| Basic Information | |
|---|---|
| Family ID | F073395 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MTRSKTRKVPPFSSDHPFPYVLVCSTFGTIVSLAVVWIVTAHSVAQAMVA |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 72.81 % |
| % of genes near scaffold ends (potentially truncated) | 32.50 % |
| % of genes from short scaffolds (< 2000 bps) | 78.33 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.03% β-sheet: 0.00% Coil/Unstructured: 58.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00027 | cNMP_binding | 15.83 |
| PF13545 | HTH_Crp_2 | 15.00 |
| PF13188 | PAS_8 | 10.00 |
| PF08447 | PAS_3 | 3.33 |
| PF00196 | GerE | 1.67 |
| PF17200 | sCache_2 | 1.67 |
| PF00106 | adh_short | 0.83 |
| PF08269 | dCache_2 | 0.83 |
| PF04226 | Transgly_assoc | 0.83 |
| PF13561 | adh_short_C2 | 0.83 |
| PF07238 | PilZ | 0.83 |
| PF13426 | PAS_9 | 0.83 |
| PF14023 | DUF4239 | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.67 % |
| Unclassified | root | N/A | 48.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16859184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1400 | Open in IMG/M |
| 3300000559|F14TC_100522859 | Not Available | 590 | Open in IMG/M |
| 3300001139|JGI10220J13317_10548736 | Not Available | 833 | Open in IMG/M |
| 3300002120|C687J26616_10060850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1284 | Open in IMG/M |
| 3300002459|JGI24751J29686_10109193 | Not Available | 579 | Open in IMG/M |
| 3300003267|soilL1_10186806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1086 | Open in IMG/M |
| 3300003996|Ga0055467_10082174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 890 | Open in IMG/M |
| 3300003998|Ga0055472_10267157 | Not Available | 543 | Open in IMG/M |
| 3300004156|Ga0062589_100416711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1098 | Open in IMG/M |
| 3300004481|Ga0069718_13128047 | Not Available | 677 | Open in IMG/M |
| 3300004481|Ga0069718_15989559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1404 | Open in IMG/M |
| 3300004801|Ga0058860_11828268 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300005045|Ga0071328_135202 | All Organisms → cellular organisms → Bacteria | 4410 | Open in IMG/M |
| 3300005093|Ga0062594_101286141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 732 | Open in IMG/M |
| 3300005093|Ga0062594_102976763 | Not Available | 529 | Open in IMG/M |
| 3300005332|Ga0066388_103456349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 806 | Open in IMG/M |
| 3300005332|Ga0066388_104056243 | Not Available | 747 | Open in IMG/M |
| 3300005332|Ga0066388_104999425 | Not Available | 674 | Open in IMG/M |
| 3300005347|Ga0070668_101761458 | Not Available | 569 | Open in IMG/M |
| 3300005367|Ga0070667_100012003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7171 | Open in IMG/M |
| 3300005468|Ga0070707_101220989 | Not Available | 718 | Open in IMG/M |
| 3300005518|Ga0070699_101047566 | Not Available | 748 | Open in IMG/M |
| 3300005539|Ga0068853_100000361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 31319 | Open in IMG/M |
