NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073367

Metagenome / Metatranscriptome Family F073367

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073367
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 40 residues
Representative Sequence RTPDITEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV
Number of Associated Samples 111
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.33 %
% of genes from short scaffolds (< 2000 bps) 88.33 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(18.333 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.35%    β-sheet: 0.00%    Coil/Unstructured: 67.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF12710HAD 26.67
PF07993NAD_binding_4 1.67
PF05973Gp49 1.67
PF09413DUF2007 1.67
PF08241Methyltransf_11 0.83
PF00501AMP-binding 0.83
PF13594Obsolete Pfam Family 0.83
PF13304AAA_21 0.83
PF12713DUF3806 0.83
PF08242Methyltransf_12 0.83
PF14534DUF4440 0.83
PF00180Iso_dh 0.83
PF13649Methyltransf_25 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 1.67
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 1.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.50 %
UnclassifiedrootN/A2.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001471|JGI12712J15308_10116947All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis680Open in IMG/M
3300001593|JGI12635J15846_10067997All Organisms → cellular organisms → Bacteria2646Open in IMG/M
3300001593|JGI12635J15846_10574632All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300002245|JGIcombinedJ26739_100667159All Organisms → cellular organisms → Bacteria → Acidobacteria917Open in IMG/M
3300002245|JGIcombinedJ26739_101773879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis517Open in IMG/M
3300002908|JGI25382J43887_10070061All Organisms → cellular organisms → Bacteria → Acidobacteria1895Open in IMG/M
3300004082|Ga0062384_100577816All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300004082|Ga0062384_100936383All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300004092|Ga0062389_100271509All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300005184|Ga0066671_10635366All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300005434|Ga0070709_11208425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis608Open in IMG/M
3300005439|Ga0070711_100546749All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300005542|Ga0070732_10933545All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005553|Ga0066695_10156464All Organisms → cellular organisms → Bacteria → Proteobacteria1421Open in IMG/M
3300005764|Ga0066903_100543213All Organisms → cellular organisms → Bacteria1989Open in IMG/M
3300006162|Ga0075030_100382721All Organisms → cellular organisms → Bacteria → Acidobacteria1121Open in IMG/M
3300006162|Ga0075030_101555154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis517Open in IMG/M
3300006791|Ga0066653_10356096All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300006806|Ga0079220_10503526All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
3300006893|Ga0073928_10498365All Organisms → cellular organisms → Bacteria → Acidobacteria874Open in IMG/M
3300006914|Ga0075436_100330934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1095Open in IMG/M
3300009038|Ga0099829_10514145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria994Open in IMG/M
3300009162|Ga0075423_10178780All Organisms → cellular organisms → Bacteria → Acidobacteria2227Open in IMG/M
3300009174|Ga0105241_12198970All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis547Open in IMG/M
3300009792|Ga0126374_11576227All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis542Open in IMG/M
3300010321|Ga0134067_10001647All Organisms → cellular organisms → Bacteria5215Open in IMG/M
3300010322|Ga0134084_10027919All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300010358|Ga0126370_12559461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis509Open in IMG/M
3300010359|Ga0126376_10337101All Organisms → cellular organisms → Bacteria → Acidobacteria1330Open in IMG/M
