| Basic Information | |
|---|---|
| Family ID | F073366 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PNKRLKLAGGDRFKGSGVLCPGGHGLSSNGLAPAGESPAA |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 38.14 % |
| % of genes near scaffold ends (potentially truncated) | 76.67 % |
| % of genes from short scaffolds (< 2000 bps) | 78.33 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (66.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (82.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF12158 | DUF3592 | 7.50 |
| PF00583 | Acetyltransf_1 | 4.17 |
| PF14534 | DUF4440 | 2.50 |
| PF07311 | Dodecin | 1.67 |
| PF12681 | Glyoxalase_2 | 1.67 |
| PF07045 | DUF1330 | 1.67 |
| PF03544 | TonB_C | 1.67 |
| PF15631 | Imm-NTF2-2 | 1.67 |
| PF03681 | Obsolete Pfam Family | 1.67 |
| PF00561 | Abhydrolase_1 | 0.83 |
| PF01965 | DJ-1_PfpI | 0.83 |
| PF14317 | YcxB | 0.83 |
| PF00313 | CSD | 0.83 |
| PF09413 | DUF2007 | 0.83 |
| PF14485 | DUF4431 | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| PF14279 | HNH_5 | 0.83 |
| PF08327 | AHSA1 | 0.83 |
| PF04191 | PEMT | 0.83 |
| PF04229 | GrpB | 0.83 |
| PF12680 | SnoaL_2 | 0.83 |
| PF00293 | NUDIX | 0.83 |
| PF13857 | Ank_5 | 0.83 |
| PF04993 | TfoX_N | 0.83 |
| PF13730 | HTH_36 | 0.83 |
| PF04365 | BrnT_toxin | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.67 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.67 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.67 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.83 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.83 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.83 % |
| Unclassified | root | N/A | 9.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002561|JGI25384J37096_10020269 | All Organisms → cellular organisms → Bacteria | 2589 | Open in IMG/M |
| 3300002561|JGI25384J37096_10138417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 792 | Open in IMG/M |
| 3300002562|JGI25382J37095_10016287 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
| 3300002908|JGI25382J43887_10291653 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300002908|JGI25382J43887_10296624 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 710 | Open in IMG/M |
| 3300005166|Ga0066674_10027548 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300005167|Ga0066672_10476922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methyloglobulus → unclassified Methyloglobulus → Methyloglobulus sp. | 812 | Open in IMG/M |
| 3300005171|Ga0066677_10230714 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1045 | Open in IMG/M |
| 3300005172|Ga0066683_10240069 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1123 | Open in IMG/M |
| 3300005174|Ga0066680_10505251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300005174|Ga0066680_10842505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella terrae | 548 | Open in IMG/M |
| 3300005175|Ga0066673_10301936 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 933 | Open in IMG/M |