| 3300005617|Ga0068859_100651545 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300005764|Ga0066903_102539921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 992 | Open in IMG/M |
| 3300005764|Ga0066903_102637383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 974 | Open in IMG/M |
| 3300005842|Ga0068858_102076077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Arenibaculum → Arenibaculum pallidiluteum | 562 | Open in IMG/M |
| 3300005844|Ga0068862_100069969 | All Organisms → cellular organisms → Bacteria | 3029 | Open in IMG/M |
| 3300005937|Ga0081455_10005103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14484 | Open in IMG/M |
| 3300006047|Ga0075024_100112682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1205 | Open in IMG/M |
| 3300006050|Ga0075028_100772756 | Not Available | 583 | Open in IMG/M |
| 3300006755|Ga0079222_10901006 | Not Available | 742 | Open in IMG/M |
| 3300006853|Ga0075420_101200173 | Not Available | 652 | Open in IMG/M |
| 3300006865|Ga0073934_10082852 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
| 3300007004|Ga0079218_13203896 | Not Available | 553 | Open in IMG/M |
| 3300009036|Ga0105244_10136190 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300009053|Ga0105095_10759853 | Not Available | 542 | Open in IMG/M |
| 3300009082|Ga0105099_10765635 | Not Available | 602 | Open in IMG/M |
| 3300009094|Ga0111539_10297322 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
| 3300009101|Ga0105247_11156429 | Not Available | 614 | Open in IMG/M |
| 3300009148|Ga0105243_12866175 | Not Available | 523 | Open in IMG/M |
| 3300009156|Ga0111538_11655718 | Not Available | 806 | Open in IMG/M |
| 3300009166|Ga0105100_10180866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1255 | Open in IMG/M |
| 3300009171|Ga0105101_10200583 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300009811|Ga0105084_1008557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1531 | Open in IMG/M |
| 3300009818|Ga0105072_1022761 | Not Available | 1148 | Open in IMG/M |
| 3300009819|Ga0105087_1036294 | Not Available | 767 | Open in IMG/M |
| 3300009820|Ga0105085_1022727 | Not Available | 1090 | Open in IMG/M |
| 3300009821|Ga0105064_1028697 | Not Available | 1040 | Open in IMG/M |
| 3300009836|Ga0105068_1015763 | Not Available | 1256 | Open in IMG/M |
| 3300010043|Ga0126380_10038309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 2493 | Open in IMG/M |
| 3300010047|Ga0126382_10071880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 2124 | Open in IMG/M |
| 3300010047|Ga0126382_10422550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1047 | Open in IMG/M |
| 3300010048|Ga0126373_10422347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1362 | Open in IMG/M |
| 3300010361|Ga0126378_10022340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5498 | Open in IMG/M |
| 3300010375|Ga0105239_12552602 | Not Available | 596 | Open in IMG/M |
| 3300010401|Ga0134121_12211074 | Not Available | 587 | Open in IMG/M |
| 3300012882|Ga0157304_1053836 | Not Available | 628 | Open in IMG/M |
| 3300012898|Ga0157293_10039970 | Not Available | 994 | Open in IMG/M |
| 3300012908|Ga0157286_10186336 | Not Available | 690 | Open in IMG/M |