3300010366|Ga0126379_10755082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1070Open in IMG/M
3300010373|Ga0134128_10234818All Organisms → cellular organisms → Bacteria → Acidobacteria2059Open in IMG/M
3300010398|Ga0126383_10192033All Organisms → cellular organisms → Bacteria → Acidobacteria1952Open in IMG/M
3300010401|Ga0134121_11115113All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300011120|Ga0150983_10988520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis627Open in IMG/M
3300011269|Ga0137392_10416650All Organisms → cellular organisms → Bacteria → Acidobacteria1115Open in IMG/M
3300012199|Ga0137383_10035897All Organisms → cellular organisms → Bacteria → Acidobacteria3505Open in IMG/M
3300012205|Ga0137362_10899392All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300012205|Ga0137362_10939983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis737Open in IMG/M
3300012210|Ga0137378_11505185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis584Open in IMG/M
3300012351|Ga0137386_11107376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis559Open in IMG/M
3300012357|Ga0137384_10138326All Organisms → cellular organisms → Bacteria → Acidobacteria2039Open in IMG/M
3300012582|Ga0137358_10397426All Organisms → cellular organisms → Bacteria → Acidobacteria932Open in IMG/M
3300012582|Ga0137358_10573352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis758Open in IMG/M
3300012683|Ga0137398_10199552All Organisms → cellular organisms → Bacteria → Acidobacteria1318Open in IMG/M
3300012683|Ga0137398_11012263All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300012917|Ga0137395_10129075All Organisms → cellular organisms → Bacteria → Acidobacteria1712Open in IMG/M
3300012924|Ga0137413_10086435All Organisms → cellular organisms → Bacteria → Acidobacteria1920Open in IMG/M
3300012925|Ga0137419_10149139All Organisms → cellular organisms → Bacteria → Acidobacteria1686Open in IMG/M
3300012929|Ga0137404_12065889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis532Open in IMG/M
3300012929|Ga0137404_12335461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis501Open in IMG/M
3300012930|Ga0137407_11121368All Organisms → cellular organisms → Bacteria → Acidobacteria746Open in IMG/M
3300012931|Ga0153915_12138395All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300012960|Ga0164301_11551138All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis548Open in IMG/M
3300012982|Ga0168317_1117535All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300013306|Ga0163162_11420243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis790Open in IMG/M
3300013307|Ga0157372_10168782All Organisms → cellular organisms → Bacteria2531Open in IMG/M
3300014969|Ga0157376_11307756Not Available755Open in IMG/M
3300015241|Ga0137418_10095173All Organisms → cellular organisms → Bacteria → Acidobacteria2686Open in IMG/M
3300015373|Ga0132257_100567360All Organisms → cellular organisms → Bacteria → Acidobacteria1399Open in IMG/M
3300016270|Ga0182036_11802626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis518Open in IMG/M
3300016445|Ga0182038_11846697All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis546Open in IMG/M
3300017933|Ga0187801_10070858All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales1290Open in IMG/M
3300017942|Ga0187808_10258505All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300017959|Ga0187779_10081432All Organisms → cellular organisms → Bacteria → Acidobacteria1927Open in IMG/M
3300017972|Ga0187781_11009660All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae608Open in IMG/M
3300018085|Ga0187772_10062907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis2312Open in IMG/M
3300018433|Ga0066667_12219516All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis512Open in IMG/M
3300020004|Ga0193755_1196017All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium580Open in IMG/M
3300020140|Ga0179590_1071743All Organisms → cellular organisms → Bacteria → Acidobacteria913Open in IMG/M
3300020581|Ga0210399_10171840All Organisms → cellular organisms → Bacteria → Acidobacteria1797Open in IMG/M