| 3300005176|Ga0066679_10604291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 715 | Open in IMG/M |
| 3300005178|Ga0066688_10244297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_13_63_9 | 1148 | Open in IMG/M |
| 3300005178|Ga0066688_10299153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300005178|Ga0066688_10703980 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 641 | Open in IMG/M |
| 3300005178|Ga0066688_10738174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
| 3300005179|Ga0066684_10440795 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300005180|Ga0066685_10743347 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005447|Ga0066689_10287048 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300005450|Ga0066682_10015977 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4127 | Open in IMG/M |
| 3300005540|Ga0066697_10598028 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005552|Ga0066701_10136757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1465 | Open in IMG/M |
| 3300005552|Ga0066701_10194055 | Not Available | 1242 | Open in IMG/M |
| 3300005552|Ga0066701_10395375 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 855 | Open in IMG/M |
| 3300005552|Ga0066701_10624887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300005553|Ga0066695_10056249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2348 | Open in IMG/M |
| 3300005553|Ga0066695_10501492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300005553|Ga0066695_10591329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 667 | Open in IMG/M |
| 3300005554|Ga0066661_10105027 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1693 | Open in IMG/M |
| 3300005554|Ga0066661_10170643 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1338 | Open in IMG/M |
| 3300005554|Ga0066661_10384957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300005554|Ga0066661_10494326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300005554|Ga0066661_10584405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 665 | Open in IMG/M |
| 3300005554|Ga0066661_10664746 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300005555|Ga0066692_10160825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1385 | Open in IMG/M |
| 3300005555|Ga0066692_10598351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 693 | Open in IMG/M |
| 3300005556|Ga0066707_10593109 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005556|Ga0066707_10734621 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 615 | Open in IMG/M |
| 3300005556|Ga0066707_10872662 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005557|Ga0066704_10094508 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300005558|Ga0066698_10206799 | Not Available | 1344 | Open in IMG/M |
| 3300005559|Ga0066700_10039980 | All Organisms → cellular organisms → Bacteria | 2817 | Open in IMG/M |
| 3300005559|Ga0066700_10198861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1383 | Open in IMG/M |