| 3300012910|Ga0157308_10257685 | Not Available | 619 | Open in IMG/M |
| 3300012913|Ga0157298_10015523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1357 | Open in IMG/M |
| 3300012913|Ga0157298_10281714 | Not Available | 579 | Open in IMG/M |
| 3300012916|Ga0157310_10092475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 959 | Open in IMG/M |
| 3300012948|Ga0126375_10012844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3627 | Open in IMG/M |
| 3300012964|Ga0153916_12676300 | Not Available | 562 | Open in IMG/M |
| 3300014320|Ga0075342_1008421 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300014325|Ga0163163_13216777 | Not Available | 509 | Open in IMG/M |
| 3300015201|Ga0173478_10030411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1629 | Open in IMG/M |
| 3300015371|Ga0132258_12958514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1179 | Open in IMG/M |
| 3300015373|Ga0132257_101108993 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300016319|Ga0182033_10141376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1843 | Open in IMG/M |
| 3300018032|Ga0187788_10316125 | Not Available | 637 | Open in IMG/M |
| 3300018055|Ga0184616_10279758 | Not Available | 633 | Open in IMG/M |
| 3300018429|Ga0190272_10492388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
| 3300018469|Ga0190270_10025099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3772 | Open in IMG/M |
| 3300018469|Ga0190270_10786298 | Not Available | 956 | Open in IMG/M |
| 3300018469|Ga0190270_11551857 | Not Available | 712 | Open in IMG/M |
| 3300018469|Ga0190270_11716599 | Not Available | 682 | Open in IMG/M |
| 3300018481|Ga0190271_10122756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2448 | Open in IMG/M |
| 3300018481|Ga0190271_10258205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1779 | Open in IMG/M |
| 3300020074|Ga0194113_10028309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 5930 | Open in IMG/M |
| 3300021560|Ga0126371_10184680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 2172 | Open in IMG/M |
| 3300021560|Ga0126371_10871388 | Not Available | 1045 | Open in IMG/M |
| 3300023261|Ga0247796_1019768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1037 | Open in IMG/M |
| 3300024055|Ga0247794_10151898 | Not Available | 724 | Open in IMG/M |
| 3300025160|Ga0209109_10022938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 3368 | Open in IMG/M |
| 3300025310|Ga0209172_10170142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1175 | Open in IMG/M |
| 3300025318|Ga0209519_10188832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1215 | Open in IMG/M |
| 3300026770|Ga0207537_104474 | Not Available | 552 | Open in IMG/M |
| 3300027561|Ga0209887_1017583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1759 | Open in IMG/M |
| 3300027675|Ga0209077_1188615 | Not Available | 575 | Open in IMG/M |
| 3300027910|Ga0209583_10298007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 731 | Open in IMG/M |
| 3300027952|Ga0209889_1075296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 688 | Open in IMG/M |
| 3300027954|Ga0209859_1027305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 971 | Open in IMG/M |
