300025267 | Deep Ocean | MKVKGGWKWGRTGKVYKTRQEAIQQGVAIRMNKKRKG |
| Ga0208179_10645832 | 3300025267 | Deep Ocean | MPAMKVKGGWKWGRTGKVYKTRQEAIQQGIAIRMNKKRKG |
| Ga0208179_10840922 | 3300025267 | Deep Ocean | MPVMKVKGGWKWGKTGKVFKTRQEAIQQGIAIRMNKKRKT |
| Ga0208183_10338002 | 3300025274 | Deep Ocean | MPAMKVKGGWRWGKTGKVYKTRTAAIQQGIAIRMDKKRKG |
| Ga0208180_10107031 | 3300025277 | Deep Ocean | SQRTRMPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMKRKKG |
| Ga0208180_10302632 | 3300025277 | Deep Ocean | VKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKRKG |
| Ga0208180_10589822 | 3300025277 | Deep Ocean | IKVKGGWKWGRTGKVYKTRQEAIQQGVAIRMNKKRKG |
| Ga0208180_11063851 | 3300025277 | Deep Ocean | GNRMPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMNKRKG |
| Ga0208449_10195552 | 3300025280 | Deep Ocean | MPAMKVKGGWKWGRTGKVYKTRQEAIQQGVAIRMNKKRKG |
| Ga0208449_10393693 | 3300025280 | Deep Ocean | MPAMKVKGGWRWGKTGKVYKTRTAAIQDGLAIRMDKKRKG |
| Ga0208315_10172753 | 3300025286 | Deep Ocean | KVKGGWRWGKTGKVYKTRQEAIQQGIAIRMDKKRKG |
| Ga0208934_10527381 | 3300025293 | Deep Ocean | VKGGWKWGKTGKVYKTRQEAIQQGIAIRMNRKRKG |
| Ga0208934_10682851 | 3300025293 | Deep Ocean | LRPLLMPAMKVKGGWKWGRTGKVYKTRQEAIQQGIAIRMNKKRKG |
| Ga0208316_10279191 | 3300025296 | Deep Ocean | MKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMNKRKG |
| Ga0208450_10523952 | 3300025301 | Deep Ocean | VKGGWRWGKTGKVYKTRQEAIQQGIAIRMNKKRKG |
| Ga0208450_10935822 | 3300025301 | Deep Ocean | AIPSQRTRMPAMKVKGGWKWGKTGKVRKTRQEAVQDGLDIRMNKRKG |
| Ga0208684_10225561 | 3300025305 | Deep Ocean | PAMKVKGGWKWGRTGKVYKTRQEAIQQGVAIRMNKKRKG |
| Ga0208684_10356981 | 3300025305 | Deep Ocean | KVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKRKG |
| Ga0208684_10482502 | 3300025305 | Deep Ocean | MKVKGGWKGGKTGKVYKTRQEAIQQGIAIRMNKKRKG |
| Ga0209757_100750911 | 3300025873 | Marine | MPAMKVKGGWKWGKTGKVFKTRQEAIQQGIAIRMNQKKNRKV |
| Ga0209757_101314442 | 3300025873 | Marine | MPAMKVKGGWRWGKTGKVFKTRQEAIQQGIAIRMSKRKKQ |
| Ga0209757_102028991 | 3300025873 | Marine | MPAMKVKGGWRWGKTGKVFKTRREAIQQGIAIRMNKRKKG |
| Ga0256380_10386252 | 3300028039 | Seawater | MAAMKVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNQKKNRKV |
| Ga0256380_10498721 | 3300028039 | Seawater | MKVKGGWKWGKTGKVYKTRQEAIQQGIAIRMNKKRKT |
| Ga0310345_111948682 | 3300032278 | Seawater | MPAMKVKGGWKWGKTGKVRKTRQEAIQDGLDIRMNKRKKG |
| Ga0326756_042917_34_153 | 3300034629 | Filtered Seawater | MPAMKVKGGWKWGKTGTVRKTRQKAIQDGIAIRMKKRKT |
| Ga0326748_042303_1_123 | 3300034656 | Filtered Seawater | MPAMKVKGGWRWGTKGKVHKTRRAAIQEGIAIRMKGNRKA |
| ⦗Top⦘ |