| 3300005560|Ga0066670_10329918 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005560|Ga0066670_10631575 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005561|Ga0066699_11266438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300005568|Ga0066703_10002954 | All Organisms → cellular organisms → Bacteria | 7086 | Open in IMG/M |
| 3300005568|Ga0066703_10009275 | All Organisms → cellular organisms → Bacteria | 4655 | Open in IMG/M |
| 3300005568|Ga0066703_10185097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_13_63_9 | 1260 | Open in IMG/M |
| 3300005568|Ga0066703_10223848 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300005568|Ga0066703_10612409 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005568|Ga0066703_10798533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300005574|Ga0066694_10243068 | Not Available | 853 | Open in IMG/M |
| 3300005576|Ga0066708_10926201 | Not Available | 543 | Open in IMG/M |
| 3300005598|Ga0066706_10015043 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4474 | Open in IMG/M |
| 3300006031|Ga0066651_10026504 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
| 3300006031|Ga0066651_10329519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300006032|Ga0066696_10210390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300006046|Ga0066652_101223512 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300006791|Ga0066653_10406624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300006796|Ga0066665_10612787 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006796|Ga0066665_11378625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300006797|Ga0066659_10309482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella terrae | 1209 | Open in IMG/M |
| 3300006797|Ga0066659_10779589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 789 | Open in IMG/M |
| 3300006797|Ga0066659_10837483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 764 | Open in IMG/M |
| 3300006797|Ga0066659_11185902 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 638 | Open in IMG/M |
| 3300006800|Ga0066660_10744577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300009137|Ga0066709_100405871 | Not Available | 1891 | Open in IMG/M |
| 3300010304|Ga0134088_10206992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 940 | Open in IMG/M |
| 3300010329|Ga0134111_10105817 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300010333|Ga0134080_10058813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1524 | Open in IMG/M |
| 3300012198|Ga0137364_10858240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300012199|Ga0137383_10505327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Solimicrobium → Solimicrobium silvestre | 885 | Open in IMG/M |
| 3300012206|Ga0137380_10039147 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4372 | Open in IMG/M |
| 3300012207|Ga0137381_10019324 | All Organisms → cellular organisms → Bacteria | 5372 | Open in IMG/M |
| 3300012207|Ga0137381_11160513 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 664 | Open in IMG/M |