| 3300027957|Ga0209857_1002302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4198 | Open in IMG/M |
| 3300028802|Ga0307503_10118194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1158 | Open in IMG/M |
| 3300030006|Ga0299907_10805764 | Not Available | 708 | Open in IMG/M |
| 3300030620|Ga0302046_11128619 | Not Available | 619 | Open in IMG/M |
| 3300031228|Ga0299914_10089887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 2682 | Open in IMG/M |
| 3300031229|Ga0299913_10585516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1099 | Open in IMG/M |
| 3300031280|Ga0307428_1044667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1318 | Open in IMG/M |
| 3300031368|Ga0307429_1009249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 3538 | Open in IMG/M |
| 3300031368|Ga0307429_1074456 | Not Available | 999 | Open in IMG/M |
| 3300031368|Ga0307429_1159519 | Not Available | 597 | Open in IMG/M |
| 3300031545|Ga0318541_10266680 | Not Available | 953 | Open in IMG/M |
| 3300031716|Ga0310813_10903486 | Not Available | 801 | Open in IMG/M |
| 3300031820|Ga0307473_10815106 | Not Available | 667 | Open in IMG/M |
| 3300031910|Ga0306923_10169185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2496 | Open in IMG/M |
| 3300031940|Ga0310901_10093405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1073 | Open in IMG/M |
| 3300031949|Ga0214473_10349315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1679 | Open in IMG/M |
| 3300031949|Ga0214473_11605358 | Not Available | 652 | Open in IMG/M |
| 3300032261|Ga0306920_100760721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium facile | 1424 | Open in IMG/M |
| 3300033417|Ga0214471_11277331 | Not Available | 556 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.67% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 8.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 4.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.17% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.67% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.67% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.67% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.83% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.83% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026770 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031280 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240 | Environmental | Open in IMG/M |
| 3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03723000 | 2088090014 | Soil | MTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA |
| F14TC_1005228592 | 3300000559 | Soil | MTRSKTQKVNQFSSDHPFPYVLACSTFGTIVSLAAVWIVTAHSVAQAMVA* |
| JGI10220J13317_105487363 | 3300001139 | Soil | VPQLSSDHPFPYVLVCSTFGTIISSAAVWIVTAHSVAQAMVA* |
| C687J26616_100608502 | 3300002120 | Soil | MTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTASSFAPVMVA* |
| JGI24751J29686_101091932 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAASLAAVWIVTAHSVAQAMVA* |
| soilL1_101868061 | 3300003267 | Sugarcane Root And Bulk Soil | MARSKSYKDRFSSDRSFPYVLVCSMLGSIVSLASVWLVTAHSVTLAMVA* |