3300020582|Ga0210395_11437385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis502Open in IMG/M
3300021477|Ga0210398_10968692All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis680Open in IMG/M
3300021478|Ga0210402_10637690All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300021560|Ga0126371_10455426All Organisms → cellular organisms → Bacteria → Acidobacteria1425Open in IMG/M
3300022504|Ga0242642_1033055All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300024284|Ga0247671_1040124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis725Open in IMG/M
3300025939|Ga0207665_10897982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis703Open in IMG/M
3300025942|Ga0207689_10396976Not Available1149Open in IMG/M
3300026298|Ga0209236_1009111All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis → Nannocystis exedens5886Open in IMG/M
3300026307|Ga0209469_1031981All Organisms → cellular organisms → Bacteria → Acidobacteria1761Open in IMG/M
3300026310|Ga0209239_1077500All Organisms → cellular organisms → Bacteria → Acidobacteria1442Open in IMG/M
3300026314|Ga0209268_1148550All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300026317|Ga0209154_1133475All Organisms → cellular organisms → Bacteria → Acidobacteria1043Open in IMG/M
3300026320|Ga0209131_1420535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis502Open in IMG/M
3300026333|Ga0209158_1157732All Organisms → cellular organisms → Bacteria → Acidobacteria827Open in IMG/M
3300026343|Ga0209159_1128607All Organisms → cellular organisms → Bacteria → Acidobacteria1050Open in IMG/M
3300026482|Ga0257172_1091140All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300026551|Ga0209648_10081832All Organisms → cellular organisms → Bacteria → Acidobacteria2693Open in IMG/M
3300027645|Ga0209117_1088808All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300027678|Ga0209011_1008103All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis → Nannocystis exedens3562Open in IMG/M
3300027727|Ga0209328_10137986All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300027729|Ga0209248_10182705All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300027765|Ga0209073_10118299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis952Open in IMG/M
3300027846|Ga0209180_10075180All Organisms → cellular organisms → Bacteria → Acidobacteria1900Open in IMG/M
3300027853|Ga0209274_10626647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis556Open in IMG/M
3300027853|Ga0209274_10757533Not Available500Open in IMG/M
3300028138|Ga0247684_1093656All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium502Open in IMG/M
3300028536|Ga0137415_11441543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis512Open in IMG/M
3300028806|Ga0302221_10450129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis561Open in IMG/M
3300028906|Ga0308309_10863108All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300030399|Ga0311353_10510953All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1063Open in IMG/M
3300031233|Ga0302307_10059389All Organisms → cellular organisms → Bacteria → Acidobacteria2029Open in IMG/M
3300031561|Ga0318528_10218784All Organisms → cellular organisms → Bacteria → Acidobacteria1020Open in IMG/M
3300031640|Ga0318555_10036645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis2423Open in IMG/M
3300031718|Ga0307474_11472130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis536Open in IMG/M
3300031720|Ga0307469_12024756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis559Open in IMG/M
3300031736|Ga0318501_10758249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis536Open in IMG/M
3300031740|Ga0307468_100577547All Organisms → cellular organisms → Bacteria → Acidobacteria912Open in IMG/M
3300031754|Ga0307475_10160977All Organisms → cellular organisms → Bacteria → Acidobacteria1786Open in IMG/M
3300031777|Ga0318543_10147368All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1033Open in IMG/M