| 3300012207|Ga0137381_11671228 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012208|Ga0137376_10654831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300012209|Ga0137379_10182372 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300012209|Ga0137379_10511658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300012209|Ga0137379_11084019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 706 | Open in IMG/M |
| 3300012210|Ga0137378_10031532 | All Organisms → cellular organisms → Bacteria | 4698 | Open in IMG/M |
| 3300012210|Ga0137378_11397206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfospira → Desulfospira joergensenii | 614 | Open in IMG/M |
| 3300012285|Ga0137370_10341313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300012349|Ga0137387_10016556 | All Organisms → cellular organisms → Bacteria | 4484 | Open in IMG/M |
| 3300012349|Ga0137387_10542307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300012351|Ga0137386_10994143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300012357|Ga0137384_10852725 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 735 | Open in IMG/M |
| 3300012359|Ga0137385_10644756 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012918|Ga0137396_10216049 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300012976|Ga0134076_10005247 | All Organisms → cellular organisms → Bacteria | 4237 | Open in IMG/M |
| 3300012977|Ga0134087_10007028 | All Organisms → cellular organisms → Bacteria | 3722 | Open in IMG/M |
| 3300018482|Ga0066669_10639002 | Not Available | 935 | Open in IMG/M |
| 3300026296|Ga0209235_1209832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300026307|Ga0209469_1020123 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
| 3300026309|Ga0209055_1247888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 550 | Open in IMG/M |
| 3300026313|Ga0209761_1033051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3080 | Open in IMG/M |
| 3300026315|Ga0209686_1038939 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300026316|Ga0209155_1037498 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
| 3300026316|Ga0209155_1103936 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300026326|Ga0209801_1123798 | Not Available | 1107 | Open in IMG/M |
| 3300026326|Ga0209801_1162324 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 934 | Open in IMG/M |
| 3300026327|Ga0209266_1031967 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 2777 | Open in IMG/M |
| 3300026332|Ga0209803_1051669 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300026333|Ga0209158_1118251 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300026334|Ga0209377_1010144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5324 | Open in IMG/M |
| 3300026335|Ga0209804_1328299 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
| 3300026523|Ga0209808_1286795 | Not Available | 528 | Open in IMG/M |
| 3300026524|Ga0209690_1056866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1722 | Open in IMG/M |