| Ga0055467_100821741 | 3300003996 | Natural And Restored Wetlands | MTRSKSHHDQFSADRSFPYVLVCSMLGSIVSLASVWLVTVHSVAQAMIA* |
| Ga0055472_102671571 | 3300003998 | Natural And Restored Wetlands | MARSKSHKDPFSADRSFPYVLVCSMLGSIVSLASVWLVTVHSVAQAMIA* |
| Ga0062589_1004167112 | 3300004156 | Soil | MTRLKTRKVPQLSSDHPFPYVLVCSTFGTIISFAAVWIVTAHSVAQAMVA* |
| Ga0069718_131280472 | 3300004481 | Sediment | MVRAAKPKEIVMPRSKPHKDQFSSDRSFPYVLICSTLGTVISLASVWLATAQTVALAIVA |
| Ga0069718_159895592 | 3300004481 | Sediment | MTRSKSHNDQFSADRSFPYVLVCSMLGSIVSLASVWLVTVHSVAQAMIA* |
| Ga0058860_118282681 | 3300004801 | Host-Associated | KEIAMTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0071328_1352025 | 3300005045 | Permafrost | MTRSKSPKIPPFSADHSFPYVLLCSTLGTVVSLAFVWIMTAHSYAAMMVA* |
| Ga0062594_1012861412 | 3300005093 | Soil | MTRTQYKVPQFSTDQSFPYVLVCSTVGTIISLAAALLLAVHSLAPMVA* |
| Ga0062594_1029767631 | 3300005093 | Soil | GPERRIYKEIAVTRSKSHKDPFSSDRSFPYVLVCSTFGTFVSLAFVWIVTIHSVAQAAVA |
| Ga0066388_1034563492 | 3300005332 | Tropical Forest Soil | MTRSKTRKVPPFSSDHPFSYVLVCSTFGTIVSLAMVWIVTAHSVAQAIVA* |
| Ga0066388_1040562431 | 3300005332 | Tropical Forest Soil | MTRRKPHTDPFSSDHSFPYVLVWSMLGAVVSLASVWLITANSMAQVLVA* |
| Ga0066388_1049994251 | 3300005332 | Tropical Forest Soil | MSRLKTLKVPQLSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0070668_1017614581 | 3300005347 | Switchgrass Rhizosphere | GPERRIYKEIAVTRSKSHKDPFSSDRSFPYVLVCSIFGTVVSLAFVWIVTIHSVAQAAVA |
| Ga0070667_1000120035 | 3300005367 | Switchgrass Rhizosphere | MTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0070707_1012209891 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ELKEIAMIRSKTRKVPPFSSDHLFPYVLVCSTFGTIVSLAVVWIVTAHSVAQAMVA* |
| Ga0070699_1010475663 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRSKTRKVPPFSSDHLFPYVLVCSTFGTIVSLAVVWIVSAHSVAQAMVA* |
| Ga0068853_10000036123 | 3300005539 | Corn Rhizosphere | MTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHS |
| Ga0068859_1006515451 | 3300005617 | Switchgrass Rhizosphere | VTRSKSHKDPFSSDRSFPYVLVCSIFGTFVSLAFVWIVTIHSVAQAAVA* |
| Ga0066903_1025399212 | 3300005764 | Tropical Forest Soil | MTRSKTRKLPPFSSDHLFPYVLVCSTFGTVVSHAAIWIVAALSVAQAMVA* |
| Ga0066903_1026373833 | 3300005764 | Tropical Forest Soil | MTRPKTRKVPPFSSDHPFPYVLVCSTFGTIASLAVVWIVTAHSVAQAIVA* |
| Ga0068858_1020760771 | 3300005842 | Switchgrass Rhizosphere | VTRSKSHKDPFSSDRSFPYVLVCSIFGTVVSLAFVWIVTIHSVAQA |
| Ga0068862_1000699696 | 3300005844 | Switchgrass Rhizosphere | SKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0081455_1000510310 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTRSKTRKVPPFSSDHSFPYVLLCSTFGTVVSLAAVWIMTAHSMAQTLVA* |
| Ga0075024_1001126821 | 3300006047 | Watersheds | MTRSTSHKVPQFSADHAFPYVLLCSTIGTLVSLASVWIMTAHSYAPVMV |
| Ga0075028_1007727562 | 3300006050 | Watersheds | MTRSKKTRVPPFSTDRSFPYVLLCGTLGTAVSLAAVWIMTAHSYAPMMTA* |
| Ga0079222_109010062 | 3300006755 | Agricultural Soil | MTRLKTGQLSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0075420_1012001731 | 3300006853 | Populus Rhizosphere | MTRSKTRKVPRFSSDHAFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0073934_100828526 | 3300006865 | Hot Spring Sediment | MTRSKPHKDPFSSDRSFPYVLLCSTLGTVVSLASVWIVTAHSVAQAMVA* |