3300031823|Ga0307478_10779594All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300031833|Ga0310917_10346913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1007Open in IMG/M
3300031890|Ga0306925_11409197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis687Open in IMG/M
3300031897|Ga0318520_10512561All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300031942|Ga0310916_10770946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis811Open in IMG/M
3300031947|Ga0310909_11302420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis584Open in IMG/M
3300032035|Ga0310911_10469076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis729Open in IMG/M
3300032205|Ga0307472_100523032All Organisms → cellular organisms → Bacteria → Acidobacteria1028Open in IMG/M
3300032954|Ga0335083_10241446All Organisms → cellular organisms → Bacteria → Acidobacteria1622Open in IMG/M
3300033004|Ga0335084_11025984All Organisms → cellular organisms → Bacteria → Acidobacteria830Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil18.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.17%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.50%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.50%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.50%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.67%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.83%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012982Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfieldEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12712J15308_1011694723300001471Forest SoilEPGQRAIGGAVFTELLREEMLRSLEHAERYGWGV*
JGI12635J15846_1006799733300001593Forest SoilTPDIMETGARASSTSGLMEILHEEMQRTLEHAERYGWGV*
JGI12635J15846_1057463223300001593Forest SoilRTPDIAEPGQRAIGGSVFTELLREEMLRSLEHAERYGWGV*
JGIcombinedJ26739_10066715913300002245Forest SoilAEPGQRAIGGSVFTELLREEMLRSLEHAERYGWGV*
JGIcombinedJ26739_10177387913300002245Forest SoilYRTPDIMETGARASSTSGLMEILHEEMQRTLEHAERYGWGV*
JGI25382J43887_1007006113300002908Grasslands SoilGGYRTPDITEPGARSVGGSVFTEVLREEMQRTFEHAERYGWGV*
Ga0062384_10057781613300004082Bog Forest SoilRTPDIIEPGARAIGGSAFMEILREEMQRTLEHAERYGWGV*
Ga0062384_10093638323300004082Bog Forest SoilAGGYRTPDIAQPGASTIAGSVFTEMLREEMQRTLEHAERYGWGV*
Ga0062389_10027150913300004092Bog Forest SoilRTTDIAGPGGRTVGGSVFTEMLREEMQRTLEHAERYGWGV*
Ga0066671_1063536623300005184SoilLSGGYRTPDLAAPGTKTVGTAGFMEILHDEMQRTLEHAERYGWGV*
Ga0070709_1120842523300005434Corn, Switchgrass And Miscanthus RhizosphereQSVVRVLQAGNRTPDLATPGTKPVGTTGFMDILHVEMQRTLEHAERYGWGV*
Ga0070711_10054674913300005439Corn, Switchgrass And Miscanthus RhizosphereSVVRVLSGGYRTPDLAGPGSKPIGTAGFMEILHQELQRTLEHAERYGWGV*
Ga0070732_1093354523300005542Surface SoilHRTPDITEPGARTVGGSIFTEILREEMQRTLEHAERYGWGV*
Ga0066695_1015646413300005553SoilADWIEQSVVRVLQDGNRTPDLAMPGAKPIGTTGFMDILHVEMQRTLEHAERYGWGV*
Ga0066903_10054321333300005764Tropical Forest SoilYRTPDLASPGSKPIGTSGFMEILHTELQRSLEHAERYGWGV*
Ga0075030_10038272113300006162WatershedsLSGGYRTPDIAEPGARTVTGSTFTEMLREEMQRTLEHAERYGWGV*
Ga0075030_10155515423300006162WatershedsAEKGSRAVGTHAFNEILREEMQRTLEHAERYGWGV*
Ga0066653_1035609613300006791SoilDLAMPGAKPIGTTGFMDILHVEMQRTLEHAERYGWGV*
Ga0079220_1050352613300006806Agricultural SoilRTSDLAAPGSKPIGTNGFMEILHVEMQRTLEHAERYGWGV*
Ga0073928_1049836523300006893Iron-Sulfur Acid SpringEPGARTVSGSAFTEMLREEMQRTLEHAERYGWGV*
Ga0075436_10033093413300006914Populus RhizosphereVVRVLQAGNRTPDLATPGAKPVGTTGFMEILHVEMQRTLEHAERYGWGV*
Ga0099829_1051414513300009038Vadose Zone SoilEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV*
Ga0075423_1017878033300009162Populus RhizosphereVVRVLSAGHRTPDLAAAGCKPIGTNGFMEVLHTEMQRTLEHAERYGWGV*
Ga0105241_1219897013300009174Corn RhizosphereGYRTPDLASPGFKPVGTAGFNETLHTEMQRTLEHAERYGWGV*
Ga0126374_1157622723300009792Tropical Forest SoilAGYRTPDIAEPKARLVRGSVFTEILREEMQRTFEHAERYGWGV*
Ga0134067_1000164743300010321Grasslands SoilEPGVRAVGGSVFTEILREEMQRTFEHAERYGWGV*
Ga0134084_1002791933300010322Grasslands SoilDITEPGARAVGGSVFTEVLREEMQRTFEHAERYGWGV*
Ga0126370_1255946123300010358Tropical Forest SoilGAGYRTPDLASPGSKPIGTTGFMEILHEEMQRTLEHAERYGWGV*
Ga0126376_1033710133300010359Tropical Forest SoilEQSVVRVLAAGHRTPDLAAPGSKTIGTSGFMEILHTEMQRTLEHAERYGWGV*