| 3300026529|Ga0209806_1021000 | All Organisms → cellular organisms → Bacteria | 3353 | Open in IMG/M |
| 3300026529|Ga0209806_1120798 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300026538|Ga0209056_10034667 | All Organisms → cellular organisms → Bacteria | 4707 | Open in IMG/M |
| 3300026538|Ga0209056_10034921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4686 | Open in IMG/M |
| 3300026538|Ga0209056_10664515 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300026547|Ga0209156_10144587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1154 | Open in IMG/M |
| 3300027748|Ga0209689_1295579 | Not Available | 630 | Open in IMG/M |
| 3300028536|Ga0137415_10414915 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 66.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.17% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25384J37096_100202695 | 3300002561 | Grasslands Soil | MPNKRLKLAGGDRSKGSGVLCPGGHGLSSHTTALAGESPAAYARSVR |
| JGI25384J37096_101384172 | 3300002561 | Grasslands Soil | NTRLKLAGGDRSEGTGVFVPGGHGLSSNSLASAGESPAA* |
| JGI25382J37095_100162873 | 3300002562 | Grasslands Soil | MPNKRLKLAGGDRSKGSGVLCPGGHGLSSHTTALAGESPAAYARSVRRPVGNRGQQ* |
| JGI25382J43887_102916531 | 3300002908 | Grasslands Soil | MPNKRLKLAGGDRSKGSGVLCPGGHGLSSHTTALAGESPAAYARSV |
| JGI25382J43887_102966241 | 3300002908 | Grasslands Soil | RLSNKRLKLTGGDRLKGSGVLCPGGHGLSSNGLAPNCGSPAA* |
| Ga0066674_100275486 | 3300005166 | Soil | PNKRLKLPGGDRFKGSGVLCPGGHGLPSKTLAPASGSPAA* |
| Ga0066672_104769222 | 3300005167 | Soil | IVNGTPPNKRLKLPGADRSKRIGVLCPGGHALTATTLAPASESPAA* |
| Ga0066677_102307142 | 3300005171 | Soil | PNKRLKLAGGDRSKGSGVLCPGGHGLSSITLAPAGEAPAA* |
| Ga0066683_102400693 | 3300005172 | Soil | PNKRLKLPGGDRSKGSGVLCPGGHGLSSISLAPASESPAA* |
| Ga0066680_105052511 | 3300005174 | Soil | VLPNKRLKLAGGYRFNGIGVLCPGGHGLSSHILAPAGASPAA* |
| Ga0066680_108425052 | 3300005174 | Soil | VLPNKRLKLAGGYRFNGIGVLCPGGHGLSSHILAPAGASP |
| Ga0066673_103019361 | 3300005175 | Soil | MSRRALPNMRLKLTGADRSKGTGVLCPGGHGLSSNGLAPAGGSPAA* |
| Ga0066679_106042911 | 3300005176 | Soil | MIVPSWRALPNKRLKLAGGDRFKGSGVWCPGGHGLSSHILAPAGESPAA* |
| Ga0066688_102442972 | 3300005178 | Soil | PLLSRHGQPPNKRLKLAGGDRFRGSGVLCPGGHGLSSNTLAPAGESPAA* |
| Ga0066688_102991533 | 3300005178 | Soil | VPPNKRLKLTGGDRSKGSGVLCPGGHGLSSNGVAPAGGSPAA* |
| Ga0066688_107039802 | 3300005178 | Soil | NKRLKLAGGDRSKGSGVLCPGGHGLSSHILAPAGESPAA* |
| Ga0066688_107381742 | 3300005178 | Soil | MAPNKLLKLAGANRFKGSGVLCPGGHGLSSNTLAPARGSP |
| Ga0066684_104407952 | 3300005179 | Soil | MAVSLGLWRTALPNMRLKLAGADRFKGNGVLCPGGHGLSSNTLAPA |
| Ga0066685_107433471 | 3300005180 | Soil | TKVVSESRPNKRLKLAGGDRLNGSGALCPGGHGLSSNTLAPAGESPAA* |
| Ga0066689_102870483 | 3300005447 | Soil | VTPADKGRLPNKRLKLPGGDRLKGSGVLCPGGHELSFKILASAGGSPAA* |
| Ga0066682_100159773 | 3300005450 | Soil | MRRMGLPNKRLKLAGGDRFKGIGVLCPGGHGLSSNTLAPASESPAA* |
| Ga0066697_105980281 | 3300005540 | Soil | VIIRLPLPNKRLKLAGGDRPRGSGVLCPGGLGLSSNTLAPASESPA |
| Ga0066701_101367571 | 3300005552 | Soil | RLKLAGGDRSGETERLRPGGRGLSSHILAPAAESPAA* |