| Ga0075419_113950573 | 3300006969 | Populus Rhizosphere | SDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0079218_132038961 | 3300007004 | Agricultural Soil | KSHNDQFSADRSFPYVLVCSMLGSIVSLASVWLVTVHSVAQAMIA* |
| Ga0105244_101361901 | 3300009036 | Miscanthus Rhizosphere | KEIAMTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAIVA* |
| Ga0105095_107598531 | 3300009053 | Freshwater Sediment | MTRSKARKVPPFFADRSFPYVLVCSMLGTVVSLASVWLVTAQSYAQMMVA* |
| Ga0105099_107656351 | 3300009082 | Freshwater Sediment | RSKSHHDQFSADRSFPYVQVCSMLGSIVSLASVWLVTVHSVAQAMIA* |
| Ga0111539_102973221 | 3300009094 | Populus Rhizosphere | SELKEIAMTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0105247_111564291 | 3300009101 | Switchgrass Rhizosphere | MTRSKTRKVPPFSSDHPFPYVLVCSTFGTIVSLAVVWIVTAHSVAQAMVA* |
| Ga0105243_128661751 | 3300009148 | Miscanthus Rhizosphere | VTRSKSHKDPFSSDRSFPYVLVCSTFGTFVSLAFVWIVTIHSV |
| Ga0111538_116557182 | 3300009156 | Populus Rhizosphere | ELKEIAMTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0105100_101808662 | 3300009166 | Freshwater Sediment | MTRFKARKVPPFFADRSFPYVLVCSMLGTVVSLASVWLVTAQSYAQMMVA* |
| Ga0105101_102005831 | 3300009171 | Freshwater Sediment | MTRSEARKVPPFFADRSFPYVLVCSMLGTVVSLASVWLVTAQSYAQMMVA* |
| Ga0105084_10085573 | 3300009811 | Groundwater Sand | MVLSGDLRTKAMTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTASSFAQAMVA* |
| Ga0105072_10227612 | 3300009818 | Groundwater Sand | MTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTAHSFAPIMVA* |
| Ga0105087_10362942 | 3300009819 | Groundwater Sand | MVLSGDLRTKAMTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSLASVWIMTAHSFAQATIA* |
| Ga0105085_10227274 | 3300009820 | Groundwater Sand | MVLSGDLRTKAMTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTAHSFAPAMVA* |
| Ga0105064_10286972 | 3300009821 | Groundwater Sand | MTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTASSFAQAMVA* |
| Ga0105068_10157631 | 3300009836 | Groundwater Sand | MVLSGDLRTKAMTRSKSHKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTASSFAQAMVA* |
| Ga0126380_100383092 | 3300010043 | Tropical Forest Soil | MTRSKTRKVPPFSSDHPVPYVLVCSTFGTIVSLAVVWIVTAHSVAQAMVA* |
| Ga0126382_100718802 | 3300010047 | Tropical Forest Soil | MTRSKTRKVPPFSSDHPFPYVLVCSTFGTIVSLAVVWIATAHSVAKAMVA* |
| Ga0126382_104225501 | 3300010047 | Tropical Forest Soil | MTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTGHSVAPAMLA* |
| Ga0126373_104223473 | 3300010048 | Tropical Forest Soil | MTRSKTRKLPPFSSDHPFPYVLVCSTFGTVVSHAAIWIVAAL |
| Ga0126378_100223403 | 3300010361 | Tropical Forest Soil | MTRSKTRKVPPFCSDHPVPYVLVCSTFGTIVSLAVVWIVTAHSVAQAMVA* |
| Ga0134128_115189933 | 3300010373 | Terrestrial Soil | SSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0105239_125526021 | 3300010375 | Corn Rhizosphere | VTRSKSHKDPFSSDRSFPYVLVSSTFGTVVSLAFVWIVTIHSVAQAMVA* |
| Ga0134121_122110742 | 3300010401 | Terrestrial Soil | MTRSKTRKVPQFTSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0157304_10538361 | 3300012882 | Soil | VARHPPPHKLRMLLSRRIKEIGITRLKTRKVPQLSSDHPFPYVLVCSTFGTIISFAAVWIVTAHSVAQAVVA* |