Ga0126379_1075508213300010366Tropical Forest SoilLAAPGSKAIGTSGFMEILHTEMQRTLEHAERYGWGV*
Ga0134128_1023481833300010373Terrestrial SoilAQPGASTSGGSVFTEMLREEMQRTLEHAERYGWGV*
Ga0126383_1019203333300010398Tropical Forest SoilAPGAKAVGTNGFMEILHVEMQRTLEHAERYGWGV*
Ga0134121_1111511313300010401Terrestrial SoilADIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV*
Ga0150983_1098852013300011120Forest SoilIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV*
Ga0137392_1041665023300011269Vadose Zone SoilVLSAGYRTPDIAEPNARAVGGSVFTEILKEEMQRTFEHAERYGWGV*
Ga0137383_1003589733300012199Vadose Zone SoilGGYRTPDLAAGGVKPVGTAGFMEILHEEMQRTLEHAERYGWGV*
Ga0137362_1089939223300012205Vadose Zone SoilITEPGARAVGGSMFTEILREEMQRTFEHAERYGWGV*
Ga0137362_1093998323300012205Vadose Zone SoilTPDITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV*
Ga0137378_1150518513300012210Vadose Zone SoilTEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV*
Ga0137386_1110737613300012351Vadose Zone SoilDWIEQSVVRVLQAGHRTPDLAMPGAKPVGMTGFMDILHVEMQRTLEHAERYGWGV*
Ga0137384_1013832623300012357Vadose Zone SoilRTPDIAEPKARVVGGSVFTEILREEMQRTFEHAERYGWGV*
Ga0137358_1039742613300012582Vadose Zone SoilDITEQGARAVGGSVFTEILREEMQRTFEHAERYGWGV*
Ga0137358_1057335223300012582Vadose Zone SoilTPDLVAAGAKPVGTAGFMEILHEEMQRTLEHAERYGWGV*
Ga0137398_1019955213300012683Vadose Zone SoilPDITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV*
Ga0137398_1101226313300012683Vadose Zone SoilTVDISDSSAHTVTGSAFVEMLRDEMQRTLEHAERYGWGV*
Ga0137395_1012907513300012917Vadose Zone SoilYRTPDIAENGARTVTGSAFTEMLREEMQRTLEHAERYGWGV*
Ga0137413_1008643513300012924Vadose Zone SoilAEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV*
Ga0137419_1014913913300012925Vadose Zone SoilTEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV*
Ga0137404_1206588913300012929Vadose Zone SoilRTPDITEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV*
Ga0137404_1233546123300012929Vadose Zone SoilTPDMASPGSKPIGTAGFMEILHGEMQRTLEHAERYGWGV*
Ga0137407_1112136813300012930Vadose Zone SoilITEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV*
Ga0153915_1213839523300012931Freshwater WetlandsGYRTPDIMEPGARTVGGSVFTEILREEMQRTFEHAERYGWGV*
Ga0164301_1155113823300012960SoilPDLAAPGCKPIGTNGFMEILHVEMQRTLEHAERYGWGV*
Ga0168317_111753523300012982Weathered Mine TailingsEPGARNVGGSAFAEILREEMQRTLEHAERYGWGV*
Ga0163162_1142024323300013306Switchgrass RhizosphereVRVLAGGYRTPDLAAPGCKPIGTNGFMEILQVEMQRTLEHAERYGWGV*
Ga0157372_1016878213300013307Corn RhizosphereIAGPGGRVVGGSIFTETLREEMQRTLEHAERYGWGV*
Ga0157376_1130775613300014969Miscanthus RhizosphereGPGGRIVPASVFTEMLREEMQRTLEHAERYGWGV*
Ga0137418_1009517343300015241Vadose Zone SoilPDIAEPGARTLSGSAFTEMLREEMQRTLEHAERYGWGV*
Ga0132257_10056736013300015373Arabidopsis RhizosphereAPGCKPIGTNGFMEILQVEMQRTLEHAERYGWGV*
Ga0182036_1180262613300016270SoilIAEPKARVVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0182038_1184669723300016445SoilYRTPDLAAPGCKPIGTNGFMEILHEEMQRTLEHAERYGWGV
Ga0187801_1007085813300017933Freshwater SedimentGYRTTDISEPGAKTVGGSVFTEILHEEMQRTFEHAEKYGWGV
Ga0187808_1025850513300017942Freshwater SedimentICAPGAKAVGGSVFTEILREEMQRTYEHAERYGWGV
Ga0187779_1008143213300017959Tropical PeatlandLNGYRTPDITEPAAKTVGTSAFMETLHEEMQRTLEHAERYGWGV
Ga0187781_1100966023300017972Tropical PeatlandVLAGGYRTVDLAEPGAKTVSGSAFTEILREEMQRTFEHAERYGWGV
Ga0187772_1006290723300018085Tropical PeatlandVLAGGYRTVDLAEPGARTVSGSAFTEILREEMQRTFEHAERFGWGV
Ga0066667_1221951623300018433Grasslands SoilGGYRTPDLIAAGAKPVGTAGFMEILHEEMQRTLEHAERYGWGV
Ga0193755_119601723300020004SoilDIAEPGARAVGGSVFTEILREEMLRTLEHAERYGWGV
Ga0179590_107174333300020140Vadose Zone SoilSGGYRTPDIAENGARTVTGSAFTEMLREEMQRTLEHAERYGWGV
Ga0210399_1017184013300020581SoilRRRYRTPDITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0210395_1143738513300020582SoilTPDISEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV
Ga0210398_1096869223300021477SoilYRTPDIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV
Ga0210402_1063769013300021478SoilPDIAQPGGSTIGGSVFTEMLREEMQRTLEHAERYGWGV
Ga0126371_1045542623300021560Tropical Forest SoilAEPKARVVGGSVFTEVLREEMQRTFEHAERYGWGV