| Ga0066701_101940554 | 3300005552 | Soil | MLLPNKRLKLTGGDRSKGSGVLCPGGHGLSSNGVAPAG |
| Ga0066701_103953751 | 3300005552 | Soil | AMLLPNKRLKLTGGDRSKGSGVLCPGGHGLSSNGVAPAGASPAA* |
| Ga0066701_106248871 | 3300005552 | Soil | AMLLPNKRLKLTGGDRSKGSGVLCPGGHGLSSNGVAPAGGSPAA* |
| Ga0066695_100562494 | 3300005553 | Soil | MGLPNKRLKLAGGDRFKGIGVLCPGGHGLSSNTLAPASESPAA* |
| Ga0066695_105014921 | 3300005553 | Soil | PPNKRLKLAGGDRFKGSGVLCPGGHGLSSHILAPAGESPAR* |
| Ga0066695_105913292 | 3300005553 | Soil | MAPNKRLKLAGANRFKGSQVLCPGGHGLSSNTLASANGS |
| Ga0066661_101050271 | 3300005554 | Soil | LAGGDRFKGSGVLCPGGHGLSSTTLAPTGESPAA* |
| Ga0066661_101706431 | 3300005554 | Soil | NKRLKLAGADRLKGSGVLCPGGHGLSSNGLAPAGGSPAA* |
| Ga0066661_103849572 | 3300005554 | Soil | PNKRLKLAGGDRFKGNGVLCPGGHGLSSNTLAPAGGSPAA* |
| Ga0066661_104943262 | 3300005554 | Soil | VLPNKRLKLTGGDRFKGSGVLCPGGHELSSNGLAPAGGSPAA* |
| Ga0066661_105844052 | 3300005554 | Soil | PNKRLKLTGGDRSKGSGVLCPGGHGLSSNGVAPAGGSPAA* |
| Ga0066661_106647462 | 3300005554 | Soil | LTGGDRSKGTGMLCPGGHGLSSDGLAPAGGSPAA* |
| Ga0066692_101608251 | 3300005555 | Soil | LPPNKRLKLAGGDRFKGSGVLCPGGHGLSSHILAPAGESPAR* |
| Ga0066692_105983512 | 3300005555 | Soil | MLSAASDVPPNKRLKLAGGDRLKGSGVLCPGGHGLSSNTLAPAGGSPAA* |
| Ga0066707_105931092 | 3300005556 | Soil | ALPNKRLKLAGADRFNGSGVLCPVGHGLTSHTLAPPSGSPAA* |
| Ga0066707_107346212 | 3300005556 | Soil | VSFDVLGKYANGLPNKRLKLAGADRLKGSGVLCPGGHGLSSNGLAPAGGSPAA* |
| Ga0066707_108726623 | 3300005556 | Soil | ARPNKRLKLAGGDRSKGSGVLCPGGHALSSTPLAPAGEAPAA* |
| Ga0066704_100945083 | 3300005557 | Soil | MPLPNKRLKLTGGDRSKGSGVFCPGAHRLTPSDLAPACESPRSLSAIR* |
| Ga0066698_102067992 | 3300005558 | Soil | MRLKLAGGDRFKGSGVFPPCGRGLSAIGLAPASESPAA* |
| Ga0066700_100399806 | 3300005559 | Soil | MPPNKRLKLAGGDRLKGSGVLCPGGHGLSSNTLAPAGGSP |
| Ga0066700_101988613 | 3300005559 | Soil | VSFDVLGKYANGLPNKRLKLAGADRLKGSGVLCPGGHGLSSNGLAPAGGSPAA |
| Ga0066670_103299184 | 3300005560 | Soil | PPNKRLKLAGGDRSKGSGVLCPGEQGLSSTILAPAGASPAA* |
| Ga0066670_106315751 | 3300005560 | Soil | PNKRLKLAGGDRFKGSGVLCPGGHGLSSNGLAPAGESPAA* |
| Ga0066699_112664381 | 3300005561 | Soil | VLGKYANGLPNKRLKLAGADRLKGSGVLCPGGHGLSSNGLAPAGGSPA |
| Ga0066703_1000295414 | 3300005568 | Soil | VVVTLLPNKRLKLAGGERSKGSGVLCPGGHGLSSHGLAPAGGSPAA* |
| Ga0066703_100092759 | 3300005568 | Soil | MPPNKRLKLAGGDRLKGSGVLCPGGHGLSSNTLAPAGG |
| Ga0066703_101850971 | 3300005568 | Soil | PNKRLKLAGGDRFRGSGVLCPGGHGLSSNTLAPAGESPAA* |
| Ga0066703_102238481 | 3300005568 | Soil | PLPNKRLKLTGGDRSKGSGVFCPGADRLTPSDLAPACESPRSLSAIR* |
| Ga0066703_106124091 | 3300005568 | Soil | VCGRLAPNKRLKLAGGDRFRGSGVLCPGGHGLSSNTLAPAGESPA |
| Ga0066703_107985332 | 3300005568 | Soil | VTISAIRRVAPNKRLKLTGGGRFKGSGVLCPGGHGLSSTTLAP |
| Ga0066694_102430683 | 3300005574 | Soil | MSRRALPNMRLKLTGADRSKGTGVLCPGGHGLSSNGLAP |
| Ga0066708_109262012 | 3300005576 | Soil | RLKLAGGDRSKGSGVLCPGGHGLTSNGLAPAGGSPAV* |
| Ga0066706_100150433 | 3300005598 | Soil | MRLKLAGGDRFKGSGVFPPGGRGLSAIGLAPASESPAA* |
| Ga0066651_100265046 | 3300006031 | Soil | VVSSRPNKRLKLTGGDRFKGSGVLCPGGHELSSNGLAPAGGSPAA* |