| Ga0157293_100399702 | 3300012898 | Soil | MLLSRRIKEIAMTRLKTRKVPQLSSDHPFPYVLVCSTFGTIISFAAVWIVTAHSVAQAMVA* |
| Ga0157286_101863361 | 3300012908 | Soil | AITRLKTRKVPQLSSDHPFPYVLVCSTFGTIISFAAVWIVTAHSVAQAVVA* |
| Ga0157308_102576851 | 3300012910 | Soil | TRLKTRKVPQLSSDHPFPYVLVCSTFGTIISFAAVWIVTAHSVAQAMVA* |
| Ga0157298_100155233 | 3300012913 | Soil | MTRSKTRKVPQFSSDHPFPYALVCSTFGTIISLAAVWIVTAHSVA |
| Ga0157298_102817141 | 3300012913 | Soil | RKVPQFSSDHPLPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0157310_100924751 | 3300012916 | Soil | MTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISFAAVWIVTAFSGPGGGG |
| Ga0126375_100128442 | 3300012948 | Tropical Forest Soil | MTRSKTRKVPPFSSDHPVPYVLVCSTFGTIVSLAVVWIVTAHSVAKAMVA* |
| Ga0153916_126763001 | 3300012964 | Freshwater Wetlands | MTRSKSHKDPFSSDRSFPYVLVCSMLGTVVSLASVWIVTAHSVAHVIVA* |
| Ga0164307_107831211 | 3300012987 | Soil | PFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0075324_11471621 | 3300014263 | Natural And Restored Wetlands | DRSFPYVLVCSMLGTVVSLSSVWIVTAHSFAQAMVA* |
| Ga0075342_10084211 | 3300014320 | Natural And Restored Wetlands | MSRSRSHKIPQFSADRSFPYVLVCSMLGAVASLTSVWIVTAHSFTQAMVA* |
| Ga0163163_132167772 | 3300014325 | Switchgrass Rhizosphere | VTRSKSHKDPFSSDRSFPYVLVCSIFGTVVSLAFVWIVTIHSVAQAAVA* |
| Ga0157376_118348452 | 3300014969 | Miscanthus Rhizosphere | SFPYVLVCSTFGTFVSLAFVWIVTIHSVAQAAVA* |
| Ga0173478_100304113 | 3300015201 | Soil | MEIVMTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAMVA* |
| Ga0132258_129585141 | 3300015371 | Arabidopsis Rhizosphere | MTRSKTRKVPPFSSDHPFPYVLVCSTFGTIVSLAVVWIVTAHSVAKAMVASPQCGKC |
| Ga0132257_1011089933 | 3300015373 | Arabidopsis Rhizosphere | SRARELKEIAMTRSKTRKVPPFSSDHPFLYVLVCSTFGTIVSLAVVWIVTAHSVAQAMVA |
| Ga0182033_101413764 | 3300016319 | Soil | QLKEIAMTRSKTRKVPPFSSDHPFPYVLVCSTFGTIVSLAVVWIVTAHSVAQAMVA |
| Ga0187788_103161252 | 3300018032 | Tropical Peatland | MTRSKSHKDPFSSDRSFPYVLLCSTLGTVVSLASVWIVTAHSFAQAMVA |
| Ga0184616_102797581 | 3300018055 | Groundwater Sediment | MTRSKTHKVPAFAADHSFPYVLLCSTLGTVVSLASVWIMTAHSLAQTIVA |
| Ga0190272_104923882 | 3300018429 | Soil | MTRSKSHKDPFSADRSFPYVLVCSMLGSIVSLASVWLVTVHSVAQAMIA |
| Ga0190270_100250994 | 3300018469 | Soil | MTRRNPHKDLFSSDRTFPYVLLCSTLGTVVSLASVWIVTAQSVQAIVA |
| Ga0190270_107862982 | 3300018469 | Soil | MTRRNPHKESFSSDRTFPYVLLCSTLGTVVSLASVWIVTAQSVQAIVS |
| Ga0190270_115518573 | 3300018469 | Soil | ERRTKREIAMTRSKPHKDSFSSDRSFPYVLLFSTLGTVVSLASVWIATAQSVAQAMVA |
| Ga0190270_117165992 | 3300018469 | Soil | MTRSKSHNDPFSADRSFPYVLVCSMLGSIVSLASVWLVTAHSVAQAMIA |
| Ga0190271_101227564 | 3300018481 | Soil | MTRRNPHKDSFSSDRTFPYVLLCSTLGTVVSLASVWIVTAQSVQAIVA |
| Ga0190271_102582052 | 3300018481 | Soil | MTRSKPHKDSFSSDRSFPYVLLCSTLGTVVSLASVWVATAQSVAQAMVA |
| Ga0194113_100283096 | 3300020074 | Freshwater Lake | MTRSTKQVPAFHADRSFPYVLVCSTLGTVISLAAVWISTALQVAPVLVA |
| Ga0126371_101846803 | 3300021560 | Tropical Forest Soil | MTRSKTRKVPPFSSDHPVPYVLVCSTFGTIVSLAVVWIVTAHSVAQAMVA |
| Ga0126371_108713883 | 3300021560 | Tropical Forest Soil | MTRSKTRKLPPFSSDHPFPYVLVCSTFGTVVSHAAIWIVAALSVAQAMVA |
| Ga0247796_10197682 | 3300023261 | Soil | MTRLKTRKVPQLSSDHPFPYVLVCSTFGTIISFAAVWIVTAHSVAQAMVA |