Ga0242642_103305513300022504SoilRTPDISEPGARTVSGSAFTEMLREEMQRTLEHAERYGWGV
Ga0247671_104012413300024284SoilIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV
Ga0207665_1089798223300025939Corn, Switchgrass And Miscanthus RhizosphereLIGPGAKRVGTAGFMEILHDEMQRTLEHAERYGWGV
Ga0207689_1039697633300025942Miscanthus RhizosphereSDLAGPGGRIVAASVFTEMLREEMQRTLEHAERYGWGV
Ga0209236_100911153300026298Grasslands SoilITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0209469_103198113300026307SoilRTPDIAEPKARVVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0209239_107750023300026310Grasslands SoilSEPGVRAVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0209268_114855023300026314SoilISEPGVRAVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0209154_113347513300026317SoilDIAEPKSRIVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0209131_142053513300026320Grasslands SoilGYRTPDIAENGARTVTGSAFTEMLREEMQRTLEHAERYGWGV
Ga0209158_115773223300026333SoilPDIAEAGTRTVSGSAFTEMLREEMQRTLEHAERYGWGV
Ga0209159_112860713300026343SoilYRTPDIAEANARVVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0257172_109114023300026482SoilDIAEPGARTVSGSAFTEMLREEMQRTLEHAERYGWGV
Ga0209648_1008183233300026551Grasslands SoilRTPDITEQGARAVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0209117_108880813300027645Forest SoilLAGGYRTPDIVEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0209011_100810333300027678Forest SoilTPDITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0209328_1013798613300027727Forest SoilRTPDIMETGARASSTSGLMEILHEEMQRTLEHAERYGWGV
Ga0209248_1018270513300027729Bog Forest SoilAQPGASTIAGSVFTEMLREEMQRTLEHAERYGWGV
Ga0209073_1011829913300027765Agricultural SoilPTPDIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV
Ga0209180_1007518023300027846Vadose Zone SoilDITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0209274_1062664713300027853SoilDIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV
Ga0209274_1075753323300027853SoilSDIAGPGGRTVGGSVFTEMLREEMQRTLEHAERYGWGV
Ga0247684_109365613300028138SoilTADIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV
Ga0137415_1144154323300028536Vadose Zone SoilSEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0302221_1045012923300028806PalsaGYRTPDIIEPGAKAIGATAFMTILREEMQRTLEHAERYGWGV
Ga0308309_1086310823300028906SoilIDIAGLVGRSVGGSVFTEMLREEMQRTLEHAERYGWGV
Ga0311353_1051095313300030399PalsaAGGYRTPDIIEPGAKAIGATAFMTILREEMQRTLEHAERYGWGV
Ga0302307_1005938923300031233PalsaDIIEPGARAIGGAAFMEILREEMQRTLEHAERYGWGV
Ga0318528_1021878413300031561SoilRTPDIAEPKARVVGGSVFTEILGEEMQRTFEHAERYGWGV
Ga0318555_1003664513300031640SoilLSAGYRTPDIAEPKARVVGGSVFTEILREEMQRTFEHAERYGWGV
Ga0307474_1147213013300031718Hardwood Forest SoilGGYRTPDIIEPGARAVGGRAFMEILREEMQRTLEHAERYGWGV
Ga0307469_1202475613300031720Hardwood Forest SoilAGYRTPDLVSPGSKAIGRVGFMEILHTEMQRTLEHAERYGWGV
Ga0318501_1075824913300031736SoilDWVEQSITRTLAAGYRTPDLAAPGTKAIGTNGFMEILHEEMQRTLEHAERYGWGV
Ga0307468_10057754723300031740Hardwood Forest SoilYRTPDITEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV
Ga0307475_1016097723300031754Hardwood Forest SoilISGPGALIVAGSTFTEMLREEMQRTLEHAERYGWGV
Ga0318543_1014736813300031777SoilQSITRTLAAGYRTPDLAAPGTKSIGTNGFMEILHEEMQRTLEHAERYGWGV
Ga0307478_1077959413300031823Hardwood Forest SoilGGYRTPDIAEPGQRAIGGSVFTELLREEMLRSLEHAERYGWGV
Ga0310917_1034691323300031833SoilGHRTPDLAAPGSKAIGTSGFMEILHTEMQRTLEHAERYGWGV
Ga0306925_1140919713300031890SoilASPGSKTIGTNGFMEILHEEMQRTLEHAERYGWGV
Ga0318520_1051256113300031897SoilSEAGARTVGGSVFADILREELHRTLEHAERYGWGV
Ga0310916_1077094623300031942SoilRTPDLAAPGSKAIGTSGFMEILHTEMQRTLEHAERYGWGV
Ga0310909_1130242033300031947SoilSGGYRTPDLAGPGSRPVGAAGFMEILHQEMQRTLEHAERYGWGV
Ga0310911_1046907623300032035SoilRVLAAGHRTPDLAAPGSKAIGTSGFMEILHTEMQRTLEHAERYGWGV
Ga0307472_10052303223300032205Hardwood Forest SoilPDISENGARTVTGSAFTEMLREEMQRTLEHAERYGWGV
Ga0335083_1024144633300032954SoilDLAAPGTKAIGANGFMEVLHAEMQRTLEHAERYGWGV
Ga0335084_1102598413300033004SoilLVNGFRTPDIAEPLGKTVGTTSFMEHLHEEMQRTLEHAERYGWGV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.