| Ga0066651_103295192 | 3300006031 | Soil | LPNKRLKLPGGDRSKGSGVLCPGGHGLSSNTLALASGSPAA* |
| Ga0066696_102103905 | 3300006032 | Soil | AIVNGTPPNKRLKLAGADRSKRIGVLCPGGHALTATTLAPASESPAA* |
| Ga0066652_1012235122 | 3300006046 | Soil | MKRTPPNKRLKLAGADRSKGSGVLSSWRGTDCATTLALVGGTPAA* |
| Ga0066653_104066241 | 3300006791 | Soil | MLLPNKRLKLAGADRFKGSGVLCPGGHGLSSHTLARAGDSPAA* |
| Ga0066665_106127872 | 3300006796 | Soil | MLAPNKRLKLAGGDRFNGTGVLCAGAHELSFNELRPAGESPAA* |
| Ga0066665_113786252 | 3300006796 | Soil | ARGATSGQLGVVLPNKRLKLTGGDRSNGNGVLCPWRGTDCRPLHLAPAGESPAA* |
| Ga0066659_103094823 | 3300006797 | Soil | VLPNKRLKLAGGYRFNGIGVLCPGGHGLSSHILAPAGASPA |
| Ga0066659_107795891 | 3300006797 | Soil | PPNKRLKLAGGDRSEGSGVLCDGGHGLSSNTLAPAGESPAA* |
| Ga0066659_108374832 | 3300006797 | Soil | KLTGDDRSKGNGVLCPGGHGLSSNTLAPVGESPAA* |
| Ga0066659_111859022 | 3300006797 | Soil | PNKRLKLAGADRLKGSGVLCPGGHGLSSNGLAPAGGSPAA* |
| Ga0066660_107445772 | 3300006800 | Soil | KLAGGDRFKGSGVLCPGGHGLSSHGLARAGESPAA* |
| Ga0066709_1004058711 | 3300009137 | Grasslands Soil | MPLPNKRLKLAGVYRLSGSGVLCPGGHGLSSTTLAP |
| Ga0134088_102069921 | 3300010304 | Grasslands Soil | VKLLPNNRLKMPGAARSKGSGVLCPGGHGLSSNGLAPAGESPAAYARSVRL |
| Ga0134111_101058171 | 3300010329 | Grasslands Soil | KLAGGDRFKGNRVLCAGAHDLSFNGLAPAGGSPAA* |
| Ga0134080_100588133 | 3300010333 | Grasslands Soil | PNKRLKLTGGDRFKGSGVLCPGGHGLSSHILAPAGESPAR* |
| Ga0137364_108582403 | 3300012198 | Vadose Zone Soil | MEPPNKRLKLAGGDRFKGNGVLCPGRHGLSSNTLAPAGES |
| Ga0137383_105053272 | 3300012199 | Vadose Zone Soil | NKRLKLAGGDRFKGSGVLCPGGHGLSSNSLAPVGGSPAA* |
| Ga0137380_100391475 | 3300012206 | Vadose Zone Soil | VGRAPNKRLKLAGGDRPRESECCALTGHGLWSTTLAPAGGSPAA* |
| Ga0137380_100705381 | 3300012206 | Vadose Zone Soil | MNCVPLPNKRLKLTGADRSKGSGVLCPWRGHGLTSTDLAPAGGS |
| Ga0137381_100193241 | 3300012207 | Vadose Zone Soil | KRLTLAGDHRFNGSGVLCPGVYGLSSNGLAPEGGSPAV* |
| Ga0137381_111605131 | 3300012207 | Vadose Zone Soil | LPNKRLKLTGGDRSKGSGVLCPGGHGLTSTTLVPAGETPAA* |
| Ga0137381_116712281 | 3300012207 | Vadose Zone Soil | VEFIERAPNKRLKLAGGDRSKGSGVLCPGGHGLSSDGLAPAG |
| Ga0137376_106548311 | 3300012208 | Vadose Zone Soil | PNKRLKLTGGDRSKGSGVLCPGGHGLSSTGLAPAGESPAA* |
| Ga0137379_101823722 | 3300012209 | Vadose Zone Soil | VKLLPNKRLKLAGGDRFKGSGVLCPGGHGLSANGLAPAAESPAA* |
| Ga0137379_105116581 | 3300012209 | Vadose Zone Soil | KGAAKELRTMKLLPNKRLKLTGGDRFKGNGVLCPWRGTGRSSTRLAPARESPAA* |
| Ga0137379_110840192 | 3300012209 | Vadose Zone Soil | MTALPNKRLKLAGGGRSKGSGGLCPGGYGLSSSTLAPAGGSPAA |
| Ga0137378_100315329 | 3300012210 | Vadose Zone Soil | MNCVPLPNKRLKLTGADRSKGSGVLCPWRGHGLTSTDLAPAGGSPAA* |
| Ga0137378_113972062 | 3300012210 | Vadose Zone Soil | PPNKRLKLSGGDRSNGIGVLCPGGHGLSSNTLAPAAESPAA* |
| Ga0137370_103413131 | 3300012285 | Vadose Zone Soil | MAPNKRLKLAGGDRSKGSGVLCPGGHGLSSNTLAPAGGSPAA |
| Ga0137387_100165563 | 3300012349 | Vadose Zone Soil | VGWAPNKRLKLAGGDRHRESECCALTGHGLWSTTLAPAGGSPAA* |
| Ga0137387_105423071 | 3300012349 | Vadose Zone Soil | MCRPPNKRLKLAGGDRFKGNGVLCPGGHGLSSNGLAP |