| Ga0247794_101518981 | 3300024055 | Soil | MTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQAIVA |
| Ga0209109_100229383 | 3300025160 | Soil | MTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTASSFAQAMVA |
| Ga0209172_101701422 | 3300025310 | Hot Spring Sediment | MTRSKPHKDPFSSDRSFPYVLLCSTLGTVVSLASVWIVTAHSVAQAMVA |
| Ga0209519_101888321 | 3300025318 | Soil | SGDLRTKAMTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTASSFAQAMVA |
| Ga0207678_114560361 | 3300026067 | Corn Rhizosphere | SDRSFPYVLVCSTFGTFVSLAFVWIVTIHSVAQAAVA |
| Ga0207537_1044741 | 3300026770 | Soil | MTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAGVWIVTAHSVAQAMVA |
| Ga0209887_10175831 | 3300027561 | Groundwater Sand | MTRSKSHKDPFSSDRSFPYVLVCSMLGTVVSVASVWIVTASSFAQAMVA |
| Ga0209077_11886151 | 3300027675 | Freshwater Sediment | MTRSKSHKVPPFSADRSFPYVLVCSMLGTVVSLASVWIVTAHSVAQAMVA |
| Ga0209583_102980072 | 3300027910 | Watersheds | MTRSTSHKVPQLSADHAFPYVLLCSTIGTLVSLASVWIMTAHSYAPVMVA |
| Ga0209889_10752961 | 3300027952 | Groundwater Sand | MTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTAHS |
| Ga0209859_10273052 | 3300027954 | Groundwater Sand | MVLSGDLRTKAMTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTAHSFAPAMV |
| Ga0209857_10023024 | 3300027957 | Groundwater Sand | MTRSKSHKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTASSFAQAMVA |
| Ga0307503_101181942 | 3300028802 | Soil | MTRSQFHKIPSFSADRSFPYVLVCSTLGSVLSLASVWLVTAHSVAQAMVA |
| Ga0299907_108057642 | 3300030006 | Soil | MTRSKSHNDPFSADRSFPYVLVCSMLGSIVSLASVWLVTVHSVAQAMIA |
| Ga0302046_111286191 | 3300030620 | Soil | DPFSTDRSFPYVLVCSLLGSVVSLASVWLVTAHSVAQAMVA |
| Ga0299914_100898873 | 3300031228 | Soil | MTRSKSHKDPFSSDRSFPYVLLCSTLGTVVSLASVWITTAQSVAQAMVA |
| Ga0299913_105855162 | 3300031229 | Soil | MTRPKSHKDPFSSDRSFPYVLLCSTLGTVVSLASVWIVTAQSVAQAMVA |
| Ga0307428_10446672 | 3300031280 | Salt Marsh | MSRSRSHKIPPFSADRSFPYVLVCSMLGTVVSLASVWIVTAHSFTQAMVV |
| Ga0307429_10092491 | 3300031368 | Salt Marsh | MSRSRSHRIPPFSADRSFPYVLVCSMLGTVVSLASVWIVTAHSFTQT |
| Ga0307429_10744561 | 3300031368 | Salt Marsh | IPPFSADRSFPYVLVCSMLGTVVSLASVWIVTAHSFTQAMVA |
| Ga0307429_11595192 | 3300031368 | Salt Marsh | MSRSRSHKIPPFSADRSFPYVLVCSMLGTVVSLASV |
| Ga0318541_102666801 | 3300031545 | Soil | SWARQLKEIAMTRSKTRKVPPFSSDHPFPYVLVCSTFGTIVSLAVVWIVTAHSVAQAMVA |
| Ga0310813_109034863 | 3300031716 | Soil | MTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAEAMVA |
| Ga0307473_108151062 | 3300031820 | Hardwood Forest Soil | SKTRKVPQFSSDHPFPYVLVCSTFGTIISLVAVWIVTAHSVAQAMVA |
| Ga0306923_101691855 | 3300031910 | Soil | AMTRSKTRKVPPFSSDHPFPYVLVCSTFGTIVSLAVVWIVTAHSVAQAMVA |
| Ga0310901_100934052 | 3300031940 | Soil | MTRSKTRKVPQFSSDHPFPYVLVCSTFGTIISLAAVWIVTAHSVAQ |
| Ga0214473_103493151 | 3300031949 | Soil | MTRSKSHKDPFSTDRSFPYVLVCSLLGSVVSLASVWLVTAHSVSQAMVA |
| Ga0214473_116053581 | 3300031949 | Soil | MTSSTTHQVPPLSADRSFPYVLLCSTFGTVISLATVWIMTAQSFAAVLTA |
| Ga0306920_1007607211 | 3300032261 | Soil | MTRSKTRKVPPFSSDHPFPYVLVCSTFGTIVSLAVVWIVTA |
| Ga0214471_112773312 | 3300033417 | Soil | MTRSKSRKVPPFSADRSFPYVLVCSMLGTVVSVASVWIVTAHSFAPVMVA |
| ⦗Top⦘ |