| Ga0137386_109941432 | 3300012351 | Vadose Zone Soil | PNKRLKLAGGDRSKGTGVLCPGGHGLSSNTLAPAGESPAA* |
| Ga0137384_108527251 | 3300012357 | Vadose Zone Soil | LRAELPNKRLKLAGVYRLDGSGVLCPDGHGLSSNGLAPAGE |
| Ga0137385_106447561 | 3300012359 | Vadose Zone Soil | PPNKRLKLTGGDRFEGSGVLCPGGHGLSSHTRVPAGEAPAA* |
| Ga0137396_102160493 | 3300012918 | Vadose Zone Soil | MALLPNKRLKLAGADRSKGSGVLCPGGHGLTSTTLAPPGGSPA |
| Ga0134076_100052475 | 3300012976 | Grasslands Soil | MQPPNKRLKLTGGNRSKGSGVLCPGKHGLSSHTLAPAGGSPAA* |
| Ga0134087_100070286 | 3300012977 | Grasslands Soil | VRLPPNKRLKLAGGDRFKGSGVLCPGGHGLSSHILAPAGESPA |
| Ga0066669_106390022 | 3300018482 | Grasslands Soil | MRAAPNKNVKLAGVDRSNGNGVLCLGGHGLSFNTLAPAGGAP |
| Ga0209235_12098321 | 3300026296 | Grasslands Soil | VRLPPNKRLKLAGGDRFKGSGVLCPGGHGLSSHILAPAGESPAR |
| Ga0209469_10201235 | 3300026307 | Soil | MGLPNKRLKLAGGDRFKGIGVLCPGGHGLSSNTLAPASESPAA |
| Ga0209055_12478881 | 3300026309 | Soil | MLLPNKRLKLAGGDRFKRSGVLCPSGHGLSSNTLAPAG |
| Ga0209761_10330516 | 3300026313 | Grasslands Soil | MPLPNKRLKLTGGDRSKGSEVLCPGAHRLTSSDLAPACESPAA |
| Ga0209686_10389395 | 3300026315 | Soil | GTWGPKPVLPNKRLKLAGGYRFNGIGVLCPGGHGLSSHILAPAGASPAA |
| Ga0209155_10374981 | 3300026316 | Soil | VRVLPNKRLKLTGGDRSKGSGVLCPGGRGLTSNGLAPAGESPAA |
| Ga0209155_11039361 | 3300026316 | Soil | MMPPNKRLKLSGGERCKGNGALCPGGHGLSSHTLAPASGS |
| Ga0209801_11237981 | 3300026326 | Soil | MKNRSMPPNKRLKLTGGNRSKGSGVLCPGGHGLSSNGLAPASRSP |
| Ga0209801_11623242 | 3300026326 | Soil | HCVMSCVRVLPNNRLKLTGGDRSKGSGVLCPGGRGLTSNGLAPAGESPAA |
| Ga0209266_10319671 | 3300026327 | Soil | PNKRLKLAGGDRFKGIGVLCPGGHGLSSNGLAPASESPAA |
| Ga0209803_10516691 | 3300026332 | Soil | VTPADKGRLPNKRLKLPGGDRLKGSGVLCPGGHELSFKILASAGGSPAA |
| Ga0209158_11182511 | 3300026333 | Soil | VGVAMPLPNKRLKLTGGDRSKGSGVFCPGADRLTPSDLAPACESPRSLSAIR |
| Ga0209377_10101448 | 3300026334 | Soil | GSVEKQPPNKRLKLAGGDRFRGSGVLCPGGHGLSSNTLAPAGESPAA |
| Ga0209804_13282991 | 3300026335 | Soil | LGKYANGLPNKRLKLAGADRLKGSGVLCPGGHGLSSNGLAPAGGSPAA |
| Ga0209808_12867951 | 3300026523 | Soil | VTIALPNKRLKLTGGDRSSGIGVLCPGGHGLSSNTLAPPSESP |
| Ga0209690_10568661 | 3300026524 | Soil | VIIQLPLPNKRLKLAGGDRSKGNGVLCPGGHGLSSIT |
| Ga0209806_10210006 | 3300026529 | Soil | VVVTLLPNKRLKLAGGERSKGSGVLCPGGHGLSSHGLAPAGGSPAA |
| Ga0209806_11207981 | 3300026529 | Soil | MPPNKRLKLAGGDRLKGSGVLCPGGHGLSSNTLAPAG |
| Ga0209056_100346679 | 3300026538 | Soil | VRRDAAKVLPNKRLKVTGGDRFQGSGVLCPGGHGLSSHTLAAAGESPAA |
| Ga0209056_100349212 | 3300026538 | Soil | MWRIRPLPNKRLKLAGGDRLKGNGALCPGGHRLSSTTLAPASESPAA |
| Ga0209056_100383491 | 3300026538 | Soil | RPNKRLKLPGGDRFKGIGVLCPWRGTDFVHTLAPAGESPAA |
| Ga0209056_106645151 | 3300026538 | Soil | MKSPPNKRLKLAGGDRLKGSGVLCPGGYGLSSTTLA |
| Ga0209156_101445873 | 3300026547 | Soil | SEPPNKRLKLAGGDRFEGSGVLCAGGHGLSSNTLAPAGESPAA |
| Ga0209689_12955791 | 3300027748 | Soil | VLGKYANGLPNKRLKLAGADRLKGSGVLCPGGHGLSSNGLA |
| Ga0137415_104149153 | 3300028536 | Vadose Zone Soil | MCGCMPNMRLKLAGRDRFKRSGVLCPVPGHGLSSTALA |
| ⦗Top⦘ |